Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000777 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000777
Unique NameTCONS_00000777
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length6758

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000777 ID=TCONS_00000777|Name=TCONS_00000777|organism=Clytia hemisphaerica|type=transcript|length=6758bp
GTTGTTGGTGACTGAACATGCTGCTAAAAACGTAGATCTAAATGAGAAAA
AGATTGAGTGTTAGTTATCATGCCACCAAAACGCAAGAGAAAGGGAGGTA
GCCAAGATACATCTTCTAAGAAAGTCAAACAAAACGAACAAGAAAATATG
AGCTCCATGcagaaatattttaaatcagCATTAAACTGTGTGGATATGCC
ATCAAATAAAGATCAAGCTTTTTCTAACAAACGTTGTGAATCATTCTTTC
ACAAATATGCAGATTCCAACTTATCGTTGATTGGTCCTCATGGTGTTGAA
AAACTTTGTCAGGATCTCGAAGTACAACCTGAAGATATTGTGATGCTAGT
ATTGTCATGGAAATTAGGTGCAGAAAATATGGGATGGTATAAATTGGCAG
AGTGGAAAACTGGAATGACCTCTATCGAatgtgacaatatttcaaaattg
aagAATAAAATTCCATCGCTACGTGGTTTACTTAAAGATCCATCTTcctt
taaaaagattttcagatATGCTTTCGACTTTGCCAGGGATAAAGAGCAAA
AGAGTCTTGACATCGATACTGGCAAAGCTATGTTACAATTGTTGCTTGAA
AGCTGGCATCTGGTTGCCGACTTCATCCAATTCTTAAATCAATCAAGGTA
CAAAATTATCAATCGTGACCAATGGAACAGTTTATTAGAATTCATCAAAA
CAGTGGACACTGCAGATTTCTCTGGTTATGATGACGAAGGAGCTTGGCCC
GTAATGCTTGATGAGTTTGTAGAATGgcataaagaaaaaagtacaatGTC
GTGAGTGGATGGATTTTAATAACGTTCAGATGCATTTCATGACCAAATAG
TGAGAGGGGAAGATTGAATCCAGGAGGGAAGATGTGGTGTTGCTTCAACT
TATCCCTGGTTGATTCATAAAGACGTTCCATTCTATCAGGCTCCGAAGAA
GAGAAGATCCATAAATACTACGTTCTTATAGTATTGGGTATCGTCAAAAG
AAGACAATCTGTTTCAGCAAAGTTTATAAACCCCCTATTTCAAGGCGAAC
CATTTTGTACCGTGGCTGAAGAGGACCTTTAAGTTTGTATTTAGTTTGCG
TTGTAACACGCGGCCGCGCTAACTATACGCGGCCGCGTGTTACAGTATGC
GGCCGCGTGTTACAATACGCGGCcgcgtctttttttgaaaacaaaaacat
gcgGCCGCATCTTTTTTCGAAAACACGCGGCCGCGTCTTTTTTCGAAAAC
ACGCGGCCGGGGAATAAAACCTGCGGCCGCGTGTTTTTGTCAAGAAAAAG
ACGCGGCCGCGTGATTTGTCAAGAAAAACACGCGGCCGCGCGTTATAAAC
ATGCGGCCGGATCTTTCTTTGATGAATGTTGAAGTCCATGTGCACGTGGG
GATCGTGAAGGtacacaaacaacaaaatggcgGAGGACGAAGGAGCTTAT
GAAAGAattagTAGTTTTCTCAACCTGCGAAACATTGGTCACTTATTAGA
AACATTTAAAGTCCACAAAATTGATGACACGGTGTTAAAAAGTGTTGACG
ACCTAACATTGGCTAATCTTGGTTTAGCGTATGGTGATGTGATTGCATTC
AAGTTGAAATTCAAAGAATCTGAGACCAACCCACAAAAGACCTATGAATC
AAGGttgcaaaatttaaaagacaAAATGAATATTTCAAGACAAAGAACTG
ACAGAAAAGATGCAAAAAACAGATCCATCAGtgttaaaaatgtctttaag
ATGACATTATTCTTaaagtgttttgaaaaaaagtatgTGAGAAAATCTGG
AGAAATGTTTGAGACAACTGTATGCATGGAAACTTCTTATGATAAACTTC
ATAACGAAGCaaaagaacattttggaattgatAAGACAACCAACACCTTC
TTAGCTTCTTACAATAATGAGACTTATCAAGGAGTCATAAATAAGATGGG
CCAATTCATTGctttgaataaagaaaagaaaaaacaattggTAATGTACC
TCATGTATCCAAAAACTTATGGCCGCTTGGAGTAtgaaagaaacaaagaa
aattccaTTTTACAATTTTGCGATGTGTGTGACAAAGAGTTTGTTGGCTT
TTGCGTTTATTGTGCTGCACAGCAAGAGCTGGAACAACATGGCAATTACA
ACCCTCTTGTTTTCGATGATTTTGATGGACAAAACGATCAAGGAGATGGA
GTTGGAAGTGGAAGAAGTCGATCCCCACTATCTGAAACAGCTTCCATGGA
AGATGTCACATCTGAAAGCACACCAGTGAATAGCGGGCTACTACCCTCAT
CAAGACAACGTAGCATACCATTGCGGTACAGGCATTCTATCGGGTCACCT
GGACTGACGCATAATCTTCTATATGAACGATCACAGAATCCAATTCCACC
CCCAGATGGACAAAATCAACATCCACTAGAAAAGGAAGATCAGCAAAAAG
ATTCTAGTGTTGTCAGTTTATTTGGACAAGACGAGATGGACAGGTTTTTT
GAGAATCTCAGAGAAAAACCGCAAAATGTGACTAAAAAAACAGAAGAAGA
ACAACCTCCAATTGCAGCAGATATCTCAACTGCTTATGACGAGTTTGTTC
ATCGAGAAAAGGAGCCCAAAAACATTCTCGTTCAAAGAGATAAAGACTTC
TTTTGGCAAATCCTTTTTAGCCAAGAATTTAATTTGTCATGTGAAGAGCC
TCGTGTCCGGTTTGCAGGGGAATCCGGTGCTGATGAAGGTGGGGTTTATC
GTGAATTTTTAACATTAGCCATGAAAAACCTGAGTCTCTCCAACCTTTTC
ATCGGAGAGGAAACATGCTTAGGAATAACATGCAAAACTGAAGCCATATT
GGATGGATGGTACCATATAATAGGGCAGCTTATTGGTGCGTCAATTTTGA
TCAATGGCCGAGGTCCTGAATGTTTTCATGACTCGCTAGTACGGGCGCTT
TTTGATATTGAGCAACCGCtgttaatcgaaccaatcgatgATGCTTCTat
caaaaaccaaatttctCACATCAACCAAGGCAACTACGATACCCTTTATG
ACTACGAAATTAATCCTAGTggaaaggaaaaagaagaacttaTAAGATTA
TATATGATAGCAGTCCTCGTGGTTTCAAAATCGTCTGCCATCGAGCAGTT
GAAAGGTGGTATTTGTTCAATTAGCAAAAATCTTCTACTCAAAAGCAACC
TTcaggaaatgaaaaattttttagtCTACTCTCCTGTACAGTATTCGTTT
GAACAATTCATCAGCCAAATTGAGTACCCACAAAATAAAATTGGCGCTGT
AGAGGTAGGATCCAATTTGGAAAATGAAGTTCGTCGGGGTGTTGCAGATT
TCGAACTTATTTTGTTAAATATTGGACAGGGTAAAGTTTTTCTGGAACCA
GGTACCGCTCTGAGATATACAGATCTATTATATTTCATCACTGGTTGTGA
CCGAATTCCATCTTGGGGTTTGCCAAAGAAAATCGAAGTCGATTTTGATC
CTACCACCACTTTACCACACACGCACACCTGTGGGTCTTTGCTTCACCTC
CCATTCCGAGTTACAGAGTCACAGATGGTTGTGGCCATAAATTTTGGTGG
AGGTTTTGGCAAGATTtagaaattgaactttttaaaaacatgacTTTCGA
AAACTCATTTATCCTGTTGATATTTGTTAAGTAGCACTatgaaaaacttt
tgatttgGGTTTTACAGTTATGATGAAGTGAAAACTAAATTGTGATTGAC
ATATTATCTTTTGTTTACCAAAACGTTTCATTTTctatgtgttttttttc
attcacactACATTTTTTACATTCTTTGGATTTCACTTTTCCTAGGCAGT
TAAAATGAGATCTAGCACAACGAATAATCtacaaaaattcttttcatttg
gTTTATAACAAAGGCTCGTTGTACATATTTGTTAAGTTCTCATTATACAA
ATGGGCGTGCACTTGTTTAAGAATAAATAATGACATAGATAATATGCATG
GGACCTCCACGAAAGTGGAAATGTTATAATAATAATTACATTAGTTTACA
CTGAAATCCAACCTTCTGTTATCTCTTCACTGTCTTCACATTTTTAACAC
ATCAAACGTTTTGCAGATTCCTACAGTTTAAGGAAAAGTAGGTGAATGAG
CGTTTTTattgtatatatatttttaaagatttttaaaagatgcaaattat
tttttgatttcgtTTGAATATGAGGTACTTTCTATTATAAAAGAAATTTC
ATTTACAGTTTCTACATGGTGATCGGCAAAGAAGCTAAACTTTTGAgttg
aattgattttttattgacaCAGCATTTTAAGGAATTGGGACAAGCCATTG
CTAAAGCAAAGCTGAATTTATTCATCTGTAAGCGTCCGATTTTTTTCTCG
GCTAcattttgaagtgttttttGTATTCTCTTGATATTTAAAACTTGATT
ATGGAGTGAGTATTATCCTTATTTAGATCAAAGTTCTGTTAATATTTCAT
TTAGTTTTGTTATACTGCAGCTTTTATTGTAGATCTgttatttatttgat
atttatactcttttgatatttaaaagatttttccgCAGCAAGTATTTCTT
GGATTCATATCATCTACCATAAGGGAAGAAAATTTAACactattcttata
taaaaaagagcGTATTTCGAGGTTCCAAAATTTCGCCTTTCGCCAaatta
cacacttttttataagaaaagtctCTATAAGAAACTCAGGGTTAAAATCG
CCAAATTGTAAGAATAACTTAACCCTATTCCAAcgagatgagctggagtt
tttacaagatgcttaactgattggttatttttaaacaatagggatgacgc
gttctttagaaaaagtaataaaatcgtttgtctcaacatttaacgaccaa
cagaaTCATCAaataacttgtaaaaactccagcttgacccattCTAACAG
GTAGAAATTTTGGCagatttggccagaatccgccaaattaagttcccgcc
aaaatttcttttttttcgccatccgccaaattaaactttttgaaaatatg
atctcttttaaggtatttttgcattttttttgctgtttttacacCATATT
AAGgacaaatttttcagcaaacgccaaattaaattcccgcaaaatttagt
tttttcgtccatacgccaaattaaattcccgccaaaatttcttcctttaa
ggtaggcTTTTTGAACCTACCACCGgtggtcctataaattaacccctGTC
CGTCTGTTCATTCGTTCGTTtcttcgtccgtctgttaccagcttttctca
ggatttctTTGCACAAAGAGGCGTATTAGCAATGTCcgaaacatggccga
gtccgattttggaaaaaaaaaatttcccgccGAAAATACCGAAAATATGC
CCGAAATCTCCGTTTTTTGCAGAtattcattggattttttccttttattt
cgttgttttttcacactaAAACATCATTAATAAAAATACCCACCATCAAT
GTTGCATGTTTCAATTgtcaaaaaaactgaattttgaagccggaactttc
taaaattcGCCGGAACAGCcaattttcgccggaaaaatggtatttcttga
atttttcgagctgtactttatattttttcatgaaattttgcacactgatg
caaaatggcaatacctaaaatatgacagagcccgattttcaataACCATT
GTTTGTACATTGTACATTGACTTTGTTTGAATCTCCgttatggataataa
tagtaatagtttTCGTTTGTCGTTGTTCATTAATTATGCCCTTGCAgatt
gattattagccctctagtgctATTTGCGCTCTCCGCTTCGGAGACCTACC
TTTGCCTGAAAActctcaaagaaaaaagaatatgatGTGATATTTGCACG
TCTCAGCCTTTGAAGAGTTGTCCATCGAGTTACCAGCTGTCGAGCCTATC
AGAAAATAAGCTGACTAGGGCGATTTACGGCATGGAGCAAAATTACCGTA
AAAAATGCACACCACTTCCACCCATCTGAGCATACTCATTCATAACTTAA
aagaagcgtatttggatgtagaaagTGGAAAAACCTGTGAGAGATTGATA
TTTTAAACACACAAAAAGTTATTAGCGGAAAACctcaattatgacgtcat
aaaaattaaaacttgaataCTTCTTGAATTGCAATTCGAATcagatcaaa
atttaaccaGCCCTCTTATTAGAAAATCAGTAAAATTAGAAATTAAGTAA
AAATGTGAGATTGTTCAACCAAAATGTATTGAAATGTATAAAAATTATAG
ATTATGTTGTATGTTACCTAATACGCGGAGTTTGGATTTGGGGTAACATT
TGGGGTAACACCCAAAAATAATAAAGCTACTACTAACTTGACTCCTAGGA
CCGTTTTAAGACAGCCACTGGAGCAGGACCTAAGAGAACCGCGTAGCGAT
GGCTGTGACGGACAGGGAGCCTTAACCGTAATTCCGGTCATGGGAGGTGT
TTTACAGTTCTTCAGTTATAGcttattattatccatatagcggtcattaa
gtaagccattaaagattcaAACGGCGGGCGATATTGAAAGGTTCCGTGAT
tcaaatagtcatacccgcgctggGGAAGCTAAGGTGCTcggcttcagagg
gctgaaatatcattaactatcaggggggatcgggttcaataatccgaaat
