Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000744 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000744
Unique NameTCONS_00000744
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length6317

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000744 ID=TCONS_00000744|Name=TCONS_00000744|organism=Clytia hemisphaerica|type=transcript|length=6317bp
tttttggacaataatctgaaaattttattattgatgtttttaaaaGAGAA
TAATTTCATGAACTAATAAACAacaaattcaataaaaagaatataCAAAA
ATGGCAACCGAAAATGTCATCATCTCTGTCGACGGTATGGTCTGTATGTC
GTGCGTCAACAGTATACAAGACGTCATTTCACAACGTGACGGTGTCACTT
CTATCAAAGTTAGCCTAGAGGACGAAGAAGCAGNCAACGTGACGGTGTCA
CATCTATCAAAGTTAGCCTAGAGGACGAAGAAGCAGGTATAGTATACGAC
CCGACGATAACAACTGTCGCCGATTTAGTCAGTGCAATCGAGGATATGGG
ATTTGATGCTTGTGAGAAACCTGGCGACACACAAGATGACAGCGTTAGTC
TAGAGACTGTCCTTATTGATATCCAAGGCATGAAATGTAATTCTTGCGTT
AATAATATAGAAAACACTATAGGTGGACGAGAATCTGTGCATCAGATCAA
AGTCTCATTGGAAGATAAAAATGCAACCATAGACTATGATTCATGTGTTG
AATCACCAGAACAAATTTGTGACGCTATTTGTGAAATGGGATTTGatgct
tttttgaaaaacaacaaTATGAAGACTGTTTTGTTAGCTATTGAAGGTAT
GACTTGTCAATCGTGTGTTAAAACTATCACAGAGGTTATGTCCAAGAAGG
ATGGTGTGAAAAATATCAACGTCTCTTTGGAGAAGAATAATGCTCTTATT
GAGTATGATTCTGATAATGTCGATGTTTCATTTCTATGTCAGAGTATTGA
AGAAATGGGCTTTGATGCATACTTGGAATCAACTAAACTTAAAGaaacTT
ATTTATCCAATACATCACTCGATGATTTATCCGTCACTTACACCAAGAAA
GGACTACCGTCAAACTCTCTCCGCCCTTCCCCGTTAACGCCATCACCAAC
ACGCCTTCTGAATGTCTTGTCTCCTGGTATACAAGCCATGAGTGCAATTG
ATATGGAGGCGACAAAGAAAAGTTTCTTCCATGTGACTGGAATGTCGTGC
TCCTCCTGTGTTGGCAAAATCGAACGAGAACTGAAGAAAAAGACAGGTGT
GTACAATGTGACAGTCGGACTATTAGCGCAAAAAGCTGAAGTTCTTTATG
ACCCTGATGAAACCAACGAGGAGACGCTAAAGAACCATATCGAAGCTCTT
GGGTTTGGTGCAAGCGTATTACAAAATCACAACTTGAAAGAACGAACTGT
TCAATTTGAGATATTTGGTTTTGAAAAAGGCGTCAGTTCTCTGTATCTGA
TTGAAAATAGTATCTTGAGACTGAATGGTATCCTGGATATTAGTATCCTT
CAAGACGGTACCCATATCACCTGTACGTATGACCCGACCGAATGTGGACC
GCGCGATATCAAAGATTCAATTGAGAAGTTGGGTTTCCAAGCTAGATTGG
ATACAAACCAAAAAGAAGATGACTTTCTGAGTCATACGAAAGAAATTAAT
CAATGGAAGAAATCGTTCTTATTCTCCTTGATCTTCGGCTTGCCGGTCCT
