Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000786 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000786
Unique NameTCONS_00000786
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length5437

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000786 ID=TCONS_00000786|Name=TCONS_00000786|organism=Clytia hemisphaerica|type=transcript|length=5437bp
ATTTGACAATATGCTCCAGCAACGAGCAAGaataaacaaagattttacAG
ATCTTCTAACGGCAATCCCAGATGAAGAGATTGATGATAGAGAGAAACTG
ATACACCGTTTAACCATTATGATAGCTCGTGCACTTCCAGATCCAATCAA
AACACAGGAACATTTGAAAAAACTGATTGTCTTATTATCAGACAAAACCA
CGTATAAATTATTCAGTGAATCGACTGATTTAAAACAGGACTGTactaaa
ataattaaatgtgtATCAGAGATAGTTAAAAAATTATCTGGGAAACATCC
CATAATAGACACAGTAAAATGCTTATTAGATCGTGCTTGTCCAATGTTGG
TGGACCAGACAAGCTTTGTTAGCTTGatacgaaaaatgaaaaactactTT
GAAGGGATGGCAGATGATGAAGATGACGATTTATCTGAAGATGAACTTGC
TTTGAAAGCTAAAAAATGTCTTAAATTGATCCAGGTGTTGGTGAAAGTGA
GACCATCCATATTCCAAACGAAACAAGCTTACGAAACTTTCTTAGTTTTC
CTCAAACACAATGATCCAGAAATTgTACAGCAATCCTTAAATTGTTTGAG
GCATGTTTTAGCCAACATAGAAGAAGTGGACAAATCCCTCAGCGCATGTT
TCAAACCTGTTCTGAACAAGCTGGTAGTGACTGGTTCTCCTAAACAATCC
AAATATGCTGTTCGTTGCTTACTGGCCATGATGAAAGACTCTGTTGTCTC
TTTGGAACGACTTTTCACCACATTGGTTGACTCCTTGGACGAAGACGAAA
CTTGCTATAAACTTCAAACCACTTTGTCAGCTCTCGGTGAAATGGCTATC
CTTGCACCCGAAGTTTTTGAAACTAAACATAAAATGATCATCAGAGATTT
TGTTGTCAAAAAGATACTAGTCATTGACAGGGAAAAGACGTCGCGAAAGA
AGGAGCCTGATGATGAATGGGGGGATGAGAGTAAAGTGTCTGAAGAAACC
ACTATGAAGATTGAAGCGATCAAACTCTTGGTGAAATGGTTACTTGGTTT
GGACAGCGCAAGAACTGGAGATAATGCATTGCCAGTTTTACGTTTGCTAT
GTACGATTATCAATAATGATGGTGATTTGTCGGGCGATGGGAAAATTAGT
GCGATCAATCGCTCTCGACTACGTTTGAAAGCTGGCAGTGGTCTTCTCAA
ACTTGCACAACAAACCAAATACACTGATCAAATTACGGTGGAACAATACC
ATCAGGTGGCTTTGATAATGCAAGACTCTTGTTGTGAAGTTCGAGACTTT
TTCACTACAAAACTTCACAAAGGTTTGGAAACATTGAGGTTGCCACCAAG
CTACATGGCTATTTATGCTTTGGCAGCCGTTGATCCCTCaagagaaagaa
aacaaaagGTGAAACAGATGATAGTGAAGAATTCGCAAACGCGGAGAGAC
TACACCAAACAACATTCAAGCGTAGCTTCCAAACCTTATGCAGTATTACC
AGAATACAGTCTACCATACCTGGTACATTTGTTAGCGCATCACCCAGACT
TCAACCATAAAGACAATGAATCTTTACTGGAATGTAAAGAATATTTATGG
TACTTCTTGGAACCTATCCTTGGATCAAAAGCAGAAAACTATAGTTTTCT
GAAGAAATTACTGGAGAACATAAAACGAACAAAAGACGCCTTAGCTGGTG
ATGACCAAACTGTCAATGAGaaactttACGCAGTATGTGACTTGGCGATA
GCCTGCATAATGCAAAAGACACAGACGTTTACACTGAAGGAATTTCCAGG
CAATCTTGTGCTACCCAAGAAATTATTTATTGCCGAAAAAAATTCAGCAG
CAAATTCAAAATCGTACCTGCCAAAGAATTTCATATTCTCGCCAAAGaaa
ataaagtCTACTGCCACGGCAAACGAAACGAAAAATGTCGCTGTCAATCA
ACAGAAAAaGTCTGGAAAACGCCCAGCAAAACGCCCAAACCTGGAAGAAG
TAGTTTCTTCCTCTGACGATGACACACCCTTATCGACCCCTGCAAAGAAG
AGGCGCGCAGCCGCTCCTAATAGTAAAAGTAAAagctcatcaaaaaagaa
aGACGAATCTTCAaccaaaaagaaaacgaaagtggtttcaTCAAACGTAC
AAGCAGCAAAGAGAAACTTAAACGGCTCACCTAAAAAGAGCGCGGCGAGC
CCAAAGAAAGTTACGAAAACTTCACCTTCTAAAAAGGACACTAAGAAATC
GAAAGAGAATAGTTCACCTCGTAAAGTAGCGAAAAGTATACCGAAGCGAG
CATCTCCGAAGAAGCGAGTGACAAGTCCACGGAAGAATGGTAGTACGAAA
CAAGCGAAAATCGATTCCTTCATGAACGGCCACAAATCTTCGTCgagtga
agatgaagatgaggaTAGTATCGTCACGGCGAGTGAAGAAAGTAGTCAAT
ACACAGCCATCAATGATGAACGACCTGCCCGTAAAAGaGTTACTCCATCA
CCTTCACCCTCTCCCAAGAAAAACCGACGAAACACATCGAAAATTAATTC
TTCTCCGGTAAAGACGTTGAAAGAAAGAACGGTACAAGAGGACGAGAAAC
CCACCCCAAAACTGAAGATTAAACGGAAACCTCGTGCGACACGCCGCTAA
CAACCAGAAAGTTTCCTCCGGCAATATTTTAAGCGTGTCATTGAAAACAA
AACAGAtaagtatttatttttcatgtaaATATTCACAGTCAGGGGATAAA
CTTTTGACGTAGAAAGGATCTAGTTTAGCCGGTCGGCTTGTTATCGCGTT
GTAGCCCTTTTCGCGAAGTACGAAAAAACTCGGTTTTGTGATCGGCCGAC
TGAGCTAGATCTTGAAGGGTCCCTTTGTACGGCTATTTTTAACTCTTGAT
ATTTTTTAGCAATTATTCTTTCAATAACCGAAAGTGTGGAAATATATTTT
GTACATACTAAGCTTTCAgtttctttaaatattttttcttccatGAATAT
ATATTTACTTTACCTGTTATTTCCATATCATCAtcgttttttcataattt
tttgacACTCATATCAGACAATATCGAGTACCTCTCTAAAAATcgggatt
tttcatcccgtATCTTGGTTagttccactttgatgattttcaaaaaatag
aagccttCTAAGTGATTCGACGCAAATTCCATATTTTCGCTACTGCAGGA
GCGATTTTTGCCTGTGCCAGACGACCACAATAGAGTGATcaaaaaatcgc
gtgttggTATAGAGATAGGCTAGAGCGATTTTAAAGTggcgtcaaaaaat
cgaatgtttggcgcccgaaaacctggaaaaagtcgcaaagtggaatagac
gttactgTGTAGAGAAAAAGctgtgacgtctagtataggctaagcAGACG
TTAGATTGAAGTACTCTAAAATGCTAGACTTCACGCACATTCTCATTAAA
ACATCATCTCTATGTACTTAAATATCATTAACTCTAATACTATTGGTTCT
TTAGCTTATATTTAGCAATTTAGTCTTTTCTCCTATTTTCTAGGTACAAT
ATTTGGTCTTTTATTGTTCGCtgattttttactttcaaaCAATTTGAATG
TCCTCGATTTTGAGCAGTTATGAATAAAAGCAACTTTtgaatctttattt
ttatttttgaaaacctcCAACCTTGAACACAATACCTCGTTTGTCCGTTG
CGAATAAATGATTCAGACCAGGTTTCTTTTCATCCAGAAttcgataaaat
aaaaacttttcaagattttctttgCTTAAGGTATAAATAACTGTTCCAta
tgataaattgttttttttaactaCTAGTCATTATAATTTTAGTTATAATA
TGTAAAGATATGAGATGTTCCTCTGTTATCACATTATAAATACAAGATTA
TTCAATTATATTGAAATGTTCTTTTGCATAGTGCTGATGTGGGCAGTCAC
TTCCCCACTTCTCTACAGTCTCAGTGCTCCAGGAAAACAACACTTTCAAT
AATTTCACATATGTACTTTATGTTTCTCCTCCGCTTTTAGGATAATACAT
TTGAGTTGGATTGATATGTTCTACTGATTGTTTGTAGGGGTACATTGCCA
TGTTGGCTACATGAGGTTGTCCCGCAAATGCGGGCATCGGCGGCCAGTTA
ATGTAAGGTTGCCCTGCAACGTATGCTGCCGTTGCCGGTGGAAAAGCTGT
CACATATGTCGGTTGCTGATTGGGTATAAATAACTCTCCTCCACTGAGGT
AACCTCCATCTGTGTGTTCTGGTTTGTCAACTAATTGTACTCCACCATTA
TTGTCGGGCATTAGAATCTTGCTCTGCATCGGTGTTCGATCTCTACGCGG
TGACGTGAGACGTCTATTTTGTCCGGAACCAAAAAATCCAGCCTTTTCAT
CTTCATTAGAATTTGATTTAGTGTTTTGAGAATTTGTTGATTTTGTACGC
CGATAAAAGATGAATAAACttgcaatgatgatgatgaaaacaCACGCAAC
TATACTCGCAATCAATGGAATGTTTATTCCACCGCCACCACTTTTCTTTT
CCCCGTCTCCCTCTTCACCAGACCCCTTATCAGGTTTTTCGTCAGAACCT
TTTGGTGTGATTATTGTCGGCTTTGATGGATCTGAAATATAAAGATAGAT
AAAAGTTATGAATTGTTTTTTGGGATAAAGTGGTCTTTATTTTGGGATCG
TTTGTAAGGAGTAGGTGAAATCAATGCCATCCATTGGTTGATTATAGGTT
TGGCAGTTTGCAGTAGCAAAGCCAAGaggggtgcaaaatttgtgtaggag
agcagatttttatgccaTGCGCCCCTCTTAGGTACGCTACTGGTTCGGCA
AATTTTAGAAAGGGACACTTTATTGGAAGCAATTATCTTTGATGATACCG
TCAATTCAGAATTATACTTACTGCCTTGTGTTTAATTGATTGCTGTTTAA
TTCTATTATGATGGTATTTTAAAGCAGCTTCAAAATTTGTATTGATTGTT
TGGTAAAGACTTACCTCGATATGTGACGTAAGAGAATCGAACTTCTACAT
CCTGGAATTGTAAACTGCTAAATAAAGTCAAATTCATCCGATTGCCAACT
GACGTGAATCGTTTCTGTTGCATGTTTTGATATTGGTTGCCTCCTTCTTT
TCCTCGGAATTGTCCAATCATTTTGTCAGGGCTTGCCACAAACACGCTGC
CCTGTTTCCAATTGAAGTTAGTTAATTTCTCTACAGTGACTATAATAAGA
TGATCCTTTTTAGCTTCGAAATTCCAAGTGCACATCATATGTGTTGTGAA
ATATGTTCTGTATTGACCATGTGTTTCACTGAACTTGCATCCGCAACAAT
GTTTTGTGCTTTGAGGGTCTTCAGTTGTTGTGGGTGGAGTTTTGGTTACC
TCCGCAATACTTCGTGTCGTATCACCTGTTGTTGAAA
Run BLAST on NCBI