gataagccgtcgtcgaacatagaggtcgtcgtcgccgcgcatagaggccg
tggtcgga
Run BLAST on NCBI

transcript from alignment at sc0000005:265228..311333-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000777 ID=TCONS_00000777|Name=TCONS_00000777|organism=Clytia hemisphaerica|type=transcript|length=46106bp|location=Sequence derived from alignment at sc0000005:265228..311333- (Clytia hemisphaerica)
GTTGTTGGTGACTGAACATGCTGCTAAAAACGGTAAACAGTGTTATAGCT TTTTTCAACTTCTAGCTCAACTGACAATGTATGTTAGCCATTCCAGGGTA GAATATCAAATTAAGTTGGGGGATTTGAAACCTAATCCATGCCATCTAGC AGTTCCCCGGAGATATGGCAATTTTTGTATGATACCCCGGATAGCCATTC CAGGGTCAAATTGAAAATATTCTGATGGCAATCAAACCTAGTTCATCTTG TAGAGCTTCAAAAAAGAAAAAAAATGAGGGGTCATACACCTCCTAATTAA TGATAAGCGGTTCCGGAGATATTGAGATTTTGGTTCTGCTATAATAGCAC CTTTTTAGACATTTGAGGTTGACAATTTAGCCCAGAAATGGCATATAAAA TGGCACCGAAATATGCTGCGAAAATTTAAAAATTCAAGCTTTTGTATTGA GTCAAGATATTCCAGATATCTTCATTTTGACTGCAGACTTTTATCAAATT CTTTTTGTAATGGCTTGCTAAAACACTTCACAAGGAAGAAATGAAAAGAC ATTGTTTTGAAAAGAAGACATTGCATTGCAAAAAAACAATAAAAACGTTA TAAAGCGGAAGCTAAAATTGCTGAACCTACCTATCTTTGTAATGAAAGCG CTGTGGAGGAAAAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN AAAAAACAAGCAAACCCGGAATGGCTACCCCGGAAACCAGTCTGGAAAGG AGGGAAATGTCGCGCCGGAGCTGCGCCAACTTAACTGGGTTGTTGTTGAG GGCAGCAGATCTCAAACCTCAAATCTACGCCGGAGATATCCGGCGGCGCA CAAGCCGCAATTGCCAGTCTGGAAATTGCGCAATTTCCAGACTGGCCCGG AAAAAGGGGCTGTTTTGACAATAAAGGTTGTTTTTGACTGCAGACTTTTA TCAAATTCTTTTTGTAATGGCTTGCTAACACTTTCAAGGAAGAAATGAAA AGACATTTTTTTGAAAAAGAATACATTGCATTGCAAAAAACAATAAAAAC GTTATCTAGTGGAAGTTAAAATTGCTGAATCTAACTATCTTTGTAATCAA AGCGCTGCGGAGGAAAAATTCCCCATGGCATATAAATAACTGTTGTAGGC TAAAAAAGGGTCAAATTTTTCAGTGGTACCACTCATCTCTATAATTCTAG TCCTCATTTCCAGGCTGAAAATGCTTGCCAAAGTAAGAAAAGTCAAAAAT AATAACTTAATGAAAGAATTACAGTAATTGGATTTCTCAGGTATTTTCTG ATAAATATGGAAAGTTTCACTGTCTGAACATTTTTTCCTCCGCAGCGCTT TGAAATCAAAGATGAGATGTGAAATTTTTTGTGTCCCCCAGATCTAATTT TTCTAAAAATGGCCTTAGTTGGAACAAATTTTTAGACATGGCTGGAAAGC TAAAAGAAAGCTCTAAATTACTCAAAAAGAATTAATTTTATAGCTCAACT ACACAAAGAACAATTGCTAGTCAAAATTGGACCTAAAATTGAAGATTTTC ATGAGCGTCAAATAAAAAACAAGCAAACCCGGAATGGCTATGTATGTACT GTCAACTGCTCTAACTTGGGACTATCTGACAAAACATGGAACGGTTGGAA CAGGGCAAATCACAATTTGGCCACCATTTTCACGCACCGAACCTCCAAAG TCATTTGATTTGAATTAATGAACGGCGTATTTAAAAAATACACGATTTCT CTTTCGCACCGATTAGGCTTTTAAATCGGAATATGAAAAAAATCCGTAGT GGAACACACACAACACGCGATTGTCTGTGCACTCTAAGTCTAAGAGGAAC GAAGAAGTATCATTTTAAATGACCCTGTCAATATTCTGGCTCGAAAGGGT CATTTGTAATCAGGTTTGTGATAAAATCAAGTCATGTCAAAATATTCTCG GCTATCTACTTCAGTTACCTGCTCCAATGAAACAGGGGCATACTCACTAA TTTTAAGTTTCAGATTTTCATAACTGATTCTTTTAAATAAAGCTAAGATG AATGAACAAACAAAATATTTTTCTTCTACGAAAAAGTGTGTCTAGACAAA ATCTGCGTAGTCTGACTGTAAACTTTATAGAAAAAGCGCGGGAAAATAAA GTGAAGAGAAAAAAAGAGAAAATATTTTCATGTCTTCAAAACGCCATAAG ACAAAAAGTTGAAATTTTTTTAACACAAAATTTTCAGATTAGGTCGAACT GGGCATGCTGGTTATTTTAAAGGTATTTTCGAGCAATTTTGAGGTATATA TATATACAGTAAATATTAAGTATAGGTAGTAAATATTAAGCAGGCTTCGG CATAAGAAAAAAGTAGGCGTGTGATCATTGCACGCCTACATAGTAATTTT TAGTAATTTAGGCGTGCGAATCATGGCACGCCTCATTCTCTTTAGACGTG CGATCGCGTGCGATCGTTTTTTTCTTTTATTTTATAAACATCATTAACAA TGATGAGGCACAAACTTTTGAACAATTCCTAAGAATGATCTNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNTTTATACCGGGTGACCCACGAAAAAGTTCAGACGTTTCTCGACGTCT TGAGGCCGAACAAATGTCCCAAAGTGCTTGCAGTTTCGGTATTTAGAAAG TAGATATCCTAACTTAAAATTTGAGTTATCACTTTTTAAATTTGACCAAG TAGTTCTCTACTTATGAGCTTTTATAGTTAAAATTCACTTTTCGGAAAGT GTAAAAAACATGTAAAAAAGAGGTATTAAATTCATGCAACCAATTAGAAA ATCACTTACAAATTGACTTATCTAACGAGTTTTATGACATTAATCATTAT GAAAAACACCTTTGAAAGTAATTTTTGTTTAAACCAAGACTAGTTTTTAT AAAAAATTGGCACTTTCATGGAATTTTCTCAACAACTCTATATCGAAAAC GTCTAAAAATACCTAATTTGATACCCCTTTTTTACTTGTTTTTTACACTT TCCGAAAAGTGAATTTTGAGTTTAAAAGCTCATAAGTAGTGAACTTTTGG GTCAAATTTAAAAAGTAATAGCTCAAATTTTAAGTTAGGATATCTACTTT TTAAATACCAAAACTCAAAGCACTTTGGGACATTTGTTCGGCCTCAAGAC GTCGAGAAACGTCCGAACTTTTTCGTGGGTCACCCGGTACATAAAAACTA GACAACAGGAAAGAATAAAGTGTTAAGAAGAGCTAGTTTATTGTCATAAA CCAACGACCTCATAAACATAGCATGGGAGAGGGAAGGAAAAAGATTTGAG AGGGGAAAAATCAGCAAAAGTGATTTTTTAAAAAAGGTTTTAGAGAGACG AAAAATCGTGCAGCAAAAGTTATTTTTGAGAAAGGCTTATTTATTGAAGA CCAAAGCATAATATGAGAGAAAGAGGAGAGAGAAGATGTGTATCCATTAG AGTAACTTTTTTATAAGAAATTTTGTATACATATAGCAGTTTGAAAGAGT AAAGGAAATTTTATCTTTCATCTAGATTTGGTTCCTTATGATTAAAGTAG AAAATGATATTTGATCTTCTTTCAACAAGCAGAAAAAATATTTCTAGAAT AAGTTTTTGCATGTGCAATTGATCGCACGCCTCGCTAGGTTTTCATGATT TATGACGTGTGATAAATTGCACGCCTAAAAGGCTTTTGGGCGTGTGCGGA GGCGTGCGCGTGCGATCGCACGCCTAATATGCCGAAGCCTGATTAAGTAG TAGGTATTAGGTGTTTTAGACCTGCCCGTTTTAGATAATATTATGAATAG AAAGAACATGGTAAAAATTGAGAGAGTTTTGTTCAACAGAACTTAGAAAA GCTAAAAACAAACAAGGAAACCAATGTAGGGAAAAACAGGTTGTTTGCCT CCAGAGACCAAATGGTGGAGAGCAACAAAACAATGCACGCACATCTGTGC TACGAATTACGGGAAAGGTGTATTAAAAAACTCCAGCCTCAAAACAAATT AATGCATAGCTATTATGTCCATTAATTTTTCTTATCATTGTTTTGAAGCG AGAGTTTTTTAAATTATTCAACATGACATCCTGACTAGCAAAGGTATATA TCAAAGTTATTAGCTATTTGGGGGTCTTGCTTGTTTCTATTCTTTTTCTA TAGACCTTTTTGCCTTTCCATCCGCCATCTTGAATTGTATGCAAAAATAC AGGGATGAAAAAGCTGTGGTGGGATTTAGTTGGAAAATATGCAAAACATA ATATCATCATCATCATCCTTCGATCTAGGTCTTTCATGGCTCGCACCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCGCCCCCCCGCCCCCCCCCCCCCCC CCCCCCCCCCCCCGCCCCCCCGCCCCCCCCCCCCCCCCCCCCCCCCCCCC GCCTGAGCGGGGGGAGCTACACCTCAAATTTGCCATATAAGAGGTGGGAG CTGTTTGTTTTTCCTGACAGGCGGGGGGAGCTCTATCTTGGGGGGGACCT GCATAATTTTATGCAACTCTGGGGGCTAAATAACACTTCCTAAATATTTT TTCTTTACTGTTTTTAATTTCTCTAAAAAACCTTTATGTCTTCATGCGAA GTGTGATCTGATCCTTAGAAGTGCACACACATGTAAATAGAGCTTTGGAA ATCCTTGCAGGGTTCCCAGCGGTCAGGGAAAACCTGTAAAACCTGGAAAA GGACTGCTTTTAGAAAAAGTCAGGCAAAACCTGGAAAAGTCAGGGAATTT TTTCCAGAATGCCTTGAATTTGATGATTTTTAGCCAATCTAGGAATNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACTCAAGGGTGCAT AAGTTGTATAATGTTAAGTTACTACTAGTTTACTTTACTGTTTATTTACT TGTGTTTTCATTGACTAAATGGTAAAAATTCACATTGAAAAGAAATTATT CATCAAAACTTTTTCCCTATTATACTGGGACCTAAAATTTTATCAGGCTG GGGGGACCTTGTTCTTAGGGGGGACCTAAATTTAGCGGGGGGACCTAGAA CCCCAGTCGGAGCCATGTCTTTAAAGACCTAGAGAGCAAAACATATGCAA GTTTACACAAAGATTAAAAAGACAACAAAGCATCTTATACTGTAAAGAAA TAGTGTATATACTCATTAGAACAATAAAAGATATAATTTCTTCAAAATTC AAAAAGAAAATATTACAACAAAAGCCTTTTAGAAATTTGTTCTTTTTTAA AGACATAGCATATTCTGTTTTAATGCCAGTAAAAAGACGGAGTACAGACT ACAAACTTTCAAAACATGCAAATTGAAAGCAGTACAGAGCAGTAATTATG ACGTCATAGTGTTTTCCTGGTGAAAAAAACGTTTTTTTAAATACTTAGAG ATAAGTCCAGAAGTAAAAAATATTCCTAAACCTTTCCTTCTCTTTGGATA ATTTGAACTTTTAGCTCAATTAACTGCATTTTGATAGTAAAATTGTTTTA TAGAGTTGGTAAAGCTCACCTTCAAAGCTTTGAGAGTTTAGAAGCACATT TTGACAGACATGATCCTTTTAGATGGTAGATCAGGAGGTAAAGATCTTGA TGAAAGTTTGTAGTATCCCCATGAAACTTTCTAAAAACCAAGATTTCATT GTCTTAGGGGGCTCATTTTCTGTTCAATCTTGAGCAAAAATTGTTGTTTT GAGCAGCATTATCAAGATTTTTAGGATTTTAGAGTTAACACGGACTTTGA GCTAGCCCTAATTTTTAAAAGAAAGGAAAAGGTTCATAAGCTTTCAAAGA GTACCATATTTGATTTTCCTAGAAACCTTTCTGGAATGTGATGAGGAATC ATGAGTTTCAGATAAAATTTACTTTCTAACTGCCAATTACAGGCTGCAAT AGAATGACTTCAGCTCTAGTCAAAAAATTGAAAAAAAAAGCCTTTTTGGC CCAAAAAAGCACATTTGACAACTTTTCACCTAGTTTCATTGTTTTTAAAA GATTCATCATAGCCCTTATATTATAACAAATTCAGTGACCTAGACCACTT TGAAGTTTGCCAATGGACCAAAATATCCCAAACTTTAGTCATTTTTTGAG TGATGTCAAGATACAAAATTAATGGTAGGAGGTCACATAGGTTTCTCTTT TGATCCTAAGAGACAAGGTGGTTGTCTTTCAGGAACAGAAGAGTTGGAGG TCAGACAATGTTGGGATTTCTAGGAGAATTGGGCTAAAGTTGGTACTTTT TTTGAGACCTAATTGGCTTTTCGGGCCTCTAGGGGCTAGAAGGGCCGGAA TTTTTTATTGCAATCACTTTAAATGGATAGACCAGGGACTGAACTACCAG AAATTACCTTTAAGTGGATAAATTTTCGCGTGGATTAATTTTCGCGGTTT GTACGAATTTTGGCCATTTTTGCAAAATTTAGTCCACATGAAAATTTTGA AGGCCTTTGATTTGCGAAAATTAGTCCACGCAAAATTATTTGGAATTTTT TTAATCGCGAAAATAAAAGTTCGCGAAATCTAGATAACATGTTACAATCA AAACATATTACGAGTTGAACTCTTTATTTCAATTATAAACTCTAGTAACT