GATCATCACCTTTACATACATGGCATTGATGGCTTACGGTATCCATGATC
TTCATGTCATCCCTGGACTGTCCTTGGAAAATCTGGTGGTTTTTACACTG
TGTTCCATTGTTCAGATTCTTGGAGGTCGACGTTTCTATGTGTCAGCTTA
CAGATCATTAAGTCATGGAAGTGCAAACATGGATGTCTTAATTGCTTTGG
CTACCACTGTCTCTTATGTTTATTCTgttaTTGTTTTGGCCATCGCAATG
GTTGAGAAACTTGACCACAGCCCAAAGACCTTCTTCGAGACACCACCAAT
GTTATTCACCTTCATCTCATTGGGAAGGTGGTTGGAACACATTGCTAAAC
GCAAAACGTCTGAAGCACTCAACCGACTGCTTTCATTACAACCTACTGAA
GCTCTTCTAGTCACCCTTGAGAAAGGAAGCATGCAGATCTTAAGTGAGGA
ACAGATTGATGTTGCTCTTGTACAGACTGGTGATATTCTCTTGGTGAAAC
CAGGTTCAAAAATCCCATGTGACGGTAAAGTCATCTCTGGTCGTACTTCA
GTCAACGAATCTCTGATTACCGGTGAAGCGATGCCAGTCGTCAAAGAAGT
TGGAGATTCTGTCATCGGTGGAACTGTCAACCAAGTTGGTGCTGTATTGA
TACAAGCTACTCATGTTGGACAAGATTCAGCGCTGTCACAGATCGTCAAA
TTGGTTGAAGATGCCCAAACCTCCAAAGCACCAATCCAGCGAGTAGCAGA
TACGATCGCAAGTGTGTTTGTCCCTATCATTGTCGTTCTATCGATGATAA
CACTTACTGTTTGGATTGTTATTGGTTACCAGTATTTCGAATGGGTACAT
ACACACGATCATTCTTCACTTCATGGCCACAATGAGATTATTATTCAGTT
TGCATTCCGTTGCGCTATCTCCGTTCTTTGTATTGCATGTCCATGTGCAC
TTGGTCTTGCAACGCCCACTGCTGTCATGGTTGGAACGGGCGTTGGGGCG
TTGAATGGAGTTCTTATCAAGGGTGGTGAACCATTGGAGCTGGCACATAA
GatcaaaacagTTGTGTTTGACAAGACGGGTACACTGACCATTGGGAAGC
CACAGGTTGTagctacaaaaatttttgcagaGGGCCTTTCCCTTCAATGG
AAAGAGTTCATGGCCATCGCTGGAACCGCCGAAATGAAAAGCGAACATCC
ATTGGGTATTGCTTTGAAGGATTACGTCATCGAGAACCTTGGATCCCACA
GCCTTGGAGATGCAGATGATTTTGAAGGGTTTCCAGGGAAAGGTTTGAAA
TGTACTGTCACCAATATTGATATTTCCAATACTGCTCCCGACCAATCAAC
TGTCGATATAGAGGTCAGTGGAATACCTGTGGATAAAGTCAATGTACCTA
AACCAAATATTGGTTCGATTCGATCAAAGAAGAGATACGAAGTTTTGATT
GGTACACGCTTATTTATGTTCGACAACTCGATTGTTATAAGTGATGACGT
GGAACAGATCATGCAGTCTCATGAACGTCAAGGAAGGACTTCAGTCCTTA
TTGCTGTCGATAATCATATCTGTGGTTTGGTTGCGTTTTCTGATTCAATC
AAAGAGGACGCGCGTAAAGCGATCATCACGTTGAAGAAGATGGGAATGAA
AGTCGTCATGTTAACAGGCGATAATGAGAAAACTGCAGAAGCGATCGGTA
GACAGGTGAATGTGGATAAAATCTACGCCAAAGTGTTACCATCCAACAAA
GTGGATAAGATCAAAATGTTTCAACGTAACGGAGACGTCGTCGCCATGGT
CGGTGACGGAATTAACGATTCACCGGCCCTTGCGCAAGCTGATGTCGGTA
TCGCTGTCGGTACTGGTACTGATGTCGCCGTGGAAGCAGCCGATGTCGTC