transcript from alignment at sc0000005:400600..433299-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000786 ID=TCONS_00000786|Name=TCONS_00000786|organism=Clytia hemisphaerica|type=transcript|length=32700bp|location=Sequence derived from alignment at sc0000005:400600..433299- (Clytia hemisphaerica)
ATTTGACAATATGCTCCAGCAACGAGCAAGGTAAAACATTTTATGAAACA AAGCTTTTTTGTTTCTGTTTATTTTCTCTTTTACATTAGTTTGAAAGATG TATATTTTAAATTGTTCAGCTCCACATTACTTCTAGCAGTTTTAATAATA AAGGAAATGATCATTTTAAAATCTACTCGTGATTTTCTTTTCAGAATAAA CAAAGATTTTACAGATCTTCTAACGGCAATCCCAGATGAAGAGGTATTGC TAAATTTGCTTTGACTTGAATTAGGATTGCTTTTCATTCAAATACTATAT TTGTTTCTGATTTCAAATTTAAAAAACATTCGTTAAATTTCATTGCAATG TGAAGTTTCATCCTAATTTTTCATGAAAGTAATGTTTTCTATTTCGTCTT CAGATTGATGATAGAGAGAAACTGATACACCGNTCCCTGAATAATAGACC TTAGGATGATCTGCAAACTGGAGTAACACTCAACATAGTGTAGAATGAGT GGCAACACAAAAGAATTCTTGTCTTCCTTTATTTCTTTACTTAATGACAG TATTGTTAGCAATGTTATAAAATTTCAACTTTAGAGCAAATTAGTAGCAG ACTTCAAGACATGGATGAAAAAGTTCGTTTGGAAGCATTGCTCATCGTAT ATGAAGCTGCAACAGATGATTTTGCAGCTTTGGATGAAAAGGTGCCTTGT AATTTATACAAGAACATGACATAATTTATATCTATCTCACATTGAACCTT TCTAAATCATTGCCTTGTTAATGCCTCTTTACCAGGGAAGTCAATTCCTT TGACCTATTACTCAAGTTTAAGAAAAAAAATCAAATAATTAAATTGCATA ATTATTTCTCTTCATCTTTTAATTGTGAAATAAATATTACTTTCTTTCTT TGACCAGCTACTTGAAGACTTAAAAGAACGCATGAGAGACAAAAAGGTAA AAAAGTCTTGTTTTTACTTAAAAAGATTTAAACCTATAAGTAATAGAAGA ATATTCAGTTTTTTCAATTTCCTTTCTTTTTTTAGTGGTCAATAAGGAGA GAAGCCATTACTTGCATTGGAAAGATTTACAAGAAGTTAAGCTCAAGGTA TCAATTCTCAGTCAATTTAATGTAATTATGCTTCACACTGTAATAGCTTT AGCCTTCCTAACAGTAATTGCAACAACATAATTTCAATATTTTATTTCAT TCAAAATTTGTCTTTAAAATTTCAGTTCCAAAACAAAACCTTTATTGAGG AAGATTGACTGGGCACCTTCTAAAATTTTACACCAATACATGATAACTAA TATGGATGACAGGTATGATTTTGTGTATCATCTTTCTGATTGACCCTAAA TTCTAAAAAGTAGAATGAACACTGCATAATCTTTACATTAAGTTTAGCAT CACACAGTGTTAAAAAAGCCAGATACCTGGAAGTATTCTTAAATTTAGGG GGTACCTGATATGTTTGGGGGTACCTGCGTTTTTAATTCAGGTCTTCAGT CGCTAAATCAGGTCTGCAACCGCTATTTCAGGTAAAAAAAATGGAAAAAA AATCTGTGGAGGAGCCTATGACAGAAAATCCTTTATTCATTTTTTAACAA TAAAAAAGGTGGTAACTCAAAGTTGGGGGGCTGCTTTAGAATTCTAAAAA TTTTGGGGGTACCTGAACCCTGGAGGACCCTATGCTTGTGTATACTTTAG GAAAACCTTGTTTTTCTTTATAATCATAGATTGTGTATCGAGAGAGTTTT ACACGGATGTTTGGTGCCTGTCACATTGAATATTGAAGAGAGAATGGAAC GCTTGTTTCATGTCTATACCTCTCTTGATGATATGGGAACCATGTAAGTA ATAAAGTATTTTACAAAACTTCATCCTCCAATTCGCCCTTTAACATTGAG ATCCAACTGTATAATTGTATAACTTAATTGTAACTGAATTGACTGAATTC CCTCCAAGTTCAGCACGATGTTTTATAAGTATTAAAATTCCTCTAAGAAA TGTCCAGAACTTTCATCAAAAGTATTTTTCCCTTTAAAAGCATTAAGCTT GAGAACCTTTGTATTTATTTACCATAATATCATCTTAAAATACAAGGGAT GTGTTGTCTTGTTTAGATTATTTGACAATATGCTCCAGCAACGAGCAAGG TAAAACATTTTATGAAACAAAGCTTTTTTGTTTCTGTTTATTTTCTCTTT TACATTAGTTTGAAAGATGTATATTTTAAATTGTTCAGCTCCACATTACT TCTAGCAGTTTTAATAATAAAGGAAATGATCATTTTAAAATCTACTCGTG ATTTTCTTTTCAGAATAAACAAAGATTTTACAGATCTTCTAACGGCAATC CCAGATGAAGAGGTATTGCTAAANCAATCATCTTTCTGATTGACCCTAAA TTCTAAAAAGTAGAATGAACACTGCATAATCTTTACATTAAGTTTAGCAT TACACAGTGTTAAAAAAGCCAGATACCTGGAAGTATTCTTAAATTTAGGG GGTACCTGATATGTTTGGGGGCACCTGCGTTTTTAATTCAGGTCTTCAGT CGCTAAATCAGGTCTGCAACCGCTAATTCAGGTAAAAAAAATGGGAAAAA AAATCTGTGGAGGAGCCTATGACAGAAAATCCTTTATTCATTTTTTAACA ATAAAAAAGGTGGTAACTCAAAGTTGGGGGGCTACTTTAGAATTCTAAAA ATTTTGGGGGTACCTGAACCCTGGAGGACCCTATGCTTGTGTATACTTTA GGAAAACCTTGTTTTTCTTTATAATCATAGATTGTGTATCGAGAGAGTTT TACACGGATGTTTGGTGCCTGTCACATTGAATATTGAAGAGAGAATGGAA CGCTTGTTTCATGTCTATACCTCTCTTGATGATATGGGAACCATGTAAGT AATAAAGTATTTTACAAAACTTCATCCTCCAATTCGCCCTTTAACATTGA GATCCAACTGTATAATTGTATAACTTAATTGTAACTGAATTGACTGAATT CCCTCCAAGTTCAGCACGATGTTTTATAAGTATTAAAATTCCTCTAAGAA ATGTCCAGAACTTTCATCAAAAGTATTTTTCCCTTTAAAAGCATTAAGCT TGAGAACCTTTGTATTTATTTACCATAATATCATCTTAAAATACAAGGGA TGTGTTGTCTTGTTTAGATTATTTGACAATATGCTCCAGCAACGAGCAAG GTAAAACATTTTATGAAACAAAGCTTTTTTGTTTCTGTTTATTTTCTCTT TTACATTAGTTTGAAAGATGTATATTTTAAATTGTTCAGCTCCACATTAC TTCTAGCAGTTTTAATAATAAAGGAAATGATCATTTTAAAATCTACTCGT GATTTTCTTTTCAGAATAAACAAAGATTTTACAGATCTTCTAACGGCAAT CCCAGATGAAGAGGTATTGCTAAATTTGCTTTGACTTGAATTAGGATTGC TTTTCATTCAAATACTATATTTGTTTCTGATTTCAAATTTAAAAAACATT CGTTAAATTTCATTGCAATGTGAAGTTTCATCCTAATTTTTCATGAAAGT AATGTTTTCTATTTCGTCTTCAGATTGATGATAGAGAGAAACTGATACAC CGTTTAACCATTATGATAGCTCGTAAGTCAATTATTTTTCCGCTGATTGA TGATTAACTTCTATCAGTATTTCCATTAGTCAGTCTCAGAATCGAATCTT AATTATTTCAATAATTACTCCATCTTTCTTATAGGTGCACTTCCAGATCC AATCAAAACACAGGAACATTTGAAAAAACTGATTGTCTTATTATCAGACA AAACCACGTATAAATTATTCAGTGAATCGACTGATTTAAAACAGGACTGT ACTAAAATAATTAAATGTGTATCAGAGATAGTTAAAAAATTATCTGGGAA ACATCCCATAATAGACACAGTAAAATGCTTATTAGATCGTGCTTGTCCAA TGTTGGTGGACCAGACAAGCTTTGTTAGCTTGATACGAAAAATGAAAAAC TACTTTGAAGGGATGGCAGATGATGAAGATGACGATTTATCTGAAGATGA ACTTGCTTTGAAAGCTAAAAAATGTCTTAAATTGATCCAGGTAAAACTCT TTGTTAAAATGTATGGTTTCTGGCTACCTTTTCCACACTTTCCCACTAAA TTTCATCCGCCATTTAGTCTCTAAGATACACAACAAATTGCATCTTTGTA GTTGATCTTAATTGCAATTCATTCTATACATAACATTTTTATTGGTCATT TTAACAATTCATTTTCTGGATCAGGGAAGTTAAAAGCTCCCATTGCCAAC ATTTTACAAAGTCAAACGCTGTAAGCCGATATCTATTTATTTTGTTTTTC TCTTTAGGTGTTGGTGAAAGTGAGACCATCCATATTCCAAACGAAACAAG CTTACGAAACTTTCTTAGTTTTCCTCAAACACAATGATCCAGAAATTGGT ATAATTTTTATTTGGCGTTTTAAGCCATCTGCATATGCCTACAGTTTTAC AATACTTACTTAGTTTATCAATTCAACTGTTGATATTAAAAGAATTTCCA GAAATTAAAACTTTCTGAAGGGAAAACCATTTAGTCACATAATTTCATAT GATGAATTGAATTTGCCTTGCAGGTTCAATCTATAATTTTAATTTTGTCA ATGATGCAGCTCTGAATCCGCTTGTGTATTCTTCTTTTAACTTTATTTTT CTTCCAATGAAATTAATGATGATCATAAATGTCTTTTCTTTACAGTACAG CAATCCTTAAATTGTTTGAGGCATGTTTTAGCCAACATAGAAGAAGTGGA CAAATCCCTCAGCGCGTAAGAATTTTTTGATTCCAAAATATCCAATCTAG AATAGGTCAATTCCTCCATTATGTTCTGTTCTGAACTTTAACAATTTTGA TACCATAGACAGTTTTTGATGAAATTATTAACAGCACTTTAGCCCTGAAA ACATAAACATAAAATCAATGATTTACTTCCAATTCAAATGTTTATTGACG ATGACTCTCATTAAACTTGAACTCTTATTATTTCAATCTTACTTCCAGAT GTTTCAAACCTGTTCTGAACAAGCTGGTAGTGACTGGTTCTCCTAAACAA TCCAAATATGCTGTTCGTTGCTTACTGGCCATGATGAAAGACTCTGTTGT CTCTTTGGAACGACTTTTCACCGTAAGAAGTTATTTTGCAACTTCAAAAT AAAATATACTTATTTTACGTAGAAGGGAAGGGACAGCAAACTGAATCAAT GAACAGGCCCAACCTTTTGATAGTTTCATTATGGAAGATTGGTGCAGTAG TGTAGTAGTCATCGTTCTTGACTTCCGTGCTGGAGTTTAGGGTTCGATTC CCACTCGGTGCTACGATTCACTTGGCAAATGGATGTACCTTGGCCCAGGT CAACCCATACCATGTGAGGGGGATAGGGCAGGATAGGGTACCATCACTCT GATACAAGAGTATGGGGAAATATGCCGGACATTGAATGTGATCTTCATCG