TCCTAAAAGTACTTTCTTTGAAGTTTTTTAAAAGCTTTTGAGTGACTTTG TCTGCCTTTGTTCGATTAAAAAACACATCTCTTTTCTAGTTACAATTTAT AAAGTCGCGAAATTAAATAAAGAAGGCCATTTTCGCAAAATTTAATCCAC GCGAAATCTTTAAATTCTTTCTCGCGAAAATTAGTACACGCGAAAATTTA TCCACTTCAGGTATTATTTTGAGCAGTAACAAACTCCCCTGGCACAGGTC AGATGGCTTTAAAATACCCCTAAAATCAGATTTGTAGTGTTTTTGTGACG TCATAACTCCAGCTACCATTTTGAAAATTTTGATTTTTTTTTAAATTGTA TAGTTTACCGGCCATAGTTTCAGAATCACCAAAAACCAATTCCTCATTTT GATTTGAGAAAGCATGGTTCTATATCAAAAAAATTTTTTAGTACAATGCC CAAAAATGTAAAAAACTTCAAATTGGCATAAATCTGCCATTATGGATTTT CAGACCAAAATATTTTGGGATTTTCACTCAGTTCATTGTACTTAAAAACA TATCAAAAAATATAAAAAATCTAAGTTTCAAACTATTGGAACTGTCCCAA ACTGCCCCATTCTTAAAAAAACTGGCTCTTAAAATATTAAAGCCCCTGTT TTGATATACAAGGGCAAGCGCAACACGTTAATAAAAGTCGCTGTAAATCA GTGGGTTCAGATCAATGTTTTGATTTCCCTGGTGAAAGATCAGCTTGAAT TTATGTCTAATGTTATGGTTTTTTGAAGTGCTTGTTCTAAGAGATGAGCG AATATAATTATTTCTAGTTTTCAAGAGAAGCAAATTTAATCTTTTTTCTA CAAGATTACACTTTAATATAATGCCAATTATGCATGTTATTTTTATTTTA ATATTTTCTTTTTGCATAGGTTTGGCATATTTTAAATGAAATCTCACCAC TGCAATTTGGCCACCAAAATTTTTGCATACAATTCAATATTGCAGATGTA AAGGTGAAAAGGTCTGTTGCACCTCATAACTTAAAAGTGTACTGAGACAT TGAGAAGACAATTATCAAAACCTATAGACACAGTTCCTATTGACAAAAGG AACAATGTCGTATGCAAAATACCTTGTAAAGACTGTAATGCTACATAAAT ATCAATGAGTCTAAGAGATCTTTCGGTGTCAGATACAAAGAACATAACAG AGCTGTTCGAAATGGTGATACAGATAAAAACAAAATAGCTTACATCTATG GTAACATGGGATTCACACCTTGTGAGGAAATTACACTTTCGATAATCATG GGTAATCAGAAGGTCTTAAGTACAAATAGCGGAGAAAACATCCTCCACAT TACCTGATGATGGGAGAAGAATCTCTTGAAACGTAGCCAAACGTAAATCT CGTGATCCAAGCCACGATAAACTTCCAATATGAATATTACTAGATCGATA AACATAAGCTTATTTAGAGTGAAAACGTCTATTTGGCATTCGCCATTTTG TTGAGTTGCAGCTGGCTTCAAAGCTCATTTTTGCAACAATCCAAACATCA GACCAGCCTTAAGTCAGTCCAGTGTGTGAATAAAATGATAGAAAAAGTCT GGTGCCAAGAATTGGCAGAATGTAAACCCGAACAGTTTTGTCTTTTTTTT AAATCCTCAAACCATGTATGTTGTTTTCAAAAGTTTTTAAAATTGTAGAA CTTTGGAAGTTTTTGGAATGTTTACAAGGTTCTTGACAGAAAATCTTTTG TTTGATTGTCGTGTGACAGTACTGTAACTGATTTTGTTAGATCTGACAAA TCTTCTCTCATTTACTTCATTAAATTAGTAGTAGAGGCTTTTTCAATGTT CACCTTGAGTTTATAAAAAAATTATTTATTTTTGACCAAATTTGACAAAT CACCCCTCAAAATTTGAGTTTATCCTCCCCCCTTCCAATGCAAAAAAGAC TGATTCTTTAACAGTTCGAGAATATTCACTTCAAAGAGGGGGACTTTTTT TCTGGGCCACCCAGTATTTAGAGAAAATTTATAAAATTGTTACCCCATGA CTCCCTCAAGGCAAAAATAAATAATCAGAAAAGACGCTGATATTAAAATT ACACCGTACGGCGGTCCTCCAAGATGACTCTTTTATTAGATTTTTCCCGC TTCGTTTTTTCTAAATAAGCCGCCCAGTTTTCAATAGTTTGAAAAACTTT GATGGAGGAGTGAAAATATAGACATGACACATGATTCATCAGGAAAAGGC GGGAAAAACACAGACAAAATAGAATAGTGTAACTCTTTTTATCAAATTTA AAAAATAATAAGACAATTTTAAGTTTCTTGTTATAAAGCCTTTGTTTTGT TTTGGAGAGAATTTGAATGTCTTTAATTAAATTAAGGTCGCTAATTACAT TCGAAAACATAACACAAAAGAGAAGAGAAAAAAGGGAAACATGGAGGCTG GCAAGCCAAGGTAGAAGATATAATTGCTAAATGTAGATTGACCTTTGATT TTAAAACAAATGCGGAATGGAGTAAGTCAAGCCCTATCAATCAACTCAAA GTTATCTTTTAAATGGACAAAACATTTGTTGCAAGAACGACAGGAAAATA AACAAAATGACATACAGACTACAGCTATTAATATATAGATCAGATAATTT TTTCGTTGTTCTGTTTGGTTCTGATGTGAAAAGAGCTGGCAAACTCTAAA TTTTCTGAGGGGACTGTTGCTAGAGGCAAGGGCTTGAATGTTTTCATGCT GTTACAAAAAGAAATCAGGTGTTTTTTTACCTTAAGGGGGGCTGAGAACA GTTGAGGATACTAATTCGTTCCTAAGAGTCAGTAGCGTGGTGGCAGGCGG CAACTTCCCCTGCAGTGCCAGTTTCTTTTTTGGGGGGACGCCAAAAGATA AGGGGCAATAAAAGGCTAATTATTAATTCTTGAGCCCATTTGCTTTTGTA CACCTTAGAAATAGCAGTTTTTAGCAGGGGGGGGGTTCAACATCCAGATA CCAGACCCATAGCCGGGTGGTGGTGTCTTTTTTTCCTTTAAAAGTCTGAA AAGTCAAGTTGGTATTGATGGTGGTAGGTCCCCCTTTTTTAGAAAAAAAG AGTTATCCTCGGTTGGTATTGATACCAAAATAGGGGGTGGGTACCCCTTT TTTTAAATAATATGATTCAGAAAGTTGGTATCCATATCAAAATGACAACA AAACTTTCCTAATTTTTGCCCTTTATAGCTAGAAAATACCCCGGGGTACA TATCAGGCTAAACAGGTTTCAATTGGATTTGTTTTAGCTTTTGTTTTGAG TATAATGACTGTAAATGAGTAATAAGTATAAATGACTTTGAAGTTTGTTT ATTTTGGGCTTTTTCGATATTTTAGTCCAGGCAATATGGGGCATGAGGTA CCACCTTGACGGCGAAAAAGGTTTGAAACTGTTTTTAGGTTCAAACACAT CTATATTTTGAGAATCGCGATGGTTTTCAGGCTAACCAGGGGGCAATAAC TTTTCAGAGGGGGTGTTTCGAGGGTACGTGACAATCNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNTTAGTTTTTAAGGCCAGGAACATTC AAGTAAAGTTTCGAGATGGTGGGATGAAAAATGTGTATTTTACAGACCAG AATATTTCGAATTTTTCATAAAAATTAAGATATGTCTTTAATTTTGACAC CTCAAACGTTGTCTGAGACTCATATTTTCAATCAATTGAAGCATTTTTGT TGATAATATTTATAACTTTATATACATTCTTAGNTCTATCTGGATCTTAA TCTTGATTCCTTGAGGTGTTTTTCACTGTTACAAAAAATATGCCAAAAAT AATGTAAAAAACAAACAGTAGAGTGTACCCGGAAAAAAGGGGAACAGATT GGTACAAAAAAATCCTCAGGATCTGTTGCTTCAACGGATTTTTCTAATAG AAAACTGAGGAACTTGAGGATTTGTTATTCTACNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACCAATAAT ATCATTATTCACCCAATTTTGTAAATTTTCAGTAACCTTTTTTCGATTCA AAAGACCTACGGCGATCCTTTGTGCTTGTCTCGTTATGTCAATATTTTTA CCGTGCACGTGAATCATCTAAAACATCTGCTATCTCTTTTAGCCTTAAGA AATACAATCTTAAGTTTAAACTCACCAAGAATAATGTTGCGCTACAATCA TGGTTGAAATATAATGAGAATTCCGGTTATTTTAACGTTTTTCAAGATTT AAAGTTCAGGGGAGAAAGTCGATTTTGGGCTATCTCTTTAATTTAATGGA ATATTTCAATTAGGGAGGTGTTGGCAGACTTCCAGGCTATATTCTGAGCC ATATTGGACTATTTTTGAACTTTTGAATCCTCAGATCCTAAGGTCCTCCT AAGTCTTAAGTCTAGCGTTAAAACTCAACGAACGTACTTTAGAGCACTTA TAAATCGATTGTGGTTTTAAAAACTTCCCGGTGGATTTCCCTTTTTTCTC AAATATTACGACCTTGATTGTATAAATGTTGGTACTCGCTATTATTTTTA CAGGGAAACAAGACACAATCGTCTTCAATGCAAGTTGAATGGTTTTAAAG AACCAAAATTGAATATCATTTTAGATTTGATCATTAGAAGATCCCTGTCT CAACGACCCATTGAATCTGTGGAAATAAGGTTAAGAAAAGTATCCAATGG GATTGACTATCTCTTGCTTTTAAGGGGTTTTTTAATACTTGGTGGCTATG GTTAGCTTAGTGGTTGTTAGCTCAGTTGGTTTGGTGTGTAGGGGTGAGTC ATAGTACAGGTTAGCGCCTTGAGCGCTACTACCGAATTCTCCTCATCGCT CGCCTGGGAAGATAATGTTTTAGAAAAAAGCACATCTCAACGTATTCTCA AGGAGTTCAGCGATCAGATGCATAGTAGTCATCAGTAAATGTGATTCAGC AATGTAGGTCTAAGGTGGTCGTATAAAAGTTGGAGGTAGCTATTACACAG TTTAGCGTAAGCAACATCCCATCCCGTCCTGGTTAAATTGATTCGAATAA AAAGACCTGAGTGAGAATCAACCGCATAACGTAGCGTAGACTGGAGCTAC TTTCTTCTTTAGATTTTTATGCTAAAAATTGAAAACCTTTTAAAAACCAG CACAAAAAAAGGTTTTTTAGACAAGTTCCCAGATAAATCTCTCATATCGG ATCGCCATTTCGACCCTCTAATCTAAAGTGATGTTGCGAATGTGATCTCT CGTACAACTTAGTGGATCAACCAGGGTCTGTTCGGAGATAACCGATAAAT GCAAAAAAAAAAATTATATCTGATGTAGTAAGGCCCAAGTAAAAATTTTA CTGATCTTTCTGGGTTACGGATACCACCATATACTCTCTTTAAGTTGATA CAGCAAAATCTTCATTAGCAGTGTCTTAAAGATATCGACGAAAAACTGTA TTACTTTAGAACTAGGAAAAGTTTTTAAAGCCTAGAAAGTAATGTCAAGC TTGACTTAACGTGCCGATACCGATGGCTTTGATCTGTAATTTAGATTAGG TACTGTACGCCACCTTGAATGTATCCTACTAATCTAGGTTGTCTTACTAG TACTAATACAAGCTTAATAGTGATCAAGATTATTAAACTTAACGGTTTTG TTTTTAAAATAAGAGTGTTGTTTGCTTACTCGTCAATTTTATTTCACAAG CTTTCTCCCATTGGATTGACACGTATGTGGAGCAAGATTGGTCAGAAAGA GGAATAGAAAAACATTGTTTGCTTATATCAGCATAAAAGAACAATAGGCA GACACTGTCCCGTTATGAAATATGTGTCTGATATGAAATGGGAACACTTG TGTAAAAATAAAACCTTTAAAAAAGGGAAGGCTTAGTCTGTAAAATACCA ATCAGATAAATAAAATATTTAAGGGATATATTTGTTTGTCTGCTTCCCCA AGTCAACGTAGCGGGGTTTCGTGCAACGCTTTAAATATCTGGTCTGTAAA TTACATTTTCCATCTAATCGTCTCATCATCTGATTTAAATTGATTAGGAA CGCATTTTCGACACATTATGAAAATTTTAAAAGCATTTCAACTTTGATTT ACATGACTTGATGACAAGTGAGATATTTCAAATTGAGTCAATTTTATTTA AATCAAAAGCAGCCAGAAAATGGTCTGTAAAATACCAAAGGCACTTAACA ACTGTTAAGTCAGACTTCTAAACTAAGAATGTATATAAAGTTATAAATGT TATCAACAAAAATGCTTCAATTGATTGAAAATATGAGTCTCAGACAACGT TGAGGTGTCAAACCTAAATAGAGAACTTAATTTTTATGAAAAATTTGAAA TATTCTGGTCTGTAAAATACACATTTTTTATCCCACCATCTCGAAACTTC ACTTGAATGTTCCTGGCCTTAAAAACTAACATCTGTGAAATTTTAANNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGTTTATTTTGGACTT TTTCGATATTTTCAAGTTTTATTTTTGATCAAGCCTGAAGCAAAAACATT TTTTCTGTGATAGCATTTGGTAATGAGTGAATCTATTCCGTTCTAAAATT ATGTACTAATAATAGCTTCTCCTAGTTTTTGCACATCAATTATATTCAGA TAATATTGATTCAGATTGATTTTTCTAGCTTCATTGGGTTTGTTTTTATT ATATTCTCAGTTTTCAGTCATTTTCTATTTTAGCACATGACATTTTTTGT GTTGTGTTGAAGAAAGAGTATTTCAAAAATGAAAGTTTCTCTTAGTACCC TGTTTGTGTGGGAGGGGGTGGGTCCCCTTTAAACAGCTTTAAACTCAAAT TTGTCAGATTGGTATTGGTACTAAATTAGGGGGTGGGTCCCATGATATTT TTTCAAATTCAAAAAGCCATGTTGGTATCGATACCAAAATAAGGGGGTGG GTCCCCCCTTTTTCTGAAAATTATGATTTTCAAGTTGGTATCGATACCAA