ATACAGCACGGCTCTGATGTGTCGCGAGCACAGAGTACAATGTCTGGTGA GCGCTGTGATTTCCCTATCTAGGGGTAGGAAACTATCCCGGGATAGGGCC CGGTCCGATGATATCGGAGGGTCCGCTTCTCTTTCTCTCTTCTCATTGTA GAAGATTACCAGGACATTGCCATTACCTTTGTGCAGTGATCTTTGACTTA AGGCCTGTTCCCACTAGGGAAGGAGTTTGTCGTGTCTTCACATTACCAGG AGAAGCACATTATTAATTTTTAAACTTCACATCATTTATTAATTCAATTG AACATTTTAGACATTGGTTGACTCCTTGGACGAAGACGAAACTTGCTATA AACTTCAAACCACTTTGTCAGCTCTCGGTGAAATGGCTATCCTTGCACCC GAAGTTTTTGAAACTAAACATAAAATGATCATCAGAGATTTTGTTGTCAA AAAGATACTAGTCATTGACAGGGTATGTTGGATGTGATTTCATATATTCT TGATCACTTGTATGTTGTGTTTTTGCCTCTTAATAATAGTTTGTTTTTAA GTTTCAGAGCTTGTTTTCAATCTTATATAGATTAAGTTAGCCTGTTGAAC GAAAACCGCTTTTTCATTATTCGTATATTATAAACAATTTGGTTTAGTGG AAAGGTACTGGCTACTATAGACTTTGCTGACGTGTTACGCTATAATTTCC ATCGTTATAGAGTAGCACATTTTGACAAGCTAGCATCATTATTTGATATT TTGCGTTTCCATTACATCAAATTCTTTGAATTCTTTCTTAGGAAAAGACG TCGCGAAAGAAGGAGCCTGATGATGAATGGGGGGATGAGAGTAAAGTGTC TGAAGAAACCACTATGAAGGTATTCCTTTTTTTATTCTTTTTTATTATCT CTAATATCTTATCTCTAAAATATTAGGGTTCTTTTTACAAGAAGTTAGTA CTGTATATAATAATCATACGAATGAAAAAAGTTTCGAAAATTACCACGTG GAAAGATTACGAAAGGCTAGCGTACGACTGACAATTATTTGATTAAACGT AGATAAGTCAAAGCCATACTCGCTAATCTGGTGTTCTTTTCCGATTTCCA CAAGGATTATAGATTTCTTTTGAAAGTATTTGCTTGTATTAACCGTTTCT GTTTCTGTAGATGTACATACAGTTCGCGCTCTCTAATTCGACGTTCTCTA ATTCGACGTTCTACTATTCGATAGGCTCCCTTATTCGATTAAATTTGAAG TCCCCGTCAGCAAGAAACTCTCATAAACGACGCTCCCTTATTCGATAAGC CCCCCTTATTCGATAAAAATACAATTTCCCTTGAAGATCGGATTAAAGAG TGTCAACTGTACATCTTTGGCTTTTTAAGTTTCATTAACGTACTGATTTT GTATGATTTGGGCGTACTGATCCTTCTTGAATTTCCTGATCAAAATGTGA CTAATGATTTTTTTTGACAATCATATAGATTGAAGCGATCAAACTCTTGG TGAAATGGTTACTTGGTTTGGACAGCGCAAGAACTGGAGATAATGCATTG CCAGTTTTACGTTTGCTATGTACGATTATCAATAATGATGGTGATTTGTC GGGCGATGGGAAAATTAGGTATGTAATGCAACCGGTGTCAACCAATAAGT AGACCTTTTACAGACTTGTAGAGCTACCTTGTTAGATATCTAAGATGTTG ACGTAGGTTCTCCATGTAAATGCAATTATTTTCGACAGCATGTATGAATA ATAAGAGAAAAATTGATTATATGCTTGATTATTCATCGGCTTTCCAAGAC CATTTTAAACAGTGAAGGAAAAATATACTTTAATGGGATAAACTTTCGCG GGGATTAAATTTCGCGGATTTCGCTGTCATACGCGAAAATCCGCTAAATT AATCATCCGCGAAATTAAGTACCCGTGAAAAATTTGAAATCTTTCTTCGA TCTGCGAAAATCTTAAATTTCTATCGTCTTTTTTTCGTCCCGCAAATCAG ACTACTCGAACCCCGCTTTGAAGAAAATCTCTTCGTTATTTTCCGAATTT TCACACACTACCATATCAAAATTTTGAGAGAAGTTATGTTTGCTACCCCG ATTTTGCAAAATTAGGAATCACTTAAAAAATAGATTTAATCAAGGAACTC CTCATCCGCGAAAATAAGTCCCCGCGAAATTTTCGAATTTCGCGGATAGG CTCATCTGCGAAATTTGATCCCCGCGAAAGTTTATCCTATTAAAGTACCA GACACGGTAAATTGGAAAAAAAGTATTTTTCGCAAAAAGATTTTTCTAAG AAAATATTTGAGACATGTTTGACGTTGAGTTTTGATATGAAGGATTAAGT GGGATGCTTAAACATTTTCTTTGTCCTCTGATCTTCTTTTAAAACATCAA GCTAAGTAAGTTTCACTTAGTATTTACTGGAAGATTAACATTGAAAATTG TTGTAAATGTAATCAATTGTAATCCATCTAGATCCGTCTACATCAATAGT TCATGATTTTTATCGTCTCTAACAGAAAGCAAAGCATTTTACATAATCTA TTCTTTATACGAACTGCAAATTCGAAAATTTTTGACTTAATATGTACTTC CTACGTAGACTCTAAGGTCTCGTATTTTTTTTAAATTTTGACTGTTTCGC TGAATTGCCAGACTTGAATGTTCTTAACTTGTTCTTAATATGCATAGTTT TCTGCTGAAAGGGTTGAAAAAGGCTGAAAAAGGGTCAGATTTTATTTTTG GATGTTCGATTATAAAAGGATAACACGCATCTCACCTTATCCTTCATAAT CTAAAGCTCGCCGTTTCACTCGCCTTAGTATTTTCTTGGAAAACTTTATT TACAAAATTCAAAAACCAGTATAATTCTTTATTTCGAGCTTTGCAAATCC GCTGTTTATATATTTTCTTTGTTTTGATTCCTGACTGTTTTGCTTACATT AAGATTATATTATAGACACAATAGACAATAACGATACACGGTTACTATAT AAACCCAACTTCCAAATCTTACAACCAATGAAGAAGTATTATAGTNGCCA ATTTTGCGACTTTCTAAGTTCAAAATCAAAATATGTTCTCTTTAATGTTG TCCTTTCTATTGACGACAGTTGAGCTACATTTTTGTAGAGGCTTCACTGC CAGTCATCGATACGACGATAATATATTGAGTGCTTATCAAACAATTGGGT TTTTCTCAAAATGTAGTGAAAATGTGATGAAGGCAAATGAAACAGCATTG AGTCTATTAGCCATTGGAATGGAAAATGAGTTGAGACAAGTTTTGGAATT CCAAAAGAATTTCAATTTTATCAGTTACGATGTTTGCGATGATACTGAAC GACTTGTTGAGTTGATCACTGACCTATGTCTGGATCGCAGATACTTTTTA TCTTCAAGTGACAATATTCACAAGCCGACAAATCAACAAAAGGCATTGTC TACGCGTGATCAAAATATTATATTTATCATTGCTTACGTGACGGATGAAA TGTCAGATATAATTCAAAGTATTTTGGGCAACCTGAATCCAATCATTGCA AGGCTTTGCATTCCTCACCAATGTGATAGCCGTTTCCCATTTTCGAACAT GGATGAATATATCGGGCAAATATTAGACTTTGTACTCCGTTTTAGTATGA GAGATTTGACTTTTATCAATATCGAGCGTAGAAACGCAGAGCCTACAGGA TATGAGACCTATTATAACAAAGTTTATCACTCTTTAACAAGTAAAAATTT CTGCTTGAGAAGGAAAACTATACACGTCTCTCATGGTATCACAGACTACG ATAACGAATACAGTGAGAGATTATTAAAAGAGCTAATAACACCTTTCTTA AACCAAAAAGGCTCAAACAAATCTAACATAATATTCTTTGGACGAGCAGA GGATATTCGAAGTATTGCACACAAGATGGCTTATGATTTTCAAGGAATTC GAACTAGTCGTTCCATACTGTTCCAAGATATAGGATTTGTTTCAAGCGAC AATGAAAATTTAATCAGGCTATACTTCGCCGGACGTCTGAACAATCTATT CAACTCNTAACTCGTGTAGCCCGCTTCGAAAAAGTAACCGGTTAACAATA TATAATATTATATATAAAAGTATTATACCACTAGGAAGTAACGTAAATTT CGTTTTACATAATACATAGTTGGCTTTTTATATAATTGGATTCAAACGCT ACAAACCAAAGAACGCAATACTATACGGAAGACACGTAACTATACAAACA AAAGTCAGATACAACAATCTGCAATACTTGTAATAGAGTTTCAGTCGGGT GAAAACTTCAAAAGTTTAAACTCTTGAAAGTTTGATTTCAGAGAGTTTTG TAGCTGATTCCAAGCAAACCAATTTTGCGACTTTCTAAGCTCAAAATCAA AATATGTTCTCTTTAATGTTGTCCTTTCTATTGACGACAGTTGAGCTACA TTTTTGTAGGGGCTTCAGTGACGGTTATCGATACGACGATAATATATTGA GTGCTTATCAGACAATTNTATGCAGATATGATCTTAACAGCTCTTAAAGA ATTTCTAAGCGATGATTCGCCGAGGGAAGGCATCCTCCATGAAGTTTACC ATTACAGGGTCCCTCACCTATCAAACAATTTTATACTTCCATTGGGACAA TACGACTCGTCTGGCAAAGAAGGTGCAATAGGGACAGTACTGTCTGAAAA ATTCTTGGAAGATGCTCGATTCAAACCAGTTTATTGTCAGCCGAATCTGA CATGCCCACCAGGTCACCACCAACAATATGGAGTTGTTAACATTACTCGA GATGCGGACGAGGAACATGCTTTCAGATGTGATCTTTGTCCCTTGAATAC TATTAAAATCGGTTATGGTGACGGCTCTTGTGTGCCTTGCGTTGGAAAGT TCAATATCGACGATGGTGAAAGAACTGTTTGTGTCGACCCGTTCACTGAT GTTAAAATGTTATTCGTTGATCAGCAACACCATGCGACTGTCGCTTTCGC CGGCTTTGGTACTTTGATCAATATCGGCATAATTATACTTTTTATCATCA AGCGAAAAACTCCAATTGTCCGCTCATCCGACAAAGTTTTGTCATTATTA CATCTTTTGTCCCTATTAGGTGTATTCCTGGGTGTAAATTCTTTGTACAG CCTCCCTTATCTTGAAGTGGGAATATGTATCGGACGAAATCTGATCTACA GTATTCCCTACACATTTCACGTAGCTTGCTTGTATACTAAATCACAAAAA TTGGTAACTGCTTTTTCCTCCAACATCCGACTTAGTGCTGGCAGTTTTCG CAAAACTTTAATGATTCAGACTTTCACAATTATCATCTTGGTTCTCTCCT CGAACTGTGGTTTATTTGTTTCATACGTTCAAATCGCGCCAAGGCTTATT TCCCAATTGGATGCTACAAAGATGACAAGAAACCATTCCTGTAATACAGA ATTTCATCAAAATATTCAAATCGTGTTGCTGACATCTTGTCAATTAATGT GCTCTGCTCAAGCTTATAGGTGCCGAAGATTACCTAACCTTATCAACGAA GCTATGTCATTGTTTTACACGATTCTCATCACATCAGTGTCGTTTGGAGT CAGTTTTCCAATGTCCCATTTCCGACGCGAACCAATGGATAAAGAGTTTG TTGGTGTTTCTGTTATACTGATCAACTGTTATGTGACTTTGTTATTAATG TATGGAAAGAAATGTTATACCATGATGTTCCAACCCGAGAAAAACACAAG AGTATATTTCAATAGCAAAAGGAGAGAACATAACGGAGTCTAATGAACGA ATACACTGTTTTGCGAGTTGTTTTAGTCTTACATTAATAAAGCCTTACAT TTTCACTTACGAGCCATTGTATATACTTATGTATATTTCTTGAAGTTGAT CTGAACAAAAATATGGCAAACAATATTCAACTGTCACTTGAAGTGCAATA CAGTGTGTCCGGAAAAAGTAAACTAGGATTTTAATTGAAAAAATCCTCAT ATTATATTTTATTCTCAACTTCAGTTGAGCTAGAATCTGACAATGTATGT ATGTATGTGTGTATGTGTGTATGTATGTCTGTCCGAAAACTTTGGGGTAG GCTGGAGACTTCAAAAATGATTGGGTTTGGTTGAAATTTGGCACACTTGT TCCTTGGGTGAATATCTTGGGGCTTTTTTTTCATTTTTTGAAAATTTTCA TTTTTAAGGGCGTGGTTGCGAGTTTTCGCCAAAACGAGGCTAAAATTTTG GGGCAGGCTGGAGACTTCAAAAATGATCGGATTTGGTTGAAATTTGGCAC ACTTGTTCCTTGGGTGAATATCTGGGGGTGTTTTTTTTTCAAAAATGAAA AAAAAAACCCCCAGATATTCACCCTTGTTCCTTGGGTGAATATCTGGGGG TGTTTTTTTTCATTTTTTGAAAATTTTCATTTTTAAGGGCGTGGTCACGA GTTTTCGCCAAAACGAGGCTAAATTTTTGGGGCATGATAGAGACATCAAA AATGGTTGGATTTGGTTGAAATTTGGTACACTTGTTCCTTGGGTGAATAT CTGGGCGTTTTCTTTTTCATTTTTTGAAAATGTTCATTTTTAAGGGCGTG GTCACGAGTTTTCGCCAAAACGAGGATAAAGCTTTGTGGCAGGCTGGAGA CTTCAAAAATAGTCGGATTTTGTTGAAATTTGTCACACTTGCTCCTTGGG TGAATATCTGGGGGCGATTTTTTCATTTTTTGAAAATTTTCCTTTTTAAG GGCGTGGTCACGAGTTTTTGCCAAAACGAGGCTAAAACTTTGGGGCAGGC TGGAGACTTCAAAAATGATCAGATTTGGCCGAAATTTTGCACACTTGATA CTTGGGCGAATCCCTGGTGGCGGTTTTTTCATTTTTTCAAAATTTCCATT TTCAAGGGCCTGGTCACGAGTTTTCGCCAAAACGAGGCTAAAACTTTTAT GCAGGCTGGAGACTTCAAGGGCTTATCCCTGTGGGTGGTTTTCATTATTT TATAATTTCCATTTTAAGGGGGTGGTCATGAGTTTTTAGTTGAAATTGGT TACAATTTTACAATTGGGCCTACGAATGATTTAAAAACACTGAAGTTGAG CCCAGTGCGGTTAGCACGTTCGACATTATTTTATAACGTTCAATTCCCTT TTCATTTTTCTAAAAATCAATTAATTGATAATGAGAAATGAGAATTGAGG TTTTGGGAAAAATGATTGTAAACATGCTTATTTATATAATAATGTTTTTT TTTTTTTAATTTATCATGAATATTCTTAACTTTTTGTGAGAAAAAAAATA TTCTTACGGTATTCTTAGATTTGGATCCAAACCCAGGCAAAATCTAGAAT GTTATACATACCTCAGGCAAAGATTTGGCATTTTTGTGGAACCCTTTAGT ATCGCTGGGGAATAATTGACAATTTAATGTTAAAATTGCATTAGGTTCAG TTGCCATATTCCATGATGGTGATATTCTTACCATATTCTTAATTTTTTGG CCAATTTCATCATAAATATTCTTATAAAGTCCATTCTTATGAAAAAAGCG TTTTTGTTTTAGAGAAAAAGTTTGTATGATAAAATATTATAAAGCAGTGC CGTAGGAAGCATTTCCATATTGGGGGGGGGGCTGAAGTTTGGTGACACCG CGAGGGCCAACCATGGTTTGGCCCGAGGGAGAAAATTTTGAAAATTTGAG CTCTAGATTGCTTGAAAATGCACTCAATTGTGACAATTATGACAAATTAA AAAAGAAAAACTTTGCATTTTGTAAAATAATATTGAGATTTGATAAGGTG ATCCGGCTGGGTGCCCCCCCCCCAGTTGCTACGGCACTGAAAAGGAAAAC CGAAAAAAAAAAACCTTTTTTTTTAAAAAATTTTTAAAAAAAAAGTTTTT TTTTGGTTTTTCCTTTTAAATGTCGGCACAACTGGGGGGGGGGGGGCTAT GCCCCCAAAAATTTTTTTAAAAAAATTTTTGGGGGCATAGCCCCCCCCCC CCCAGTTGCTACGACACTGTAAAGGAAAACCGAAACAATAATACCTTTTA TTTTAAACACTTTTTAACGAGAAAAAGACTTAAGTTTCGCCTAAGCCTTT TTAGGCTCGGATTTCACTTTAAAACAATTTTAGTATAATAAACTTTATTT CTTTCTAGATGGAAACAGGCCTTTATGTCGAATGATTTTAATGGGGTCTC AAAACAGATATTGGATTATTATATTAGAGACGATAGCTTCGACTTTTCTG GCCAAAGAGTATAATTTAATGAGGTGTGAAAAAAATACTTTCAACAAATA CCCACACGAAGCTATGTGTAGGCGCGATAACACCGCCGGCCAGGACTACT TATTTGCACCGTACAAAGTTTCGATTTCCCAACCCGTAGGACTCCCGTAC AGCAACTCCAATCATGTTAATTTATCACAAAGTGCTAAGTTACGCTATGA AAAAAAATGCTTCATCTAAACAAAATAACGTGCATTTCATTAGTTGATTG TCTACTTACTAAATTTACATTATAATAAAGAACTTTAATTTAGAACGCTT TGGTGTAACAAATAATATAAACGAATAGTCTATATTTTTTATGGTAAAAA AGTAACATTTTGCATTTGCTTTTGCAAGATCGGCACACATGTATGTATTG ATTGGCTATTGATTGGCTTTTCATTGGCTTTACCCATGTCTTTATATATT TGCCAAATACAGTAATAACAACATGTTTCGACATTCTCATTTTAGTGCGA TCAATCGCTCTCGACTACGTTTGAAAGCTGGCAGTGGTCTTCTCAAACTT GCACAACAAACCAAATACACTGATCAAATTACGGTGGAACAATACCATCA GGTGGCTTTGATAATGCAAGACTCTTGTTGTGAAGTTCGAGACTTTTTCA CTACAAAACTTCACAAAGGTTTGGAAACATTGAGGTTGCCACCAAGCTAC ATGGCTATTTATGCTTTGGCAGCCGTTGATCCCTCAAGAGAAAGAAAACA AAAGGTATACCGCCTGCCCCCTCCCCGAATAAACGCCTCTCCTTAAAGGA AAAATTTTCAATAAACGCCCCTCCTTAAAGGAAAAATTTTCAATAAACGC CCTCTCAAATAAACATCCCTCAAATAAACGCTCTCTTCTAGGAGGGGCAT TTATTTGAAAAGCCTTCGAACGTTCTTAACTTTTTGAGTTTTAAACTAAA GATGTTCTTAAAAAGTTCTTATAACTCTATATTGTGAGTATTTTCTAAGA AACTGGGTATTTTAGNGACCTACCTCCGGGTGCCCCGGCCGAGGTTCTAT AAATTAACCCATGTCCGTTCGTCTGTTCGACTGTTCGTTCGTCCGTCTGT TACCAGCTTTTCTCAGGATTGGCTCATTAGTTTTTTCTGATTTTTGGCAC AATGATGCGAAATGGTAATGCCCAGAACGTGACGGAGCCCGATTTTTGAG AAAAAATTTATTTGGGCAAATTTGGGCCAAAAACTACCCAAAAATAGGGT TTTTTGGACTTTGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNTATATTGTGAGTATTTTCTAAGAAACT GGGTATTTTAGAGGTATTTCAAAGTCTCAAAATGTTCTTAGCTTGTTTTT AATATCCGGCCATCGGTCACTTTATAATTGTATCCGATAATTGAACAAAA AATTTGATCTTGACAAACTTTCAGGTGAAACAGATGATAGTGAAGAATTC GCAAACGCGGAGAGACTACACCAAACAACATTCAAGCGTAGCTTGTAAGA ATTTACTTCCTCTTTTTTTCTTCCCATCGTTTTCCGAACTTCTTAAAACC ATAAGTTTGTTTTTAAAACGGATTGGAGACATATTAACATAAAACAAAAA TTTTATTATGATAACATCATTGATAGATTTTACCATACATAAATACATTT AAGTAAAATACACGTTTTTTATAAGAATATACTTTATAAGAATATGTATG ATGAATACTGGCCAACAAATTAAGAATTTTGTAAAAATACCATCACCGTG GAATTTGGCAACTGAACCTAAGAACACCATTTTTAGAGCATTCTACCATT AAATGGTCAATTATTCCCAGCAATGCTTAAAATGTTCCACAAAATGCCAA TTTTATGCTTGAGGTATGTATTACATGCTGGATTTTGGCTGGGTTTGGAT TCGGACCTAAGAATAATTCAGGATGATTTTTCCCAAAAAGTTTATAATAT TCATGATGAATTAGAAAATATCATCCTTATAAAAAGTGTGTAATGCTTAT AGCGATGTGAGGTACATATCTTACGGTTTTAAGCCAATTTACATAGTTTC CACCCCCTTACATTTAGTTGTTCTGAAACATTATTTTCTCATTGCTTGCT CTAAAACATCAACTATTTTGAATAAACATCTAAAAATTCAAACGGTAATC AAACCATACTGGTACGAATTGGCGCCACCTGGGAAAGGGAACCAAAAAAA AATTTATGAAAAATTGCGAAAAATATACATTTAAATTCTTCAACTAAAAG AAAGAAAAGAAAAGTCCCAGAAGAGCACTTGGCTCAAAGAAAGAGTAGAA TAAAAATATACGAATCAACATATGAATTTTATCATTATACCCGGATGCTA AACTTAGAGTTGCAAAAAAAACGCAATGTTTTTAGATCGAATGGAAGATA AGTTAATTCATGTGATCACAACGGACATGCTCTGTAAAAAGGAACTCTTT CGATAAAATAACACTATTAAATATATTATCCATACATTAGGCTACGTCAT ATCTTCCTTCGTTTCGAGCGTAAAACTCCGACTCAAGAGTAAGGCCTGAA AGCTTGGAGCTTGTCTATTGTGTACAGTGGCGTTGTGGCAGGGGGGGCCG GGGGGGCCATGGCCCCCCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCAGCGGAGCTT TTTTGAAGGGGCGCCGAAGCACAAGGGGCGCCAAAAGAGATTTTTTTAAA CGCCCTGATCTTAAAAATCATATTTTATGCGCCTTAAATTGCGCCCCAGG ACTAATTTTACTGAAATAATTTTAAATTACTTGCAATTTTTTTCGCTCAC TTCGCTCGCAATAAAGTTAATTGGTAACTTCTTTGAAATCTAGCTAATTT ACAAGTTTTTTTGTGTACCATATAGCATTATTAAATGAAAATCTAACTCC ACCCCAAGACCAATTTGCTGACAACAATATTGAAGTTATAAAACATCATA AATTCTTTCACTCGCTTCGCTCGCATTACACATTGTTTCTTTCTTTTCAC TCTAGCAAGTGTCAAATTTGTCTATTTTTATTTAGTGATTTAGGGTAATC TTGGCAGTCGATTTTCAAAAATTTTCTAGTCGGCCCCAACCATGGTGGGG CCTGTTTTACCCTTTTCCATTCATCAAAGATATATCTACTCTTATCGAAA AAATTTCCTTCCTCATTATGCCTAGGCAAATGAATTAGTAAAAGTTTAGA AACTGGTGGGTGGGGCGCCACTTTGGAGAATTGGGGGCGCCATTTAAAAA AAATTGACTTTGGCCCCTCCAGAAGAATTTTCCCACAACGCCACTGATTG TGTAGACTATCCATACATATATCCTTCGTCCACTAAATACAGTGTTTAGG