TTTTTGGGTGGTGGTGTTAACTTAGCTCAAAAGTCAGGTTTTTGGGCTAT GGGTTGGTATTATAAATGTTGACCCCCCCTGTTTTTAGCCAATAAAAAAG AAAATACCCAAATTTTCATGATTGCTTCGTCCGTGTAATCTACACAAAGT TATTTTACTTTTAAGATTGCGCACCAAAATCCCAACTTTTAATCCCAAAT AAATGCCTTGTCCCCAGATTTGGTTGGCCCACCGCCATGATACTGCTAAT AAGTGTAACTAAAATTGTTTTTCACATTGCACACCTGAAGTAAACAGCCT TTTTACATTTTATGAATTTTGAATCTTGTTAATTCAAAAATCTTTGCATC ATTTTGGAGCAATACTTGGATACTTTAGGCAATACTTTGATACTTTAGGT AATATTTTGATACTTTAGGCTGACCTGATTTTTCTGGAAAAAGATTATAC CAAATAAAACACTTCATAGTTTGTTTATCTTGTTTCTTTATAAATCAGAA CATTTTACCAAATATGGAAATTTGTTGCTATAGAAACAAGATGATTTTGT ATGATTTAATTCCCTCTTAGTAGATCTAAATGAGAAAAAGATTGAGTGTT AGTTATCATGCCACCAAAACGCAAGAGAAAGGGAGGTAGCCAAGATACAT CTTCTAAGAAAGTCAAACAAAACGAACAAGAAAATATGAGGTAAGATTAT TTTGCTAATTTTATGTACTTTTGAGGATTTCATCACTCCATTGTAAGAAA TCTAACTAGATATTTAAAGTTAATATTCTTAGAGTTTCCCAACATTTTCA TGTTTTTTAATCAAAATAGGGTTTTCCTTTGACATACAAAAATGTTTTAT AATTGATGATTACATCAGAAATTGAAAGGGGGTTTCCTTTATGATAATAA TTTTTTCTTGTTTGAGTTTCTCAAACAACGAATGTTTAAAGAATCTTTTT TGTAGATTTTGTTGCTGTGTGAGACATAAGGTTGAAACAAGACCTCCAAG CTGGATTAATGAAATATTTTTATATGGCAGTTATCTTTATTTTTTATGTC CAATTCTTTTATTTTAAACTTACAGTAAAACACTTGCTCTGTGCTATTTT TTGTGTATTTTTTTCTTGTACATATAAGATTTATGTGACTCTTATATAAT ATCTTATTTTATATATCACTTCCAAATTCCAATGTTGTGATATTATATCA TAACATTCAAAAATAGAACTTTATAGTAAGAGCTGAGTGAGAATAATAGT ACATGAATAAAATACAGCTTTACTTGTTCTGATGACCATTTTAGTGCATT TCTCTATCATTTCAGCTCCATGCAGAAATATTTTAAATCAGCATTAAACT GTGTGGATATGCCATCAAATAAAGATCAAGCTTTTTCTAACAAACGTTGT GAATCATTCTTTCACAAATATGCAGGTAACATTCTAATATTGTATTCTAT TATCACCTTTCTTTGTCTACCAAGCATCTGTGGATTGCACTACATGCCCT GTTTATTGGCAATCTGGAAAATCTTCAGTTTTGATCCGAAAATCCAGGAC AGTAATCTCCTCATTTAATTTACTTTTATTACTTGTATGTAAAAACTCCT TCCATATCAACCACAGAAAGACATAGGCCGAATATTAATTCGTTTTTAAC CAATTTGTTATATACTTGTCCTTCCTTTGAACATTTATTGCTGAGTGATC ATTTTATTTTCATGTCTAAGCGAAGACTTATTTCATAAATCAACTTTATG GTTTTTGCTTTAGAATCATTTTTTTGAGGAAAGCCCCAAATTTTGACTTA TTAAAATTAGATTTTGAAGTACTATACTTTTTAAGAAATGTCATTACTAC CGGGTGACCCAGAACAAAATAAAATGGTTTTATGGCTAACTGTGTCCGAA ATTATGTGAACTTTAGATAAATTCTTTTGTCAATGTAGAGTGGAAAGGCA AACTTAAAAATTTGGTATATAACTTTTTAAATTTGGTTCAGAGGTTCACA AGTTATAAGCTTTTGAAGTCAAAATTTGCTTTTGAAAAAGTCCAAAAACA TGTAAAAATTATTAACGCAATTTTATGCAGAAAACCTCATATTTTCACTA TTTTAATGACTCTTAGGACTCAATTTTAATAATCTCAGCTGAATTTTATC AATTATCCTAATAAAAGTTACGGCGAAAAATAGGAAAACAGTAATTCTAA ACATTTTTCAAAAAAAGTTTAGTGAAAAATATTAAATATGCTTATTTGAT GCCCTTTTTTGACGTACGTTTTTGGACTTTTTCAAAAGTGAATTTTGACT TCAAAAGCTTTTAACTTGAGAATCACTGTACCAATTTTAAAAAGCTATGG GCCAATTTTTAATTTTGTCTTTCTTTTTGACAATTAAAAAAGTTTAAAGT AGTCACATTATTTGGACACAGTTAGCCATCAAACCCTTATACTTTTTTCT AGGTAGATTTTAATTATAATTTCGATACCACTTTTGTTTGTTTACTTCAG ATTCCAACTTATCGTTGATTGGTCCTCATGGTGTTGAAAAACTTTGTCAG GATCTCGAAGTACAACCTGAAGATGTAACAAAACTTCATTTTATTTAAAC GGATTTTGTCCTATTTTTTAGAAGGGGGCCCAAATATAATTTACTTACTT TGGATAAAAACCTACCCTAGAACCTTATAAATCTTTACTCTTCACACCAA CAACCTCATTTGCTTGATATATTATTTTCTTTTAGAGAATTTTTTTTAGA CACTTATTCAGACTAGGCTACGTCATATTTTCCTTCGTTTCGAGCGTAAA ACTCCTACTCTTCAGGATATGAGCACTGTAGTCCCGCTGCTGAGGTCGAA AATTGTTTCGTTTCGTGATACATCTCTTAGATCTAACTTTCTTTGGTGGA AACTCGCGAATTAGTATGTGTAGATTACAAAATCGAAAAGTTTCCGCGAT TTTCTAGTGCAAGTGTCGAGAAAATCGACTTAAAAGTTGANNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAACGGCTAA AATCGATAAAATCATCGATAAAACATCGAATGTCAACTGAAAAACTCCGA ATGAGTCTGTAGACTTCAAAAATTGTCTGATTTGGCTGAAATATTGCACA CTTGGCCCTTGGGTAAATATCTGCAGATCTAAGTCTTCATTTTTTGAAAA TTTTGATTTTTGGGGTCTGGGGACCAGTTTTTCGTCAAAACGAGGCTGAA ACTTAGGGGCGGCCTGCAGACCTCAACAATGGTCAGATTTTGCTGAAACG TTGCACACTTGGCCCTTGGGTGAATATCTACAGATATAATTTGTCATTTT TTGAAAGTTTGGATTTTTGGGGTCTGGGGACGAGTTGTTCGTCAAAACGA GGCTGAAACTTTAGGGCACACTGTAGACTTAAAAAATGGTCTGATTTGAC TGAAATTTCGCATATTTGCTGCGTTAGTGAATATCTGCAAATCTAAACAT CATTATATTTGGGGTCCGGAGGCGAGTTTCTTGTGAAAACGAGGCTTTGC GTGGGCAGCCTGTAGACTGGACAGGGTTAAATGGATGAAATTTTGCAAAC TTTTCCATACTGATTTTCCTTTATTGAAATTGTTTTGAAAGACCAGAAAC ATGTTTTCCGTCGACGACACTTAATCCATGGGAAAATTTTTACGTTAGCT CCAAAGAAAATAAAAATTACTTCGCTGGATCATCTTCAGTTAGCGAAATT TGTAGACGAATGAACAAACAAACTTTGACACGAGGAACAAACACTTAAAA AGATCTTCTAGATCTTTATGTGGAGTTATGATATGAGTGTATAGTGATCG TGTCACTTCCAGGACTGTCTAGAAGCAGCCGGCGAAGCAATTTTTTAGAA ATATGTGTTCTTATTTGCTAGGAGGGAGCTTTTTATGGTCTTCAAGTTTT TTTTATTCAAATGATGTGTTCTAATTTCTAGGAAACCTGTAGCTATGTCT CCCAAAATTTATCATTATTCCATGGAGGATGTGTTCTGAAATTAAGGAGA AACCTTTTGCCTACAAATGTCTAATTATTTCCTTGAAAGATGTGTTCTGA AGCTTTCTTTCTTTCTAGGGTTACCAGGCAACAAAAACACACCAATTTTT CATAATTTTTCGATACCCCTGTCTCATTGCGTCTCAGAACACATCAAGTT TTCTAGCTCCTTTTCAGAATACCTCCTAAAAAAGATCGCCTCGTCGGCTG CTTTTGACTGTCGTAAATATTACTAATCTATAGTCTGAGTAGGTTTAAAC GGCGTAGGATTTGTAGATGAGAACAAACGATCACTCGTTTTAGACCAATA TCGCATTTAATCTTGTATATTTTTTCTTGATAGTGGTTGAAGCCTAGTCA TTTTTATCTTATGGATTATATTGATATACCTATCTCGTATTGCAATATGA GGGGACCTGGTTCTTTGAGTAAAATAGATCTCAATCGCTTTCTTCACTCT TGAGGTTGATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAGGTT GATAAACGTCTTTAAACATTTCTTCATTTTTTATCAGCTCGATAAGACGT CGTAATTAATCCAGGAATATTGAAAAAGTGAGAAAGAATCACCAGAAAAA AAAATTGATTTTGTAGATAATGCTTATAATAGCAAGCCTTTAGTTATTAC CTCACTTTGTCTCCTTTATTATTCTACACGGGACCAACGTTCGGTATTCT CTATTCAGGAAAAATTCCTAGAGNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTCCTGTTCTT CCCCTCAATGAAAGACTGGTTCTAGGTCAGAGATCTCTGCCACTGAATCA AGGGATGGGGAAGTTGATGTTCAAATTATCGACCCTTTTTACGCTGGCTC TTATTGGCGTTATTTTAGAGCTCGTGGCCTAACGGACCGGCGTTAAAAAG GCCGACGTAAAAAGAGCCAAAATTATACATTTTAAACCTAAAAGCGGTGT TTCTTTTTTTGGAACCATTTTTTCGCAATCGAACTGGCTTTCTGAACAAA TTCAAGGTGGAAATTACCGAAATTCTTGCCTCGTATCCAAAACTTAATGT AAATAAGTGAATTTCGACGATAAAAATTGTACGCATTTTCCTACTCACAG ATGGCATTTTGATGAAATATTCTGTCATAATTTTCTATTTTGAAGCCTAA ATTAAATTGCAGTTTTTGCAGGTTTTGGTGTTATTTGCAGCCCTTATTGG CGTAGGCCCAAAAATGGGCAGTGGCGTAAAAAGGACCGATGAGGTAATAT GAATTGTCACTGCACTGAATAAAACGAGATATAAATCTTTCATGAGAGAG AGGTACATCCCTGTGTCACGATCTGGTGGGACCACCCTACTCATTGAAAA TAGTTTCCGTAAAATCGTCCCCGCTAAGAAAGATATGCTGAAATCTCCAT CTCTACTTTTAAAGTAGAAACAGTAGGATTTTGCATTATATTTCGCCACT TTAAAAATCTTTACGCAGTTATTGAGACAGAGGTGCAATTTTCGATAGAT TTTTAATCATCGGGATTGATATGTCATCTCAACAATGGACTTCATTGCTC GTAGTGAGTGCAGGAAATGGTTGCCAAGATCAGGAATTTTCTTCAAGGCA GTAGCATGTTTATTTATTTCTTCAAAACAAAGCTAGGATGCGCGACATTT TAAATAACTGCGGCAGCTAAAGCTTAAGGAATTTAGCAANNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNTTGCTTCCAGGCCCTTTGTGCCAGAGTTTATGTAAT ATAAAATGTAAACTGTTTCCCCAAAACATTCAGCCAAGGGAACAAAACTG CTTCAAAATACTGCCACGCTGCCCCAAAGTTTCAGCCTCGTTTTGACGAG AAACTCGTCCCAAACTCGTCCCCAGGCCCCAAAAATACAAATTTTCAAAA AAAGAAAAGTTGGATCTGCAGATATTCACCCAAGGGCTAAGTGTGCAAAA TTTAAGACAAATCCAACCATTTTTTAAGTCTACAGTGTGCCTTAAAGTTT CAGCCTCGTTTTGACGAACAACTCGTCCCCAGACCCCAAAAATCCAAACT TTCAAAAAATGAAGACTTAGATCTGCAGATATTTACCCAAGGGCCAAGTG TGCAAAATTTCAGCCAAATCAGACAATTTTTGAAGTCTACAGACTCATTC GGAGTTTTTCAGTTGACATTCGATGTTTTATCGATGATTTTATCGATTTT AGCCGTTTTTCCTACATTTTCATCGCTTGAATTAATTATTAGTGTAATAT TTTGGTGGCTTTTAGTATTTACAAGCAAAATGCATCATAAACGTGAAAAC TCATGACCTAGAAACTGTTAAGTTCATGAAAATCGATTAAAATCGATTAA CTCGATAAAAGTCAATTTTTAAGTCGATTTTCTCGACACTTGCACTAGAA AATCGCGGAAACTTTTCGATTTTGTAATCTACACATACTAATTCGCGAGT TTCGACCAAAAAAAGTTAGATCTAAGAGATGTATCACGAAAATCGTTTTC TAGCCACTTTTTTCGACCTCAGCAGCGGGACTACTGCTCTTGTTTTAAAT ATTGAAATTCTCCGGATAAATCGCATGTGCACTAAGGTTTTAATGAGACA ATAGAGAGTTTCGAAACCTAAGCCAATCAGCTGTGTTTTAAACATTCTTT AATTTGAAATCTCTATTGATAAACATCTTTTGTGAAAGTTGTCTATTATT TTAAACCTATTAATAAGCGATTCCCGGCGGGGGTTACTAGTGGCCGCCTA TAGCAGTGCCTATAGACCAAGAGTAAGGCCTAAAAGCCTGGAGCTGTCTA TTGTGTAGACTAATTTAGACAGGATGTTTTATGATTGTTGGTAAATCAAC CAAATTGGGCCTTAGGGAGGTACAGCTGATCGGAGTCCCTTTTTTAGAGT TATTAGGCTTTAACAGTGAGGATTTTGGTGTCAATATAAAGATCTTGGAT CTCATTTAAGATTGATCTCTGGCAGGGTCCACTCGGCCCTCTCAGCCAAC AAGATTGGTACCTGCTTCGGTTTAACTGCATTGAAAACTATTTATGCATC CATAGCGGGCACCCCCCTCCCTTGAAAAAGGGGGGCTTGTGAAAATTTCA AATAAAAGGGGTGACTTGGACAAAAAGAGGGGGTTTGAAGATTTATCAAT TTCGAAAGAGTGTTTTCCATTCATCTTTAAATTTCTCAACAATTATTATA TTTAACCATTCATTTGAATGAAGCAAAAACTCTGTTTCTACAACTCTTGA TGGAGTATGTTGCTTTTTCAACCTTTGCAAGACAGCTCCTTTTGTTTTTT CCACCGGTTATTTCACAAAAGGTTGAAAAAAGAGGGGGGCTGTACTTAAA CCTGGGAAAAAAGAGGGGGTTGAATAAAAAGAGGGGGTCGAGGAATTTTC ATTTTTAAGAGGGGGTCGAGCTAAAAGAGGGTGGTGTCATTTTTAAAGGG GGGGACTTGATACCCCTCTGCCCACTATGGTATCTTAAAATGTTACACTT CTTCAATTACAGATTGTGATGCTAGTATTGTCATGGAAATTAGGTGCAGA AAATATGGGATGGTATAAATTGGCAGAGTGGAAAACTGGAATGACCTCTA TCGAGTAATTATCTTTATTTTAACATTATGTTTCGTTAATTTTGTTCTAT TTCAATGTGTTTGTCTTGAAACAGCTACCATCTTGAATTTTGAATTTTCG AGTGGAAAAAGTGGCTGAAAATGCTTGAAACCATATTGTAGTTGAAAATG GGCTTTTCCAAAAATAGTCCGTGCCCCCCCCCCCTGTTGAGGATATCGGA TATCCAGGGGGTAAAGTGTCTTTTCAAGTAAAAAATACGATATCCAGGGG TAAGCATCTTTATAAGAGAGGATATCCAGGGGGGGTTAACCATATTTTTA AGAGTGGATATCCAGGGGGTTCGATACTTCGAAAAAATCAATATCCTCAA CAGTGGGGGTAAAAAAATTTTCTGGAAAAGCCCAATAATAGCGTTTACGG ATCTGGATTGCGATGGATTTCATGTTTATCAACATATTGAAATTGATTGA TTTAAATATAATTCTATGATGGTTTAATCAAAAAAGCTTTAAAGCCTCAA TGTTTATAAAGTTTATTTTTATCTTTCAGATGTGACAATATTTCAAAATT GAAGAATAAAATTCCATCGCTACGTGGTTTACTTAAAGATCCATCTTCCT TTAAAAAGATTTTCAGATATGCTTTCGACTTTGCCAGGGTAAGTCCTATT AGGTGTAATCTTATATCTTTTACATGACCATACATTTATTTAAAAATATG ACACATATGTATTGTCATTTGTTGATGTATATTTCTCTGGATGCAGTACT CCCAAAATATTTGTGTGAAGCTCGATAGTTTTTATTAAGGTTATATAGAA TTACTTACGACAGCTTAAGCATAAGCTTTCATTCTATTTTAAAATCTTTT TGAACTTTTTTCCTTGCAGGATAAAGAGCAAAAGAGTCTTGACATCGATA CTGGCAAAGCTATGTTACAATTGTTGCTTGAAAGCTGGCATCTGGTTGCC GACTTCATCCAATTCTTAAATGTAAGTGGTTTTTCCTCAATTTCTTTCCA CAGTTATATGTGGTATGTGTATTTTAATAGTGATGTTCTATCATTTCATC AGTTNTTCCACAGTTATGTGGTGTGCGTGCTTTAATAGTAATGTTCTATC ACTTCATCAGTTTCTTATATTATAAAACTGTGCTCGTCTGCTGATCGCAA TAATATCTGTAATGAATACTTTCTTTTTCCCATTTTCTCTATTCATAGCA ATCAAGGTACAAAATTATCAATCGTGACCAATGGAACAGTTTATTAGAAT TCATCAAAACAGTGGACACTGCAGATTTCTCTGGTTATGATGACGAAGGA GCTTGTATGTTCTTTTTCTTTGGAAGTTTTGAGCTCGTTTTACAAGCCTG TTTGACTTTTAATTAGACAATTCTCTATGTATTTTATATTACCATTTAAC ATTAGATGACCATAAAACTCTACATTCGTGCTACTTAAAGATTTGATGTC CCAAATGCTTGCTTGTATAAATAAAGCTTGTAATTTTTCGAAACTTTGAA CGTTCTGAAGCGAGAATTTTTCAATTGAAAAACCTACAAGTTTCTAATTA CCTTTTTTCCCCGATTTTAGGGCCCTCTAACTTCGTGTAATTTGGAGACC CAATAATTGCTTCTAATAAAGAGACTTGTATTTGAGACTTCTAGAATCTC TTTTCCCAATTTTAGGGCCCGTAATGCTTGATGAGTTTGTAGAATGGCAT AAAGAAAAAAGTACAATGTCGTGAGTGGATGGATTTTAATAACGTTCAGA TGCATTTCATGACCAAATAGTGAGAGGGGAAGATTGAATCCAGGAGGGAA GATGTGATGCTTCAACTTATCCCTGGTTGATTCATAAAGACGTTCCATTC TATCAGGCTCCGAAGAAGAGAAAATCCATAAATACTACACTCTAAGTATT GGGTATCATCAAAAGAAGACAATCTGTTTCAGCAAAGTTTATAAACCCCC TATTTCAAGGCGAACCAGTTTGGGTGTCGTCCATCAGGTATTTTAGTTTG TTTTATACTGCTTTTGTTTGTGAATTTGCGCTTTAAAAAAAGTTTTATTA TTATATTTAGTAGTACTTGTACATTAATATTATTAGGAAGGTAGGACATT TGTATAACATTATGCAAAAGCAAAAGAGTAAAGAAAATATTTTGTTACCA TACCAATAATTACTCCTGATTTTGATTTTTATCAGTTTGTGTCAAAATTT CTGATATTAAGGCTATTGATTACCTTAACTCGTCCAACTTTCCTATTACT CTTATACTTGAAATAATTTTCTTAGAATCTGACGTTGTCAAACAACACAA AACATTTCTTTCTTAATCACTCCGTAAGCTTTCTTCTAGGATATAAACTT CTCTTCTGATAATGTGTGGTGAAGACGAATAGTATTAGTAGCTATGCTTT ATTATTCTTAAACTGGATTGCCAATAATTACTTGCTAAAATGTAATCATT TTAAGGATAATCGTCAGCCATGCAAAATTACTCGAATCTGATTGGTTTAG AGGAGTGCGATTAATCGTTAATTGCACTATTACCACTTTTTGCACTCATC GGCGGGGGGACACTTTTGTCCCCTTATTCTTTTCTCTCCCAAGTCCTGTG TCAGAGACTTTTTTTTACTATATAATAAAAAACAAAGANATTAATGAAGG GCAGCCGAGGACGAACATTCTACAACTATGAAGTCCGAACATAAGAGCTA ATGCTTCACCCTCGATAGGGGCGTATCGGCTTTCCGAGTCTTTCGTGAAT CGGGAACCAGCGTAAATTGTTTTCCAATGATCGGGGCCGCAGAAGACGTC CTCTTTATTTGGGCAATGACAATGTTTTTGAAACAGGGTGAAGCCTATAC CGGTTTTTGACCAATCCGTCGATAACCAGGTCTGGCGGTTGAGTTGAAAA GACTTAACTCCGTCTTTGATAGCGTCAATGATTGCTACCTTTGATTGTTG AAATACACTTTCTAGAGTATCGTCCCAATAAAATTTCTTACTTTTCTCTA ATAATTCCCGAAAGGGTGCCATTACTGAGGCTTGGGCAAAAGCGTATGTA GTTTGGTTGATTAAGCCGAACCAGGAACGTACATCTTTAATGTTTTTCGG TGTTGGGAATTCCTGGATGGCTTGCAATATTCGAGCTGGTGGTCGGTAAC CATCCTCAGTTATATCAAAACCAGCAAACTCTACGATGTCCCCAGCAAAG TGAAATTTTTCTGGGTTAAAGATGATGCCGTTTGTTGCACACAGGTTGAT GTATCTAACGCAATGCCAGAACGATTTGGTAATGTCATTATCCCAAAGGA TGGAATCGTCAATACATCGAGCTACTCTAGGGAAGTCTTTGGTGATATCA TCAAAGCGCTTGGTGTATCCGTCCCCGGAAGCATGGAAACCTTGAGGTGC GCGAAGGTATCTATAGCGTCCCCACTCGGTGATGAACGTTGTTGCATCGC GGGCCTCTTCCGACAAGGCGACGCTGTGATATCCGTTCCAAGCGTCTAGG ACGGTTTTCTTGACTCTGGGGGGTATGGCGCTGACAATGTTGAACGGCGT TTGGGTGTGGTGCGTCTCTCGACGAGTTGCTTTATTCAGCTCCTGGAGAT CGACGGTTCGTCTGGGTGTTCCGTCCTTTTTGGGGACAACGACCATACGA GAACACCATGTGGTTGGATGACCAGGAGGGATGGGTTCAATGATCCCAAG CGCCACGTCAGAATCGAGTTGGGATTTCACGGTGTACTTCCAATGATGTG GAATCGGGATTGGGGTGTGTACGGCCTTGGGTGGATGGTCTGGTAGGAAC GATATGCGAAGAGGTTCACCAGTCATTACTTGGAGTTTCTGGTGTTTACA TACATTAAACGCGCTACTGGCGTAATAGTCTTTAATCCATTTCTCAATGT CCATTCGATGGTCATTCGTTGGCGGAAATGGTAGTTTGTCAGGTAACGAT GGACATTCTGTTCTTATCCTACAACCACACGGTGCGATGGAGGTGTCTGG TGTGTTGGGTTTAGTTGTAGTGGCGTTAACGGAAGGATCGTTGGGGAACG AATCGCGTAAAATGTCTAAGCGTTTCAGGGCGGTTTGTGAGAGGTACGTG CTGCTAACCCCTTCACATATGTATAACAGTTCCGTAGTTTCGCCGTTGGC TGTGATAATATCGACGAGGAGGGTTCCAATAATTGTTAGTTTGTTATTAC CAACTCCCCTCAGACGATTTTTTGTAGGTAGAAGCCATCGCTTGGCTTGC GTAATGTTCTCGAGGATATGTGGTCCGGTAGTGCAAATCTGTGCACCGGT GTCGGCAACAGCTTTCTCGTTGACTCGTTGTGGGATATCCGGCCAGTTTT TGTTAGGCCGTAGATTCATATAAGCTTTCTTGTTTATTTTAACTTCAATG TCTAACATAGGTGATTTTTCCGGTGTGCTTGGGATAAAACGATCATCGAC TAGATTGCCATGTGGAAGTCCATCTAGTCATAATGGGGATGCGGTATCTA CTGCTGACAATAGGAAGTCGGCAGATTCATCGGGTGGGATTTCAATCGCC GAGGTCTTGGGGCTACGGCAGACATTAGCGAAGTGGTTCAATTTATTACA GTTTCTACAAGTCTTACCATAGGCAGGGCAGGTTGAACGACCCTTTGGGT GGAAGGGCTTTCCGCATCCGACGCAAGTTCTGTTGTTATTGGTGGGTGGA CGGAATGATGGCTTCGACTTCAATGCGGATACGTCAGATGTCGACTGATG TGGCGATTGAAATTCGGATGAAGCGCGTTCAGTCGATTCCAATGTCAAAA GACGGGTTGTAAGCTGGCTCAATGTTGTTAATATTTCCATTTCAGAAAGT ACCTTCGATTGATGGGACGAATTTCGGAGACCGGCAATCAGTTGGGATCG AATCATTTCGTCAGCATATGAAGGGGTGCATCCGTTGTCTCCACAGGTTC CAGAGCAACTAAATCTACAAAGCATAGCTTGGGCTTTTAAACGGGAAATA AATGACGTAACTGTTTCACCGTCACTTTGTTTTAATTTGTAAAAGTGTTG GCGATAAACTTCGGGGTGTACAGTTTTTACGGCTACTGACTTGATGAATC CAAGCAAGGCATTCTCAGACGCAGTAAGTAGGGTGTCAGGACCGATAAAA TTAAACAACATCTCGTTTACTTTTTGAGAGCATGCAGCTCTTAGTTCGTT TCTGATGTCCTGCTCACTCGATAGGCCGGCCATCTCTTTATAGCGGCTCC ATTCATCCTTGAAGATGATCCAACGGTTGTCAGTGGTATCGGCGTCAATA ATGGGTCGCGTAAGTTTTGCACGTGATCTCCCTCCAACAGATGGGTTGGC GGTGGGCAGCAGTGACGGGAGGTGCGCGAACAGCGTGGTCATTGTTTTTT GCATCTCGAGGTGTTGTTGCTGCATTTGAATTATCATCTCGGCTTGACTT GGTGGCGGGGCGTCGGGTAATGGGGCGGCGGGCGGTATACCGTTATCTTG CGACATGGTCAAAACAAAATGGCGGTGTGACCACGGATGAAAATAGAACG ATTTAGAATGTTTTGTAAACCCTTGGCAATAATCACGAGCCAAAGAGATA TGAAAAGTATGCTAAAGTGAGTTTGTGTGTTTTATACAATATACAACGTT GCGAATTAATGCAAATGTTCAAGGTGTGCTCGATGTGACGTGAACAGACT TCGTTTAGAAGATACAGAATGTTTGTTGTGTTTTTGTTATTGAACGTGTA TAAACGAGCGTGGAACGTGTTGAATGTCTATGTTTTTTTGGTGAGTTCAG TTTCCACTTACGATGTTTTTGTTGATAAGAGAGTGCTTGCTTGTGTGCAA TCTCACCAGTTGATAACAAAATATCCAGGAGTTGAAGGCTCACTTCTGAC ACCATGTATATTCGTTGATAAACTGAATGTTATTCTCTGACCTAACATAC TAAGATAAAATACAAATCGGGTTAACTATCGGATAATATAAACGGGATAC ATATACATGTTTGACTTTCAATTAGACATTTCTGTGTATTTTGTATTAGC ACCATTTAACATTAGATGAAAAGAAAACTCTACATTCGTGCTACTTGAAG ACTTGATGTCTCAAATGCTTGCTTTTACAATAAAGCTTGTAATTTTTCGA AACTTTGAACGTTCTGAAGCGAGAACTTTTTCAATTGAAAAATCTACAAG TTTCTAATTACCTTTTTTCCCCGACTTAAGGGCCCTCTAACTTCGTGTAA TTTGGAGACCCAATAATTGCTTCTAATAAAGAGACATGTATTTGAGACTT TGAAATCTTTGAAGCAAGAGTTTTTCAATCAAAAAATCTAGAATCTCTTT TCCAAATTTTAGGGCCCGTAATGCTTGATGAGTTTGTAGAATGGCATAAA