ACCCAATTACATCACACTTTCTGATTGGACTCTCATGTTATTCATTCGTT ACTCTCGAAAATATGATTTCGTGTTTTTGTTTGGATATCTGGCAATCCGG TATGCTTTTCGTCCATATAATAACACCATGATCACTGTATTACTGACAAC AATAGCAAGGCATTGTACTATATGGCAAAGTTCGCGGTGAATACAGCTGT CAAAACGAAAGTAGTATAGACTAGGATCATACTTTCGTTCATCACACTTG GGAGATTTCGTTCGCGGAACTCTTGGATAGAGCACAACAACTGAATGAGC AATTCAAAAGCCATAATAATGTTGCTGTGAAAATAAGTGTTAGAACTAAA GTTTCTTTCATAATACTCTTTGAAATGTTCAAGTTCGATCCCATTGATTT TCTTTCTCTTAACCTTTAGACGCCGAGAGACGTACCACGTACGTCATATA TACAGGCCGAGAGACGTACCTCGTACGTTTTGATACTGGGGTCCTTTCAA AGTTTAATAAAATAAAGACCAGTTTGAACTTTTCTATTCTGTAAAATTTA GCAGACAGGATAGAGGTGAAGGTNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTGA AATTTCACACAATGGTGGCTTATAACATAAACTAAAACAAAATAATTTTT CTGGGACCAATCTTTACCTTGTACCCACTTTTTTCATTCAATTTGTCAAA ACAAAGAAAAAAAGTGAAAAAATCGTCAACATGGAATTTTTACTGTTTTG ATTTGAGGCTGTGTAGTCAGGTTTAAAAGGGTGATGAGGCGTCTTTTTGG TATTATCTGAAAAAATAGATCCTTAGCTTTTCAAAATGGGTTTACTTTTT ACTAAAGCTTTAGCGGTTCAGATTTTATGACATTTTCCGCGAAACCTCCA TTTTCATGAAAAAAACAGCGGCAGCAGCGCGCGCTGTTTTTAAAAACAGC GGTGTCTAAAGGTTAACACATCCTTTCTGGTACATAATACTTCTTTCTGC ATTTGACACATTAAAAAGGATTCCCAAAAGCAAAAAAAATCTTTCTCGAG ATTTTTAAACCAATCAAAATACGGCTACTTTTACCCTAGCGACCAAAACA TTTTGCTTAATCCATCGTAAATCAAATACATAAAATAGATATAGGATTGA GTAGGATTGAGTGTCATTGTCAGTTTCCAGGCTAGATTTTTTAATTAGGA AAAATACGAAAAAGAATAGTTTAAGCAAAAATCTTCACTGTCTATTTGAA TCTACCTGTGTGTAGGTCTTAAATTGGGGTTTGTTCGTTCTTTGTTTTAT TACTTTAGGCGTAGAAACTTTCACGAGCAGAAACTTTCGCGAATTGGGTG ACCAAAATGAAAATTTTCACACGAAAAATGGCTTAAAAGTGACAAATGCT AGTTGAATTATTAAAAACGGGTATTACAAGACAAGACATAAAATTGCTAT AATTACTAGTTTTTATTTCCATTTCGGAGCATTGTAGATTTTTCGTGAGC ATAAACTTTCATTTTGTCATTTGAGTCTATTGATTTCAACCCTTACGGTG CATTTTATTTTCATTTTCGGTGCCACGAATTGTGCGGTGCGAGAGGCGAC TCTTTAATAATATTCAAAGAAATTTACTTTCGCGAAAAAGGCCAAATTTC GCACCGCACAATTCGTGGCACCGAAAATGAAAATAAAATGCACCGTAAGG GTTGAAATCAATAGACTCAAATGACAAAATGACATTTTATCTTTATTGTA AGGGTCCGATTTTAAAGGCTCAATTTGGGTCGTACATAAGGTCGTTTATA AATCGAGTACCCCCCCCCCCCCCCCCCCCCCCCTNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCCCTCCCCGAGCTATTATT CTGTCAACGTCCAATGACCGAGTTGCGGTTTTGATGGTTCTCCTGCAGTC AAAGCACCTTCAGATTCATAGCTCAATTTTCAAGCGGTCGATGATCCAGA CTAACGATTGTGAGGGATTTGCTGTTGAAGTAATCAATCTCTTCGCTTCA TTTCAGCCAAACCTTATGCAGTATTACCAGAATACAGTCTACCATACCTG GTACATTTGTTAGCGCATCACCCAGACTTCAACCATAAAGACAATGAATC TTTACTGGAATGTAAAGAGTAAGTTTTATTTCACAATATTCAAATTTTAA CACCCTGTAAGATTTTTGAATTTTAACTGTAATAATATCGTGCGGCCACC TCCTTAGTTAGCTTTATGTCTACGAGTGTGGTCGCGAGTCTCGTTTTTAA GACAAATGAATCATTTACTTGCTTACGATATTCTAGTCTAGACCTTTTCT TGATAGGAAGCAAGATTTCATGTTTATTTAAAGAACAAATTTAGCAGTAT TGAGTGACGTCGAACAGTTCTTATATTAGATTGTTTAATCGAGTGTATTT TTCCCTTCCATTACGTATTAGTTTGAGTTGCTAGTGAAGTACCCAACTCT CCATTTTCAGATATTTATGGTACTTCTTGGAACCTATCCTTGGATCAAAA GCAGAAAACTATAGTTTTCTGAAGAAATTACTGGAGAACATAAAACGAAC AAAAGACGCCTTAGCTGGTGATGACCAAACTGTCAATGAGGTAAAGATTG TGCTTTGTCCGTTAATTTTTTAATCAAACAGAACTTTAAAAAAACCATAA CTAAAAGATTGGCAAATTCAAGATTCTGTTTGTCATATTACTCAACAGAA ATCGAGACTTGAGACTCACTTTTTATTCCATATTTATTCTTTTTTTAGAA ACTTTACGCAGTATGTGACTTGGCGATAGCCTGCATAATGCAAAAGGTAT GTTGTTTTCTATTGTTTAAAAACTCTCTCAAAAAAAATAAAATTTTCTTC CATCAGATACCATTATTCCCATAACTTCGAATTTCCAACCTAAATTTTTA TTCGGTTTGGGTAAAAAAACAGGATAATTGAATCGAAGCGCTGCTAGTTC CAGACCGTTTGGGTTTGACTTTAATTATCTTTACAGTTGGAAATTTTCTT TTGATACGATTCTCTTTTAGACACAGACGTTTACACTGAAGGAATTTCCA GGCAATCTTGTGCTACCCAAGAAATTATTTATTGCCGAAAAAGTAACAAC CATCCTTTCCTTTTTTCGGGAACAATGCTAAAATTATCAAAATCGATAAC GCTTGTCATTTAAATAAGATAAGAATTGTTTTTGTTTTTTCTCGCCGAAG TTTATCGGGAGCTGGGATTTACGGGGGTCGCGTAATATATTTAGAGTCTT TTGAAGAAAAAACAACGATGATAACGGGGCAATGAGACTGCTATTTACAT ATGGTATTGATAAATCTTTTAAGCTTTAACGTTAATTTTTTCTGTCCATC CATAGAATTCAGCAGCAAATTCAAAATCGTACCTGCCAAAGAATTTCATA TTCTCGCCAAAGGTTTGAATACATTATTCTCTTGTTTTTTATGTATATAC ACGTTCCCTGGGCGAATAAAGAAGACGTTGTGTAGCAAAATGTTCTTGTT GTGAAAAATGTTTATTGATTCTTTGTATGCAGGTCATCTGATACACGTTT TTTATAAGAACGTCCAAGATTTTTAAAGCCTTCGGATGCTCTTAACTTTT TTAGTTCTAAGCCTAAAACATGTTTTTATTTTTACCATCTTATGAGTATT TTTGTGCAACTTCCTAAGAAATTAGGTGGTTTAGAGGCCGCAATGCGTTA AAATGTTCTTGACGCCTTGTTCTTGTAAAAAAACCGTGTTTCCATTTTGT TGCTTCTTGTATTTTTAGAAAATAAAGTCTACTGCCACGGCAAACGAAAC GAAAAATGTCGCTGTCAATCAACAGAAAAAGTATTATATTTGATTTATGC GACAAAATCAATTATTGTGTATCTGTTTTCATAATGCTCAATCCTAGAAT TACATTCACTTTATTTTAGAAGTTTCAATCATTAAAAGCTTGCTAACTGA AATTTGATACCGGTCCTTTTTGATAGGTCTGGAAAACGCCCAGCAAAACG CTCGAACCCGGAAGAAGTAGTTTCTTCCTCTGACGACGACACACCCTTAT CGACCCCTGCAAAGAAGAGGCGCGCAGCCGCTCCTAGCAGTAAAAGTAAA AGCTCATCAAAAAAGAAAGACGAATCTTCAACCAAAAAGAAAACGAAAGT GGTTTCATCAAACGTACAAGCAGCAAAGAGAAACTTAAACGGCTCACCTA AAAAGAGCGCGGCGAGCCCAAAGAAAGTTACGAAAACTTCACCTTCTAAA AAGGACACTAAGAAATCGAAAGAGAATAGTTCACCTCGTAAAGTAGCGAA AAGTATACCGAAGCGAGCATCTCCGAAGAAGCGAGTGACAAGTCCACGGA AGAATGGTAGTACGAAACAAGCGAAAATCGATTCCTTCATGAACGGCCAC AAATCTTCGTCGAGTGAAGATGAGGATAGTATCGTCACGGCGAGTGAAGA AAGTAGTCAATACACAGCCATCAATGATGAACGACCTGCCCGTAAAAGGT ATTCCATAAATGCCGGTTGATTCCTTTCTTGTGCCGTTGTCATTGCAGTA AAGTGATCACATGGTCGACCATATGCATTTGATACATCCATTCACTTTAA GTGTGCACTGATCATCGTTTTCCTAGTCTAGCAAGCTAGACGACTAATTC ATACATAGTAGAAATAAAGCAAAAAGTAATAAAGAGAACAATTTTAGTCG TCTAGAAACCNNNNNNNNNNNNNNNNNNNNACGGCAAACGAAACGAAAAA TGTCGCTGTCAATCAACAGAAAAAGTATTATATTTGATTTATGCGACAAA ATCAATTATTGTGTATCTGTTTTCATAATGCTCAATCGTAGAATTACATT CACTTGATTTTAGAAGTTTTAATCATTAAAAGATTGGTAACTGAAATTTT ATACCGGTTCTTTTTTATAGGTCTGGAAAACGCCCAGCAAAACGCCCAAA CCTGGAAGAAGTAGTTTCTTCCTCTGACGATGACACACCCTTATCGACCC CTGCAAAGAAGAGGCGCGCAGCCGCTCCTAATAGTAAAAGTAAAAGCTCA TCAAAAAAGAAAGACGAATCTTCAACCAAAAAGAAAACGAAAGTGGTTTC ATCAAACGTACAAGCAGCAAAGAGAAACTTAAACGGCTCACCTAAAAAGA GCGCGGCGAGCCCAAAGAAAGTTACGAAAACTTCACCTTCTAAAAAGGAC ACTAAGAAATCGAAAGAGAATAGTTCACCTCGTAAAGTAGCGAAAAGTAT ACCGAAGCGAGCATCTCCGAAGAAGCGAGTGACAAGTCCACGGAAGAATG GTAGTACGAAACAAGCGAAAATCGATTCCTTCATGAACGGCCACAAATCT TCGTCGAGTGAAGATGAAGATGAGGATAGTATCGTCACGGCGAGTGAAGA AAGTAGTCAATACACAGCCATCAATGATGAACGACCTGCCCGTAAAAGGT ATTCCATAAGTCCCGGTTGATTTCTTTCTCGTGCCGTTGCCATTGCAGTA AAGTGATCACATCGTCAATCATATGCATTTAATATATCCATTCACTTTAA GTGTGCACTAATCATCGTTTTCCTTACCAATTTTCAAAGAACGCTTCAAT CTTGACATATTATATACCGTTGAAAAGATAATTCAGAGCACTATAGATTT TTAAGAAAAGTGATTACAAAAATTTGAGAAAATGCAGAAGAAAAAAATGA ACCTATTATCCTTTGGTGCTAAAACCTTCATTTTTGGTACAGAAGTACTT TGAAGTCTCCTGATTTCAATTGTATTGTTATTTTTCCTATAAATTTCTTG CGTCGAAGGTTACTGCCTCTTGGAGTTAATTCGTTGGAGTTGAAAACCCG TTTTTTGCTGTGTTTTTTTTCACTCCCACGGGCTATCTCTGTACCAAAAA TTTTTTTCTTCTTCACTTTTTATCTTCATTTTCTAAAATGCTTTGAATTC GTTTTCTTAGGAATTGTAGTGCTCTATATTATCTTTTCAACGGTATAGAA TATGTTAGAATTGAAGCTATCGTTGCATAATTGCAAGCAAAAATAAAATT AGTGAAAACTTAAAGTGAATAGGATATAGATTCATGACACGAGCTAACGA TTATGTACGCTTTCAAGACAAGACAAGACCAAACATACACCTTCCCAAGT GACATTCTCAGTAAATTGCCTTATACCTTTTATAAGGAAAATAGGTCAAG TAAAAGTGATCTCTTATATGGCCCTTATATTCCTCGATAAGGTATGTAAG AAAAACAAAAACTGTTAGAATAACATATTCAATCATATCTCAGAATTCAA CATCATTTCTGAAGTTTTCTTTTTGGACCTACCCCGGTGGGGTGGAGGTC CTATAAATTAACCTTTGTCCGTTCGTCCGTTCGTCCGTTCGTTCGTTAGT TATTAGCTTTCCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNTTCTGAATGATTGTTTAATGGT CACGTCACGTAGATATCAATTATATATGTGTTAAATGCATAACCAGGTAG GTCCATAAAAGTATCACTTGTTCTCTTTTCTTTTTAGAGTTACTCCATCA CCTTCACCCTCTCCCAAGAAAAACCGACGAAAGTAAGATTACAAACTCTT TATACTTGTTTCACACACCCTCACGTAGCCTAGTTAACTAAGCCAGTATT CATGAAGCTAGGACACACGACTAATGGCAATATAGCGTTTTCGGGGCTTT AAAGATTTTATATTTACGGATTTTAAGTTTGCCTTGGAATACTATTATTC AGTCACAACTTACCATCAGATTATTCTAGTACACGTTTTTTCTTTTTTAA GAAACTAGTTTTACCAAGCAGCCTCAATGTTTCTTAAGAAATCGGCCTTT TGAGCCTTAAATTTTTCTTACATGTTTCTAAACTTTTTGACAAAATCAGC CTCTCATTTGTTTTGATTGGAAGGTTCTTAAAAAAACGAATTAAAAAATG TTATTTTCTCATTCTCAGCCTCAGCATGTTTCTTAGATGTTTCTTAGTTT TTAGGCATTCTGAGCCTCATGTTTCTTAAAAGTGTGTTTCTTAAAAAAAA ACGTGTACCTGAATCAAATAGCTTAGATTTTTAGGTTTACCCTCACGTGG AAAGTTACTTTTTCTGAAAAAGTTTCCGTTCTGAATTGTTGTTCTTTTCT AATTTCAGCACATCGAAAATTAATTCTTCTCCGGTAAAGGTGAATTTTTG TTTATTTCAACTTGAATCATCGTTACGGTTTCAAACATTTTCAAATGTGG AAGGGAAAAATTACAGAACAGATCGAATTCCTCAAGTGAAACATCCGTAA AATTAAATTCCGCAGAAAAATTTCTAAACAGCAACAGCAATCCTTACATA TAATGAAAGTTAGATCCATCGCATGTAGTTTTTTTTTTCAAATCTTCTTT TATATTTTAGACGTTGAAAGAAAGAACGGTACAAGAGGACGAGAAACCCA CCCCAAAACTGAAGGTATATATTTACTATAGCATCATAAAACATTCAAAT GAGGTCTATTTAGCACGAAACTTACAAAGTACGTTGGTTGGAAGAATAAG GTTTAAATTCTTTACCTCGAAATTGCACTAAAGCCTCAACGGGAATGTGA AGTTTAAGATAAATTAGGCATACTCAGGGAAGGTTTTTAATGTCCAGTGG AGTACCGAAAACAAATCGCTTACAACTAAGGGCAATATTCATTCACTCAT CATGGGCCCCGTCAACTACCACTTTTTGGTAGACCATATCATACGTTTTT AAGAGTTACTATTTTAAGCTGGTGTGAGACCAAATCAAACCACAAAAACT ATTATATTTTCCCCAATTAGATATCGTTTTAAGGGCTCTGACCATAGTGA ATTTTTCATGATTGCCGTGTTTAAAATGTGTTTTCTGACTGATGTAACCA ACCAAACTAAGGCATGTTATACATTTTCTGTTAGAAAAACTATTCCTGAA TCTGAAAATTCAAAAATTGCATTGAAAAAATTTGATGAAGAAGAAAATGA AGACTTTTGCGAGGAAGAGTATTTCAACTTTGAAGAGCTTAGTTTCGGCG AAGAAAAAACATTTTGAAAATTTTTTCGCATTACATGGTGTATCTTTTAC CAAACAATAAAAATTTTTGCGGAAAAATTTTGTAAATGCTTCTTTGTCTC GAAATCTTCAAAATAGTGGTTTTTCATCAATTTTTCATCTGGATTTTGCT TAAAAAAACAGTCATAACTTTTGACACATCTTTTTAGAAAAATTTTCCGC AAAATTTAAAATAGTGCAATTCTTTGCGGGCAGTGTAAAGAAATTTTGAA ACAAAAAAGTTAATTACCCATTAAAACTAAGCACTATTTGTAAAAGAGGG TGATGCAACATATTATTAACATCTTTTTAAAGTTCATAACGTCATTTTTG CAATTAAATTCTTAATTACTCTTAAGGGATTCNNNNNTGTAAAGGCAATT CTTTGTTAAAAGTGTTAAGGAACCTGAAATATAACTTTTATGTTCAAATA CCAAAATCAACTTTTGGACTATGGTCAGAGCCCTTAAGGTGGTTTGAGGG TGTAAAACGTGAAAAATTTTCTTCGTCGCCCAACCATGGTGGGCGACATT TTTTTCCAAAATGTTGGCCCCCTCACTCGAAATGGCTCGCCGGGGCCCAT GTTCATTTTTGAATGAAATTACAGTCAACTCTCACTAATTCGAATCTCCT CCATTCGAATCTTTCTATAATTCGAACAAAAGTATTTTTCCTCAGCTAGG AATTAGTATAAATTACATTCTGTAATTCGAAGAAAATTCTTGGTTCCTTG AAGATCGAAGAAGAGAGAGTCATCTGTTGTTTCTTTTCTGTTACATTTAG ATTAAACGGAAACCTCGTGCGACACGCCGCTAACAACCAGAAAGTTTCCT CCGGCAATATTTTAAGCGTGTCATTGAAAACAAAACAGATAAGTATTTAT TTTTCATGTAAATATTCACAGTCAGGGGATAAACTTTTGACGTAGAAAGG ATCTAGTTTAGCCGGTCGGCTTGTTATCGCGTTGTAGCCCTTTTCGCGAA GTACGAAAAAACTCGGTTTTGTGATCGGCCGACTGAGCTAGATCTTGAAG GGTCCCTTTGTACGGCTATTTTTAACTCTTGATATTTTTTAGCAATTATT CTTTCAATAACCGAAAGTGTGGAAATATATTTTGTACATACTAAGCTTTC AGTTTCTTTAAATATTTTTTCTTCCATGAATATATATTTACTTTACCTGT TATTTCCATATCATCATCGTTTTTTCATAATTTTTTGACACTCATATCAG ACAATATCGAGTACCTCTCTAAAAATCGGGATTTTTCATCCCGTATCTTG GTTAGTTCCACTTTGATGATTTTCAAAAAATAGAAGCCTTCTAAGTGATT CGACGCAAATTCCATATTTTCGCTACTGCAGGAGCGATTTTTGCCTGTGC CAGACGACCACAATAGAGTGATCAAAAAATCGCGTGTTGGTATAGAGATA GGCTAGAGCGATTTTAAAGTGGCGTCAAAAAATCGAATGTTTGGCGCCCG AAAACCTGGAAAAAGTCGCAAAGTGGAATAGACGTTACTGTGTAGAGAAA AAGCTGTGACGTCTAGTATAGGCTAAGCAGACGTTAGATTGAAGTACTCT AAAATGCTAGACTTCACGCACATTCTCATTAAAACATCATCTCTATGTAC TTAAATATCATTAACTCTAATACTATTGGTTCTTTAGCTTATATTTAGCA ATTTAGTCTTTTCTCCTATTTTCTAGGTACAATATTTGGTCTTTTATTGT TCGCTGATTTTTTACTTTCAAACAATTTGAATGTCCTCGATTTTGAGCAG TTATGAATAAAAGCAACTTTTGAATCTTTATTTTTATTTTTGAAAACCTC CAACCTTGAACACAATACCTCGTTTGTCCGTTGCGAATAAATGATTCAGA CCAGGTTTCTTTTCATCCAGAATTCGATAAAATAAAAACTTTTCAAGATT TTCTTTGCTTAAGGTATAAATAACTGTTCCATATGATAAATTGTTTTTTT TAACTACTAGTCATTATAATTTTAGTTATAATATGTAAAGATATGAGATG TTCCTCTGTTATCACATTATAAATACAAGATTATTCAATTATATTGAAAT GTTCTTTTGCATAGTGCTGATGTGGGCAGTCACTTCCCCACTTCTCTACA GTCTCAGTGCTCCAGGAAAACAACACTTTCAATAATTTCACATATGTACT TTATGTTTCTCCTCCGCTTTTAGGATAATACATTTGAGTTGGATTGATAT GTTCTACTGATTGTTTGTAGGGGTACATTGCCATGTTGGCTACATGAGGT TGTCCCGCAAATGCGGGCATCGGCGGCCAGTTAATGTAAGGTTGCCCTGC AACATATGCTGCCGTTGCTGGTGGAAAAGCTGTCACGTATGTCGGTTGTT GATTGGGTATANGATGTAAGGTTGCCCTGCAACGTATGCTGCCGTTGCCG GTGGAAAAGCTGTCACATATGTCGGTTGCTGATTGGGTATAAATAACTCT CCTCCACTGAGGTAACCTCCATCTGTGTGTTCTGGTTTGTCAACTAATTG TACTCCACCATTATTGTCGGGCATTAGAATCTTGCTCTGCATCGGTGTTC GATCTCTACGCGGTGACGTGAGACGTCTATTTTGTCCGGAACCAAAAAAT CCAGCCTTTTCATCTTCATTAGAATTTGATTTAGTGTTTTGAGAATTTGT TGATTTTGTACGCCGATAAAAGATGAATAAACTTGCAATGATGATGATGA AAACACACGCAACTATACTCGCAATCAATGGAATGTTTATTCCACCGCCA CCACTTTTCTTTTCCCCGTCTCCCTCTTCACCAGACCCCTTATCAGGTTT TTCGTCAGAACCTTTTGGTGTGATTATTGTCGGCTTTGATGGATCTGAAA TATAAAGATAGATAAAAGTTATGAATTGTTTTTTGGGATAAAGTGGTCTT TATTTTGGGATCGTTTGTAAGGAGTAGGTGAAATCAATGCCATCCATTGG TTGATTATAGGTTTGGCAGTTTGCAGTAGCAAAGCCAAGAGGGGTGCAAA ATTTGTGTAGGAGAGCAGATTTTTATGCCATGCGCCCCTCTTAGGTACGC TACTGGTTCGGCAAATTTTAGAAAGGGACACTTTATTGGAAGCAATTATC TTTGATGATACCGTCAATTCAGAATTATACTTACTGCCTTGTGTTTAATT GATTGCTGTTTAATTCTATTATGATGGTATTTTAAAGCAGCTTCAAAATT TGTATTGATTGTTTGGTAAAGACTTACCTCGATATGTGACGTAAGAGAAT CGAACTTCTACATCCTGGAATTGTAAACTGCTAAATAAAGTCAAATTCAT CCGATTGCCAACTGACGTGAATCGTTTCTGTTGCATGTTTTGATATTGGT TGCCTCCTTCTTTTCCTCGGAATTGTCCAATCATTTTGTCAGGGCTTGCC