GAAAAAAGTACAATGTCGTGAGTGGATGGATTTTAATAACGTTCAGATGC ATTTCATGACCAAATAGTGAGAGGGGAAGATTGAATCCAGGAGGGAAGAT GTGGTGTTGCTTCAACTTATCCCTGGTTGATTCATAAAGACGTTCCATTC TATCAGGCTCCGAAGAAGAGAAGATCCATAAATACTACGTTCTTATAGTA TTGGGTATCGTCAAAAGAAGACAATCTGTTTCAGCAAAGTTTATAAACCC CCTATTTCAAGGCGAACCATTTTGTACCGTGGCTGAAGAGGACCTTTAAG TTTGTATTTAGTTTGCGTTGTAACACGCGGCCGCGCTAACTATACGCGGC CGCGTGTTACAGTATGCGGCCGCGTGTTACAATACGCGGCCGCGTCTTTT TTTGAAAACAAAAACATGCGGCCGCATCTTTTTTCGAAAACACGCGGCCG CGTCTTTTTTCGAAAACACGCGGCCGGGGAATAAAACCTGCGGCCGCGTG TTTTTGTCAAGAAAAAGACGCGGCCGCGTGATTTGTCAAGAAAAACACGC GGCCGCGCGTTATAAACATGCGGCCGGATCTTTCTTTGATGAATGTTGAA GTCCATGTGCACGTGGGGATCGTGAAGGTACACAAACAACAAAATGGCGG AGGACGAAGGAGCTTATGAAAGAGTAAGTATTTTTTCTGTTAGCTTCAAT GTTCAGTCCAATTCTTTTCATTAAGCTTCATCGTTTTGTACACGTGTAAG GGGGCTGGGCTGGTAATATATTTTAAGTACCTATGCTATAGCTCTGTTCT GACAGTCTTATTAGATTGGATTGCAAATCTTATTTTCCTATACTATAGTA GTGGTATGGAAGTTTTCCAAAGGCAAAGGGTTGACAAGTTGAAATGTAAT GATATGAGAAATCATAATCGGAGGGTTTGGATTTTGGATATTATAAGTTA GTTTATTATTTTAAAATTCTATATACCCAGACGATCTCAATCGAACAGAA TCGACGATCGAAACAGTCGAACCAAATCGAACGCAATCGACCGATTGAAA TTCGATTGTCAAACGCAATCGAATCTCAATCGAATATTACCGCAATTTTC AGATTCGATTGATGTTCGATTGCGTTCGATTGATGTTCGATTGCGTTCGA TTGCATTCGATCGTCGATTCATTGACCCCCAGATTGTTCATCGCATAATT TCTACGGGAAATCAAAAGTAATTTCATTCGGCTTGTGATGTTTGAGAGTT TGGATGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN AACAACAATCGAACCAATCGAATATTACCCAGAATTTTGACGTTCGATTG AGATTCGATTGCGTTCGACAATCGAATTTCAATCGGTCAATTGCGTTCGA TTTCGTTCGATTGGTTCGATCGTCGATTCCGTTCGATTGAGATCGTCGGG ATATACATCATAAAAAAGTGAGTCACTCATTCAGAGTCACTGCAAAATTT CAATGATTTAGACATGTATAGTTTTTGTCATTCTTTTCTCCATTTTTATA AAAGCTCTGAAAAATCTAGCTAATTTTTTTGCCCGATTTTTAAAACTTAT TTTATTCTTGGCTGCTTTAGTTGAAAAAATTAACCGATTAGTTATTACAG ACGGTCTCAATTGATAAAATCAGTCATAGATTATACCAGACGGTCGTAAT CGATAAAATTGATAATTAATCGATAATTAATCGATAAAACTTATTTTATT CTTGGCTGCTTTAGTTGAAAAAAATTGACCGATTAGTTATTACAGACGGT CTCAATTGATAAAATCAGTCATAGGTTATACCAGACGGTCGTAATCGATA AAATTGATAATCGATGGATTAAATATTTATTAAAATCTTTAATCAATAAG TAATTGGCGCCTAAAAAATTGTGAGTATCGATTAATATCAATTATGTATC GGTTAGCTATCTATTAACATCGATTACTGTAGCTATCGATTAACATCAAT TAGCTATCGATCAACATCGATTAGTTATCAAGGCTCGAAATAATGATTTC AAGTGGGTCGGACAAAATGTCCGATCAGGGTTGCTTTAGCTTGAAAATTA TTATTTTTGGGTCGGACATGAAGCCATTTGGGTCGGACAATGTCCGATGT CCGACCGTTATTTCGAGCCCTGAGTTATTGATTAAAAATTGATAATTTCC GTAATTAGTCGTTATTGATAATTAACCGATATAGATATAGATAATCGATA ATTAATCGAGGCTGAAAAAATTGTGAGTATCGATTATCAACCATTGATTA CCGGCTTTAATCGATTTTTAATCCATCCATTTTAATTGATGATCGATTTT ATCGATTACGACTGTCTGGATAAAAATTGATAACTAATCGATATTAATCG ATGGATAAGATATTGATTAGAATCAATAATTGATAGCTATTAATCGATAT TCTAAATTTTATGACACTCAATTAGTTATCGATTACTATAGATCCAATTG ATAGTATCAAGTTATGACACAAAGAAGGTACAATGATCGATAATAATTGA TAGACCATCAATAATAAGCGATCATTACTCGATAATAATCGATACCCGAA GGTAATTGATATTCACAATTTTTTACCTCCATTAGCTATCGATTATCGAT TCTAATCCATCAATTAGCTATCGATTACCGATTCCAATCCATCTCTACAG GATGTAATAATGATTAATTACACTCTTTAAGGGTGCACCAAATTAGAAGA AATAACACATCGTGTGATTAACGTACAAAATTGCAGGCCAATCATAGTGG GTATCCCCCTTGAAAAGGGGGAGGGGTTGAAAATTTTACTGAATTTAAAA GAAATGGGGCCTGTGAAAATGTCAAATAAAAGGGGTGGCTTGGACAAAAA GAGGGGGTGAATTTTTTAAGGGGGAAGATTTGGCAATTTGCAAAAGAGTT TTGTGTTTTTCATTTATTTTTAAATTTTTCAACAATTATTATTTCCATTC ACTAGATTAAAGAAAAAACTTTGTTTCTACAACTCTACTTGATGGAGTAT GTTACTTTTTCAACCTTTGCATTAATTCATAACCTTGGAATTGTGTAAAA GGTTGAAAAAGAGGGGGGTTGAACTTAAACCTGGGAAAAAGAGGGGTTGA ATAAAAGATTTTCATTTTTAAAGAGGGGGTTATGAGTTTAAAGTGCCAGG GGTGCCATTTTTAGGGGGCTTGATACCCCTCTGCCCACTATGCCTATGTG ATAATTTTATTGAGTTCTAATAGTAGTTTTTGGCTAATTTTGGAGATTTG GGTTGGCCTAAAACGTTAAAAAATTAAAATTTCAAAATTATTTTTACAGG ACTTTATTAATATGCACCTACAGTCTGTTCATGATAAGTGTGCAGCCTTT CTTATTTTGCTTATAGCTTTTGAAGGAATTCTCTAATCATAATAAATTTG GTATGGTTGGAAAGGTATTAGTGAGTGGAATAATTTGAAATAAAAAGTTG TTTGAAAATGAAGATCTCTGTAGAATAATGCTACAATTGTAATTTTTTAG ACCAGATTCTTGTCTCAACAGGGTCTGAAAAAGGGGCTCCCAATTTTATT TTGATCCTAGGTCTAGATATAATTAAGGAAGCCAAAAAAGATTATTTTGA CGTGTAAAGACTAAAAAAGTAAAAAATACCCATTTATAGCCCATTGCTTG TAAGAAAAGTAGGGATAATTAGGTGAAAGAAATTTTTGGCTCAAAACCTC TAGCAATGGTCTCAAGTAAAACAGGGTGGCCAGCGATACTGGAAATACTT GAAAATACTTGAATATACTGGAAAAAAAATTGATACTTGATTATACTTCA AATTTTGATAAAAGTGTTATTTTTAAAGTATATACTGGAAATGAAAATCT CTAATACTGGAATATACTTGATTTTATCATTCATGATGCCGCGGAGGTCA AATCCTGGATTGGTGTCCAGCGCGGGATAACTCATCACCCTTTTTCGTTA TATTGTTTGTGAAATTTTAGTCGAGTATGTACTTGAATATACTTATTTTT CTTGGTCCAAGATACTTGAAAATTTTGAAAATGTACTTGAAAAATGGAAA AAAATTGTAAAAATGTACTTGATTTTACTGGAAATTGGATTCCCGAAATC GCTGGCCACCCTGTAAAACTTACTGACACTTTTTTAGTACTAAGATTCTG AAGCTAAAGTATGTCAATTTGAAGTCTTGAATCTTGAGGTATCACAAAGA CATAATTATTGAAATTAATATAAACAGAACTAAAAAATTTCAAGCATGAT TATCTCAATATTAGAATATAGAAAAGGGAGAAAAAAATTTGGAGGTTTTT CTCAGAATAACTAAAAAAAAACTGAGGACCAAATTTCATAACTTACCTGA TTATCCCTTTAAAGTAAATAAAGCACAAATTAATAGCATGGAGACACTAT TGGATCCAAATCAACAGCTTTCTTTGACTGACTTGGTGGTTTATTATTAC AAAGTGCAACCAAAACTGAAGTATCATGAAATAGTTTCAATAATAAACCA GCATCATGGCAAGCACTTGACCCTTAGAAACTTGAAAAACATATGTGCAA AACAATCTTTATCTCGAAAATGTAATGTAACTCACGAGCAACTTTGTGAA GCTATAAGGAATGAAATTGGTACTTCGCTGTCTCTTGTTGGCTATAGGCA AATGTATGAAAATTTAACATTGAAGTATAACATCAATACATCAAAAGAAA AGGTAAGGTTAGCCTTGCTAACAGTTGATCCAGAGGGTGTAGAACAAAGA AGAAGTCGCACTATTCAACGTCGTTCTTATTACACTGACGGGCCAGGTCA TATATTTCACATTGATGGCAATGACAAGCTCAAGCAATGGGGATTTGCAA TCCACGGTGGAATTGATGGATTCAGCAGGAAAATACTTTGGCTAAGTGTT TCAACCACTAACAATGAACCAATAGCTGTGGCTAATTTATTTTTGAATTG TGTGAAGAGGTTTCTAGTAGCCCCTAAGATTTTAAGAATGGACAATGGAA CTGAAAATGTACATTGCAATCGTTTGCAAGAGTTTTTCACTGGAGAAGAC AACCGATGCATAAATTCTGTTTCAGTCAGGAATCAACGAATTGAATCATT TTGGTCAAGACTTAAACGTTATCGTACAAATTGGTGGATACAACTTTTCA GGACCATGGAATCAGAAGGTCTTTTTAATGGAGAATTAGAGTCTCACAAA GAGTTGCTTTTGTTCTGTTTTATGCCAGTCATCCAAAGAGAGCTAAATGA TATGCTATCCACCTGGAATAGGAGGTCAGTTAGACAGTCAAATGTTAGTC CTGGTGGAAAACCTGATATATTGTTCCATGTTCCTGCTACTGTTGGTTAC AGCTTTCAGGGAACTCCAGTTGAACTAGAAGACATAAACGTTGCATCAGA TTTGATTGGAATTATACAGCAACCATTTTTCAAAAGTAAAGAGCTCTATG ACTTGCTAATGAGCTATTCTGTATTGCATGGTTTATCACAATTTAATAAC GCAGAAGATTCACTTGAAAACTATGTGAGACTACTTAACTTGTTACAAAA TGATGGTGTATATTTTTAACTCAAATACATTTCTATAATTTATGCTTGTT ATGTTTTTTTAGTCAAGATATTTTGCAATTGTCACACTCATAGTGAATTA GCGATCTATTTTAAACCTTTGAGGTTAGATCGCATGTGCGGGTTGCAAAT AAAACCCATTTTGTCAGCTTGATGAAACTCATACAAATTGTACAGGAAGC AGGTTTAAATAGGCTCTCTCGGTTCTGTTATTAGTACACTTTGAATTTTG TAAACATCAGGGCTGGAAAAATTCAGACCAAAGAGGAAAAATATCTGCTT ATCACTAGAGGTTATACATTGCTACTCTCAAGTGCCTAATAAACGGGGGG TTAAAATAGACAGGGGGATGGAAAAAATTTTCAAATCTAATAAACAGGAC CCCTAACTACTTTATCTGGATTAAATTAAAATTTTTTGGATTTAATTTCC CGAGTCAAGAGTTTCAGAAATTTCACGTGGATTTAATTTCGCGAATCCAC ACGTTTTCACGAGTTTTAATTTCGCGAAAAGGGCAAAAAATCGCGAAACC GCAAAATTTAATCTCATAAAAATTTAATCCGATTAAAATACCTAATTACA ACCTAATTACCAGGGGGTTGGAAAATGTTCTCCTGAACACCCTTACATAG GGTAAAATTAAGCTGAAAATAAGGCCATTTATAGCAAAATGAGGGACTTT CACTATGGTACCTGAATATTTAAAAAAAATAAAATAAACAGGGGGTCCTG ATAAGGTCTGGGGGGTTGGAAAAAAAATTGAAAAATCAACAAAGGGGGAG GGGCGTTTATTAGGCACTCGAGAGTACCTTGTTTCTATTATTTTTTTAGC ATTTCAGAATTTAGCTATTTTTTAAATTTTTTGCTAAGAAATTTTTTCCA CCTTGATTGAAAATTTAGTTTTTTGAAACTTTTGTGAATTTTTCGGGATT TATACTGTAGCCAACTTGGTAAAATCGAAATTTCTGCTGCATATGGGTAA TTGGCTAATTTTTTTGTACCCCAAAAGATAATTATGTTGAGAATATTTTT GTGTTACTCGACATCTGTCGCGTGTTTTGAGCCTACTGGGCCATAATAAT TATGCATTATGCATTATTATGCATTATGCGTTATGCATTATGCGTTATGC ATTATGCGTTATGCATTATGCAGTAGGTATTATGCATTATGCATTATGCA TTTTCCGTTATGCATTATGCATTTTCCGTTATACATTATGCGTTTTGTAC TTGGCCAAAAACATATATCCAATTTTTCTGGAATTATGAGAACTAGCTAT TTTCAATAATAATTTAGAATAATTCAGAATTAATAATGATAAATGACTCA CAATGTTTTTCTTTTTTCTTTTTTAGATTAGTAGTTTTCTCAACCTGCGA AACATTGGTCACTTATTAGAAACATTTAAAGTCCACAAAATTGATGACAC GGTGTTAAAAAGTGTTGACGACCTAACATTGGCTAATCTTGGTTTAGCGT ATGGTGATGTGATTGCATTCAAGTTGAAATTCAAAGAATCTGAGACCAAC CCACAAAAGACCTATGAATCAAGGTTGCAAAATTTAAAAGACAAAATGAA TATTTCAAGACAAAGAACTGACAGAAAAGATGCAAAAAACAGATCCATCA GTGTTAAAAATGTCTTTAAGATGACATTATTCTTAAAGTGTTTTGAAAAA AAGTATGTGAGAAAATCTGGAGAAATGTTTGAGACAACTGTATGCATGGA AACTTCTTATGATAAACTTCATAACGAAGCAAAAGAACATTTTGGAATTG ATAAGACAACCAACACCTTCTTAGCTTCTTACAATAATGAGACTTATCAA GGAGTCATAAATAAGATGGGCCAATTCATTGCTTTGAATAAAGAAAAGAA AAAACAATTGGTAATGTACCTCATGTATCCAAAAACTTATGGCCGCTTGG AGTATGAAAGAAACAAAGAAAATTCCATTTTACAATTTTGCGATGTGTGT GACAAAGAGTTTGTTGGCTTTTGCGTTTATTGTGCTGCACAGCAAGAGCT GGAACAACATGGCAATTACAACCCTCTTGTTTTCGATGATTTTGATGGAC AAAACGATCAAGGTGAATTTTCCCTTTATTCTCAACTTCAGTTCTACTTG AATCTGACCATTTTTTGAAAAACTTGAAAAATACAAAATAGACAAACTGA AAACTGGCCAAAACCAATTATACTTCAAAAAGCTCCCAAAAAAGTTTATA GAAGACTTTTAAGGAATGTGTACACCTTTTTTCCGATTTTTTGTCAAAAA AAATTTTTTCAGTCAAAGTGGAAGAAAAGTTACTGGATTTCATTTTGGTA AAATCGCGATCTTAAAATCTTTTTTAATCCAGAGTTATAACGATTTAAAT TTCAAAACAAAGTTCGTCTTATGATGGTTATTTACTCAAATAATTGTCTC TTTCGGAAACAACAAAGACAAAAGAGAGAATTCAGCTGATGTTTATTCTC ACCTCTATTGAATAGTAATATTTTTGACACATTTCACTGATTACTCAAAT AAACAGCAATCATCTCGTTAAAAATTTCAAATTGATGTAGAAAAAAACGA AATTTTACCACACCATACTACTTTTAACGAAGTTAAAGTCACCCATAGCA TTTAGATATCGACTTCATTCTTTTTTTATGAGATTCCCAAAAGATCAAAC TTAAAAAGTGTCTTAGGATTTTATTTCTAACCGACTTGTTTTTCCTCAAT TTATAGATAACTGAAAAAATCACATTTAAATTTACTTTTTTATCGATATT TTTACAGAATTTAGGATTTCAAGAGTTAAAGTCGATTCCAAAAAAAATCC CAAGACACTTTTTTAGTTCAATCTATTGGGAACATAGTATCGAAATTTTT TTTTCAAAATTCAAAAGCTATGGGTGACTTTAACTTCTTTGAAGTAGGTA AGGTTAAAATTCTTAAGATTTTAATTATATCCTGCCCAGTTTTTTAAATT CAGCTGAAACTTTTACCATTAGAAAGAGAATATTATTGGCTTTCAGAAAA TATATACTTTTGATATATAAAAATTTGCTGTTCTAAAGATATGATCAATT AAAGAGAATGGTTCAAGAAAGGTGTACACATACCTTAAACGAATTTGGTC AGTTTCTGTACTGGTTTGGAGGTATTTGGCCTCAAAGGCAAGAACATTTG ATTAAAATTCTCCATAAACCTGAAAACGTGTGTATTTTCAGGCTAAATAT ATCTCTAAATCAATACAGATTTTTTAAATATCCTTATAATAGTGAGACCT TCAATGAACAGACAGGCGTGGAAGAAAAGAAGAAAAAAAAACAGAACTTT ATGAAAAATTGAGGGGGCAATATTTTTCATCTTTAGCAATACCCTGTTGA CAACAATAAACTTAAAATTATTTTGTCAGGAGATGGAGTTGGAAGTGGAA GAAGTCGATCCCCTATTTTGTCAGGAGATGGAGTTGGAAGTGGAAGAAGT CGATCCCCACTATCTGAAACAGCTTCCATGGAAGATGTCACATCTGAAAG GTTTGACAATATATAATATTAAGAAATAAAGAACTAACTTACAATTGCGA CACAGTGTTTCATGCTGTCGCATGAATATACACTAGATCCTTGCCTTTAG CCACTATTTTAGAAATAAAAGTGCTCAAAACTTTTGAGATTTTACTTCCT GTTAGTGAGAGCTGCTATGTTTTATATTAAATAAAAACACTCTTCGTGTG TACAGACCTGTTAGAAGCAAATCAACTTTTTCAAATGATCAAAAAGTCGA ATGTTAATGTTACCATCAGATTTAGCTCGATGCACTGATGAAAAAAATTT GTCATTTGTTAAGTTTTGACCACCTGGACTCGATTTATGGCCCTTTTTAG GCTCAAAAATGCTCATTTTAGGCCCAAATTTGGCCCATTCCATACGATTT GACCTTGCTAAACATAGAAATTCCTAATCTACATAAAGTTTGAAAACTTT TGGTATATAACATGTCTGGTAAGCTCATTGAGCCCAAAAACCTCAAAATC AGGCCCTCAGCTCATGGACTATTTTTACCATCTTTTAAAATCTCAAATAT GGCTCAAATGAAGGATTTTTACCTCAGGATTCAAAAAATTGTCATAACAT ATATCTAAAAATGAGGTAAAAGTCTTTCGTTTGAGCGATATTTTGAGATT CTACTTTTCACTTCCGTTTTTAACCTCCAGCAAAAGTGATAACGTCATGC GGTGGCAACCTGAATGGTCAAAATCATTATCACCACTTATTTTTGTGATC TTATGGACGCAAGCGATCATTTGAAAAAGTTGATTTGCTCTAATTAGTCT ACATACGAAGGAAATAGTGACTCTCACTATATGAAGGACACATCGTCTTA TTTTCTTAATTCCTCGCAATGGGCGTTGAGGAGGTCCGATTTTTCCTCCA GGGGGTAAACCTTAAAACCTTAAAAAATCTGGAAAATTCAGGGGGGGTAA CAAGATTTAGTAAAATCCTGGGGTCCCTTAAAAATAATAAAAAAATCCAG GGGGGTCTCTAAAAATTCAGTAAAAATCGGGGTCTCTAAAATTTCGGCAA AAATCCAGAGGGGTTGATATTCCAAAAATGACCTCAAAATTGTTTTCTGG AATAGCTCAATTTTCACTTTTAATTTTGTCTGATCATAAAGAAGATTTAC TCTTCCTAAATTTTAGCACACCAGTGAATAGCGGGCTACTACCCTCATCA AGACAACGTAGCATACCATTGCGGTACAGGCATTCTATCGGGTCACCTGG ACTGACGCATAATCTTCTATATGAACGATCACAGAATCCAATTCCACCCC CAGATGGACAAAATCAACATCCACTAGAAAAGGAAGATCAGCAAAAAGAT TCTAGTGTTGTCAGTTTATTTGGACAAGACGAGATGGACAGGTTTTTTGA GAATCTCAGAGAAAAACCGCAAAATGTGACTAAAAAAACAGAAGAAGAAC AACCTCCAATTGCAGCAGATATCTCAACTGCTTATGACGAGTTTGTTCAT CGAGAAAAGGAGCCCAAAAACATTCTCGTTCAAAGAGATAAAGACTTCTT TTGGCAAATCCTTTTTAGCCAAGAATTTAATTTGTCATGTGAAGAGCCTC GTGTCCGGTTTGCAGGGGAATCCGGTGCTGATGAAGGTGGGGTTTATCGT GAATTTTTAACATTAGCCATGAAAAACCTGAGTCTCTCCAACCTTTTCAT CGGAGAGGAAACATGCTTAGGAATAACATGCAAAACTGAAGCCATATTGG ATGGATGGTACCATATAATAGGGCAGCTTATTGGTGCGTCAATTTTGATC AATGGCCGAGGTCCTGAATGTTTTCATGACTCGCTAGTACGGGCGCTTTT TGATATTGAGCAACCGCTGTTAATCGAACCAATCGATGATGCTTCTATCA AAAACCAAATTTCTCACATCAACCAAGGCAACTACGATACCCTTTATGAC TACGAAATTAATCCTAGTGGAAAGGAAAAAGAAGAACTTATAAGATTATA TATGATAGCAGTCCTCGTGGTTTCAAAATCGTCTGCCATCGAGCAGTTGA AAGGTGGTATTTGTTCAATTAGCAAAAATCTTCTACTCAAAAGCAACCTT CAGGAAATGAAAAATTTTTTAGTCTACTCTCCTGTACAGTATTCGTTTGA ACAATTCATCAGCCAAATTGAGTACCCACAAAATAAAATTGGCGCTGTAG AGGTAGGATCCAATTTGGAAAATGAAGTTCGTCGGGGTGTTGCAGATTTC GAACTTATTTTGTTAAATATTGGACAGGGTAAAGTTTTTCTGGAACCAGG TACCGCTCTGAGATATACAGATCTATTATATTTCATCACTGGTTGTGACC GAATTCCATCTTGGGGTTTGCCAAAGAAAATCGAAGTCGATTTTGATCCT ACCACCACTTTACCACACACGCACACCTGTGGGTCTTTGCTTCACCTCCC ATTCCGAGTTACAGAGTCACAGATGGTTGTGGCCATAAATTTTGGTGGAG GTTTTGGCAAGATTTAGAAATTGAACTTTTTAAAAACATGACTTTCGAAA ACTCATTTATCCTGTTGATATTTGTTAAGTAGCACTATGAAAAACTTTTG ATTTGGGTTTTACAGTTATGATGAAGTGAAAACTAAATTGTGATTGACAT ATTATCTTTTGTTTACCAAAACGTTTCATTTTCTATGTGTTTTTTTTCAT TCACACTACATTTTTTACATTCTTTGGATTTCACTTTTCCTAGGCAGTTA AAATGAGATCTAGCACAACGAATAATCTACAAAAATTCTTTTCATTTGGT TTATAACAAAGGCTCGTTGTACATATTTGTTAAGTTCTCATTATACAAAT GGGCGTGCACTTGTTTAAGAATAAATAATGACATAGATAATATGCATGGG ACCTCCACGAAAGTGGAAATGTTATAATAATAATTACATTAGTTTACACT GAAATCCAACCTTCTGTTATCTCTTCACTGTCTTCACATTTTTAACACAT CAAACGTTTTGCAGATTCCTACAGTTTAAGGAAAAGTAGGTGAATGAGCG TTTTTATTGTATATATATTTTTAAAGATTTTTAAAAGATGCAAATTATTT TTTGATTTCGTTTGAATATGAGGTACTTTCTATTATAAAAGAAATTTCAT TTACAGTTTCTACATGGTGATCGGCAAAGAAGCTAAACTTTTGAGTTGAA TTGATTTTTTATTGACACAGCATTTTAAGGAATTGGGACAAGCCATTGCT AAAGCAAAGCTGAATTTATTCATCTGTAAGCGTCCGATTTTTTTCTCGGC TACATTTTGAAGTGTTTTTTGTATTCTCTTGATATTTAAAACTTGATTAT GGAGTGAGTATTATCCTTATTTAGATCAAAGTTCTGTTAATATTTCATTT AGTTTTGTTATACTGCAGCTTTTATTGTAGATCTGTTATTTATTTGATAT TTATACTCTTTTGATATTTAAAAGATTTTTCCGCAGCAAGTATTTCTTGG ATTCATATCATCTACCATAAGGGAAGAAAATTTAACACTATTCTTATATA AAAAAGAGCGTATTTCGAGGTTCCAAAATTTCGCCTTTCGCCAAATTACA CACTTTTTTATAAGAAAAGTCTCTATAAGAAACTCAGGGTTAAAATCGCC AAATTGTAAGAATAACTTAACCCTATTCCAACGAGATGAGCTGGAGTTTT TACAAGATGCTTAACTGATTGGTTATTTTTAAACAATAGGGATGACGCGT TCTTTAGAAAAAGTAATAAAATCGTTTGTCTCAACATTTAACGACCAACA GAATCATCAAATAACTTGTAAAAACTCCAGCTTGACCCATTCTAACAGGT AGAAATTTTGGCAGATTTGGCCAGAATCCGCCAAATTAAGTTCCCGCCAA AATTTCTTTTTTTTCGCCATCCGCCAAATTAAACTTTTTGAAAATATGAT CTCTTTTAAGGTATTTTTGCATTTTTTTTGCTGTTTTTACACCATATTAA GGACAAATTTTTCAGCAAACGCCAAATTAAATTCCCGCAAAATTTAGTTT TTTCGTCCATACGCCAAATTAAATTCCCGCCAAAATTTCTTCCTTTAAGG TAGGCTTTTTGAACCTACCACCGGTGGTCCTATAAATTAACCCCTGTCCG TCTGTTCATTCGTTCGTTTCTTCGTCCGTCTGTTACCAGCTTTTCTCAGG ATTTCTTTGCACAAAGAGGCGTATTAGCAATGTCCGAAACATGGCCGAGT CCGATTTTGGAAAAAAAAAATTTCCCGCCGAAAATACCGAAAATATGCCC GAAATCTCCGTTTTTTGCAGATATTCATTGGATTTTTTCCTTTTATTTCG TTGTTTTTTCACACTAAAACATCATTAATAAAAATACCCACCATCAATGT TGCATGTTTCAATTGTCAAAAAAACTGAATTTTGAAGCCGGAACTTTCTA AAATTCGCCGGAACAGCCAATTTTCGCCGGAAAAATGGTATTTCTTGAAT TTTTCGAGCTGTACTTTATATTTTTTCATGAAATTTTGCACACTGATGCA AAATGGCAATACCTAAAATATGACAGAGCCCGATTTTCAATAACCATTGT TTGTACATTGTACATTGACTTTGTTTGAATCTCCGTTATGGATAATAATA GTAATAGTTTTCGTTTGTCGTTGTTCATTAATTATGCCCTTGCAGATTGA TTATTAGCCCTCTAGTGCTATTTGCGCTCTCCGCTTCGGAGACCTACCTT TGCCTGAAAACTCTCAAAGAAAAAAGAATATGATGTGATATTTGCACGTC TCAGCCTTTGAAGAGTTGTCCATCGAGTTACCAGCTGTCGAGCCTATCAG AAAATAAGCTGACTAGGGCGATTTACGGCATGGAGCAAAATTACCGTAAA AAATGCACACCACTTCCACCCATCTGAGCATACTCATTCATAACTTAAAA GAAGCGTATTTGGATGTAGAAAGTGGAAAAACCTGTGAGAGATTGATATT