ACAAACACGCTGCCCTGTTTCCAATTGAAGTTAGTTAATTTCTCTACAGT GACTATAATAAGATGATCCTTTTTAGCTTCGAAATTCCAAGTGCACATCA TATGTGTTGTGAAATATGTTCTGTATTGACCATGTGTTTCACTGAACTTG CATCCGCAACAATGTTTTGTGCTTTGAGGGTCTTCAGTTGTTGTGGGTGG AGTTTTGGTTACCTCCGCAATACTTCGTGTCGTATCACCTGTTGTTGAAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000484XLOC_000484Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000786-exon-sc0000005-1575043694:433270..433299TCONS_00000786-exon-sc0000005-1575043694:433270..433299Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:430938..430986TCONS_00000786-exon-sc0000005-1575043694:430938..430986Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:429678..429726TCONS_00000786-exon-sc0000005-1575043694:429678..429726Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:429210..429565TCONS_00000786-exon-sc0000005-1575043694:429210..429565Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:428852..428942TCONS_00000786-exon-sc0000005-1575043694:428852..428942Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:428485..428554TCONS_00000786-exon-sc0000005-1575043694:428485..428554Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:428128..428251TCONS_00000786-exon-sc0000005-1575043694:428128..428251Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:427328..427489TCONS_00000786-exon-sc0000005-1575043694:427328..427489Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:426931..427008TCONS_00000786-exon-sc0000005-1575043694:426931..427008Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:426182..426321TCONS_00000786-exon-sc0000005-1575043694:426182..426321Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:418796..419054TCONS_00000786-exon-sc0000005-1575043694:418796..419054Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:416956..417025TCONS_00000786-exon-sc0000005-1575043694:416956..417025Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:411882..411993TCONS_00000786-exon-sc0000005-1575043694:411882..411993Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:411410..411539TCONS_00000786-exon-sc0000005-1575043694:411410..411539Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:411204..411251TCONS_00000786-exon-sc0000005-1575043694:411204..411251Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:410908..410979TCONS_00000786-exon-sc0000005-1575043694:410908..410979Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:410588..410644TCONS_00000786-exon-sc0000005-1575043694:410588..410644Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:410170..410231TCONS_00000786-exon-sc0000005-1575043694:410170..410231Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:408552..409079TCONS_00000786-exon-sc0000005-1575043694:408552..409079Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:405768..405812TCONS_00000786-exon-sc0000005-1575043694:405768..405812Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:405161..405191TCONS_00000786-exon-sc0000005-1575043694:405161..405191Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:404886..404939TCONS_00000786-exon-sc0000005-1575043694:404886..404939Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:401947..403499TCONS_00000786-exon-sc0000005-1575043694:401947..403499Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1575043694:400600..401866TCONS_00000786-exon-sc0000005-1575043694:400600..401866Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:433270..433299TCONS_00000786-exon-sc0000005-1510915933:433270..433299Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:430938..430986TCONS_00000786-exon-sc0000005-1510915933:430938..430986Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:429678..429726TCONS_00000786-exon-sc0000005-1510915933:429678..429726Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:429210..429565TCONS_00000786-exon-sc0000005-1510915933:429210..429565Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:428852..428942TCONS_00000786-exon-sc0000005-1510915933:428852..428942Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:428485..428554TCONS_00000786-exon-sc0000005-1510915933:428485..428554Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:428128..428251TCONS_00000786-exon-sc0000005-1510915933:428128..428251Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:427328..427489TCONS_00000786-exon-sc0000005-1510915933:427328..427489Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:426931..427008TCONS_00000786-exon-sc0000005-1510915933:426931..427008Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:426182..426321TCONS_00000786-exon-sc0000005-1510915933:426182..426321Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:418796..419054TCONS_00000786-exon-sc0000005-1510915933:418796..419054Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:416956..417025TCONS_00000786-exon-sc0000005-1510915933:416956..417025Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:411882..411993TCONS_00000786-exon-sc0000005-1510915933:411882..411993Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:411410..411539TCONS_00000786-exon-sc0000005-1510915933:411410..411539Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:411204..411251TCONS_00000786-exon-sc0000005-1510915933:411204..411251Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:410908..410979TCONS_00000786-exon-sc0000005-1510915933:410908..410979Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:410588..410644TCONS_00000786-exon-sc0000005-1510915933:410588..410644Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:410170..410231TCONS_00000786-exon-sc0000005-1510915933:410170..410231Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:408552..409079TCONS_00000786-exon-sc0000005-1510915933:408552..409079Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:405768..405812TCONS_00000786-exon-sc0000005-1510915933:405768..405812Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:405161..405191TCONS_00000786-exon-sc0000005-1510915933:405161..405191Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:404886..404939TCONS_00000786-exon-sc0000005-1510915933:404886..404939Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:401947..403499TCONS_00000786-exon-sc0000005-1510915933:401947..403499Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1510915933:400600..401866TCONS_00000786-exon-sc0000005-1510915933:400600..401866Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:433270..433299TCONS_00000786-exon-sc0000005-1491911889:433270..433299Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:430938..430986TCONS_00000786-exon-sc0000005-1491911889:430938..430986Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:429678..429726TCONS_00000786-exon-sc0000005-1491911889:429678..429726Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:429210..429565TCONS_00000786-exon-sc0000005-1491911889:429210..429565Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:428852..428942TCONS_00000786-exon-sc0000005-1491911889:428852..428942Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:428485..428554TCONS_00000786-exon-sc0000005-1491911889:428485..428554Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:428128..428251TCONS_00000786-exon-sc0000005-1491911889:428128..428251Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:427328..427489TCONS_00000786-exon-sc0000005-1491911889:427328..427489Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:426931..427008TCONS_00000786-exon-sc0000005-1491911889:426931..427008Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:426182..426321TCONS_00000786-exon-sc0000005-1491911889:426182..426321Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:418796..419054TCONS_00000786-exon-sc0000005-1491911889:418796..419054Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:416956..417025TCONS_00000786-exon-sc0000005-1491911889:416956..417025Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:411882..411993TCONS_00000786-exon-sc0000005-1491911889:411882..411993Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:411410..411539TCONS_00000786-exon-sc0000005-1491911889:411410..411539Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:411204..411251TCONS_00000786-exon-sc0000005-1491911889:411204..411251Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:410908..410979TCONS_00000786-exon-sc0000005-1491911889:410908..410979Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:410588..410644TCONS_00000786-exon-sc0000005-1491911889:410588..410644Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:410170..410231TCONS_00000786-exon-sc0000005-1491911889:410170..410231Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:408552..409079TCONS_00000786-exon-sc0000005-1491911889:408552..409079Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:405768..405812TCONS_00000786-exon-sc0000005-1491911889:405768..405812Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:405161..405191TCONS_00000786-exon-sc0000005-1491911889:405161..405191Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:404886..404939TCONS_00000786-exon-sc0000005-1491911889:404886..404939Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:401947..403499TCONS_00000786-exon-sc0000005-1491911889:401947..403499Clytia hemisphaericaexon
TCONS_00000786-exon-sc0000005-1491911889:400600..401866TCONS_00000786-exon-sc0000005-1491911889:400600..401866Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000005supercontigsc0000005:400600..433299 -
Expression
No biomaterial libraries express this feature.
Blast
BLAST of TCONS_00000786 vs. Swiss-Prot (Human)
Match: PDS5B (Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens GN=PDS5B PE=1 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 1.473e-115
Identity = 250/636 (39.31%), Postives = 371/636 (58.33%), Query Frame = 2
Query:   50 DLLTAIPDEEIDDREKLIHRLTIMIARALPDPIKTQEHLKKLI-VLLSDKTTYKLFSESTDLKQDCTKIIKCVSEIVKKLSG----KHPIIDTVKCLLDRACPMLVDQTSFVSLIRKMKNYFEGMXXXXXXXXXXXXXXXXXXXXXXXIQVLVKVRPSIFQTKQAYETFLVFLKHNDPEIVQQSLNCLRHVLANIEEVDKSLSACFKPVLNKLVVTGSPKQSKYAVRCLLAMMKDSVVSLERLFTTLVDSLDEDETCYKLQTTLSALGEMAILAPEVFETKHKMIIRDFVVKKILVIDR---EKTSRKKEPDDEWGDESKVSEETTMKIEAIKLLVKWLLGL--DSARTGDNALPVLRLLCTIINNDGDLSGDGKISAINRSRLRLKAGSGLLKLAQQTKYTDQITVEQYHQVALIMQDSCCEVRDFFTTKLHKGLETLRLPPSYMAIYALAAVDPSRERKQKVKQMIVKNSQTRRDYTKQHSSVASKPYAVLPEYSLPYLVHLLAHHPDF-NHKDNESLLECKEYLWYFLEPILGSKAEN--YSFLKKLLENIKRTKDALAGDDQTVNEKLYAVCDLAIACIMQKTQTFTLKEFPGNLVLPKKLFIAEKNSAANSKSYLPKNF--IFSPKKIKST 1912
            DLL  I   + D   K I    ++I R LPDP K Q+ +KK   VL  D+   K           C +   CV EI KKL       +P ++ +K LL+R  P+ +D  S  +LI+++    +G     DD+          +  L+L++VL    P  F + + +E+ L  LK +D ++ + +L   ++  + IEE    + +   PVL+     G P+Q+KYA+ C+ A+         ++F  L  SLD     + L T L  +G +A+LAP+ F    K ++  F+VK +L+ DR   +KT++   PD+E      VS ET +KI+AIK++V+WLLG+  + +++G +    LRLL TI+++DGDL+  GKIS  + SRLRL AGS ++KLAQ+  Y + IT+EQY   AL + D C +VR  F  KLHKGL  LRLP  YMAI AL A DP +ER+   +Q +VKN   RR+Y KQH++V+ K  ++LPEY +PY +HLLAH PD+   +D E L + KE LW+ LE IL +K EN  ++F++K++ENIK+TKDA   DD  +NEKLY VCD+A+  IM K+ T++L E P + VLP + F     + +N+K+YLP      F+P K K+T
Sbjct:  508 DLLDLIKQPKTDASVKAIFSKVMVITRNLPDPGKAQDFMKKFTQVLEDDEKIRKQLEVLVSPTCSCKQAEGCVREITKKLGNPKQPTNPFLEMIKFLLERIAPVHIDTESISALIKQVNKSIDG---TADDEDEGVPTDQAIRAGLELLKVLSFTHPISFHSAETFESLLACLKMDDEKVAEAALQIFKNTGSKIEEDFPHIRSALLPVLHHKSKKGPPRQAKYAIHCIHAIFSSKETQFAQIFEPLHKSLDPSNLEH-LITPLVTIGHIALLAPDQFAAPLKSLVATFIVKDLLMNDRLPGKKTTKLWVPDEE------VSPETMVKIQAIKMMVRWLLGMKNNHSKSGTS---TLRLLTTILHSDGDLTEQGKISKPDMSRLRLAAGSAIVKLAQEPCYHEIITLEQYQLCALAINDECYQVRQVFAQKLHKGLSRLRLPLEYMAICALCAKDPVKERRAHARQCLVKNINVRREYLKQHAAVSEKLLSLLPEYVVPYTIHLLAHDPDYVKVQDIEQLKDVKECLWFVLE-ILMAKNENNSHAFIRKMVENIKQTKDAQGPDDAKMNEKLYTVCDVAMNIIMSKSTTYSL-ESPKDPVLPARFFTQPDKNFSNTKNYLPPEMKSFFTPGKPKTT 1128          
The following BLAST results are available for this feature:
BLAST of TCONS_00000786 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PDS5B1.473e-11539.31Sister chromatid cohesion protein PDS5 homolog B O... [more]
back to top