TTAAACACACAAAAAGTTATTAGCGGAAAACCTCAATTATGACGTCATAA AAATTAAAACTTGAATACTTCTTGAATTGCAATTCGAATCAGATCAAAAT TTAACCAGCCCTCTTATTAGAAAATCAGTAAAATTAGAAATTAAGTAAAA ATGTGAGATTGTTCAACCAAAATGTATTGAAATGTATAAAAATTATAGAT TATGTTGTATGTTACCTAATACGCGGAGTTTGGATTTGGGGTAACATTTG GGGTAACACCCAAAAATAATAAAGCTACTACTAACTTGACTCCTAGGACC GTTTTAAGACAGCCACTGGAGCAGGACCTAAGAGAACCGCGTAGCGATGG CTGTGACGGACAGGGAGCCTTAACCGTAATTCCGGTCATGGGAGGTGTTT TACAGTTCTTCAGTTATAGCTTATTATTATCCATATAGCGGTCATTAAGT AAGCCATTAAAGATTCAAACGGCGGGCGATATTGAAAGGTTCCGTGATTC AAATAGTCATACCCGCGCTGGGGAAGCTAAGGTGCTCGGCTTCAGAGGGC TGAAATATCATTAACTATCAGGGGGGATCGGGTTCAATAATCCGAAATGA TAAGCCGTCGTCGAACATAGAGGTCGTCGTCGCCGCGCATAGAGGCCGTG GTCGGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000480XLOC_000480Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000777-exon-sc0000005-1575043694:311302..311333TCONS_00000777-exon-sc0000005-1575043694:311302..311333Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1575043694:294344..294463TCONS_00000777-exon-sc0000005-1575043694:294344..294463Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1575043694:293609..293718TCONS_00000777-exon-sc0000005-1575043694:293609..293718Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1575043694:292460..292533TCONS_00000777-exon-sc0000005-1575043694:292460..292533Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1575043694:286630..286721TCONS_00000777-exon-sc0000005-1575043694:286630..286721Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1575043694:285996..286104TCONS_00000777-exon-sc0000005-1575043694:285996..286104Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1575043694:285663..285764TCONS_00000777-exon-sc0000005-1575043694:285663..285764Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1575043694:285330..285435TCONS_00000777-exon-sc0000005-1575043694:285330..285435Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1575043694:279561..280271TCONS_00000777-exon-sc0000005-1575043694:279561..280271Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1575043694:272322..273057TCONS_00000777-exon-sc0000005-1575043694:272322..273057Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1575043694:270884..270959TCONS_00000777-exon-sc0000005-1575043694:270884..270959Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1575043694:265228..269717TCONS_00000777-exon-sc0000005-1575043694:265228..269717Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1510915933:311302..311333TCONS_00000777-exon-sc0000005-1510915933:311302..311333Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1510915933:294344..294463TCONS_00000777-exon-sc0000005-1510915933:294344..294463Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1510915933:293609..293718TCONS_00000777-exon-sc0000005-1510915933:293609..293718Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1510915933:292460..292533TCONS_00000777-exon-sc0000005-1510915933:292460..292533Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1510915933:286630..286721TCONS_00000777-exon-sc0000005-1510915933:286630..286721Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1510915933:285996..286104TCONS_00000777-exon-sc0000005-1510915933:285996..286104Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1510915933:285663..285764TCONS_00000777-exon-sc0000005-1510915933:285663..285764Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1510915933:285330..285435TCONS_00000777-exon-sc0000005-1510915933:285330..285435Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1510915933:279561..280271TCONS_00000777-exon-sc0000005-1510915933:279561..280271Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1510915933:272322..273057TCONS_00000777-exon-sc0000005-1510915933:272322..273057Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1510915933:270884..270959TCONS_00000777-exon-sc0000005-1510915933:270884..270959Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1510915933:265228..269717TCONS_00000777-exon-sc0000005-1510915933:265228..269717Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1491911889:311302..311333TCONS_00000777-exon-sc0000005-1491911889:311302..311333Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1491911889:294344..294463TCONS_00000777-exon-sc0000005-1491911889:294344..294463Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1491911889:293609..293718TCONS_00000777-exon-sc0000005-1491911889:293609..293718Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1491911889:292460..292533TCONS_00000777-exon-sc0000005-1491911889:292460..292533Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1491911889:286630..286721TCONS_00000777-exon-sc0000005-1491911889:286630..286721Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1491911889:285996..286104TCONS_00000777-exon-sc0000005-1491911889:285996..286104Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1491911889:285663..285764TCONS_00000777-exon-sc0000005-1491911889:285663..285764Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1491911889:285330..285435TCONS_00000777-exon-sc0000005-1491911889:285330..285435Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1491911889:279561..280271TCONS_00000777-exon-sc0000005-1491911889:279561..280271Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1491911889:272322..273057TCONS_00000777-exon-sc0000005-1491911889:272322..273057Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1491911889:270884..270959TCONS_00000777-exon-sc0000005-1491911889:270884..270959Clytia hemisphaericaexon
TCONS_00000777-exon-sc0000005-1491911889:265228..269717TCONS_00000777-exon-sc0000005-1491911889:265228..269717Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000005supercontigsc0000005:265228..311333 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.605825 0.589268 1.45723 1.71809 0.0375518 0.0323892 1.91223e-05 0.398209 9.42275e-05 8.37663e-10 1.92333e-05 0 0.000474584 0.00315177 0.458911 0.469988 0.652104 0.490941 0.321784 0.426724 0.613888 0.601463 0.659373 0.542493 0.727596 0.0349228 0.792964 1.06349 1.43447 0.921975
Blast
BLAST of TCONS_00000777 vs. Swiss-Prot (Human)
Match: DCNL4 (DCN1-like protein 4 OS=Homo sapiens GN=DCUN1D4 PE=1 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 1.057e-71
Identity = 120/242 (49.59%), Postives = 176/242 (72.73%), Query Frame = 1
Query:   67 IMPPKRKRKGGSQDTSSKKVKQNEQENMSSMQKYFKSALNCVDMPSNKDQAFSNKRCESFFHKYADSNLSLIGPHGVEKLCQDLEVQPEDIVMLVLSWKLGAENMGWYKLAEWKTGMTSIECDNISKLKNKIPSLRGLLKDPSSFKKIFRYAFDFARDKEQKSLDIDTGKAMLQLLL-ESWHLVADFIQFLNQSRYKIINRDQWNSLLEFIKTVDTADFSGYDDEGAWPVMLDEFVEWHKEK 789
            +MPP++KR+  S D  S K  +++    S  +KY  + +        +++AFS+KRC  +F++YA ++  ++GP G+EK C+D+ V+PE++VMLVL+WKL A+NMG++ L EW  GMTS++CD   KL+N +  LR  L D ++FK I+RYAFDFAR+K+Q+SLDI+T K ML LLL + W L   F QFL QS+YK+IN+DQW ++LEF +T++  D S YD++GAWPV+LDEFVEW+K+K
Sbjct:   60 VMPPRKKRRPASGDDLSAKKSRHD----SMYRKYDSTRI------KTEEEAFSSKRCLEWFYEYAGTD-DVVGPEGMEKFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPLFPVFHQFLEQSKYKVINKDQWCNVLEFSRTIN-LDLSNYDEDGAWPVLLDEFVEWYKDK 289          
The following BLAST results are available for this feature:
BLAST of TCONS_00000777 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DCNL41.057e-7149.59DCN1-like protein 4 OS=Homo sapiens GN=DCUN1D4 PE=... [more]
back to top