TTGATTAAGAACAACTTAATGGACGTAGTAGCTGCAATTGACTTGTCGAG
GAAGACAGTacgcaaaatcaaaacaaatttcatttttgcaCTTATCTACA
ATTTGATTGGAATCCCGATAGCGGCAGGTGTTTTCATGCCCTTGAACTTC
GTTTTGAAACCGTGGATGGCGTCTGGTGCGATGGCTATGTCCTCCGTATC
GGTTGTCTCTTCATCTCTATTGTTAAAAACGTATAAGAAACCACAGTATG
ACGAAGACGGCTCACGACTCTACGAAACATTCAAACAGAAGAAACGAAAA
GTATTGAAGGCTTTCCAACGTTCCTTTTATAAAGGTGGTAAAGTGGACAA
TCGGAGATCAAAACTCAGATCGTATTCGGATAGTGAACACGGTTTATTGG
ATAGTGACCGCGAGGATTGACTAGATTGAAGAAGGATTGGTTGAAGGTTA
TGAGTGTGTCAGTGAGATATTGTTCTCATCCTGGTAGTGATTGCTTCGTT
CAGAGATGGAATGTTTTGAGCATTTATTGACGATCTACCTCATAACCTCT
TAGAAATTTGGCTCTGAGCAATATCGATGAGCAAGTGGTATGAATAACCT
TCATCCCTATGTCACAGACTGAAGTGATTTTATTGGTTTATTTGAGAATT
ATGATGTCATTCGTAATCAATAGAATGGTTTTGCATCATTTCCAACTTAT
CAATACTTACAAAATTGAAACGCGGTTTCGTACAGTAGATTAGTTTCATA
TTTAGAAATCAAGTCTTTGTCGTCAAGAAAAGTTCATTTGACTCCTTTGG
TTGAGCAGTAAAGGAAAATGAACCTTAATTTTTCTTGGACGAAAAAGAAT
TGTTGTGTTAACTGAACTTTTATACCCTACTGGTAAATAGAGTCTTTGGG
TCGATGGTAATtcaaaatttgagtcactgcaatGGCTGCAGTTCATAACA
TGCCACGAATTATacgttgttgttttgtttttttgtttttttgttttttt
gtttgttttttttcaatgtgaagAATCACCTTTTTGTATAATGAACTTTT
CAAACCTGTCTTTCTCAAACTGTTGGATATTTTTCGAGGTTTCTAtgttc
aaatttgtttttgtaaagCCCAAAAGAGCTGCCGTAGTATTGTTTCCCAT
GGGATACAATACGACTTAGCCTGAGTATACAGAGtcgaaatttcagaaaa
tatataaattgcCACAGCatgcagtgctgcaaataacggccggtgactgg
taattaccggtcattttgtagtttctacCGGCCAATCTGAAGTTCAATct
ttcattttgtccggttaaaattAAAGACTAGAAAGAGGCTTAGATAAATA
CTTAATAACGTTTCTTAAAAGAGGGatagattttgaattaataCATGTGT
TTAGCCAATCTTAAGGTCATTTCAGACTTTTCTAATGCCCAAATTATTTT
CGTGACACTcaaaaaattaccggccaactgaaatttccttatttgcagca
ctggcATGTATTAATGCTATTTCAAATAGTTATACACCAGTTGTAAGATA
TTTCCAAAGAGAATAACTTAAAAGATTGAAGATTTTCTACTGGTTCAAAA
TCATGACATCagactttttaaaatattttaacctTGCTCAGATTTTTTGC
ATCTTTGTAGGATAAAAAGCCCTTTGAAGTAGACCTAAAACGattcaaaa
accaaaaacaacaaaaatgatCTTATCCACGGTgctttcgagacagactt
taaaacTTTAGAGCTTTTAGTCACAATACTGTTTTACAACCAACATAAAG
AAACTGTTAGGTATAgactaggctgcacgcatcccctctgatatgatttg
atataacaaaataaattctggggatgcgcgcagcctagGTATAGACAGAt
actaaatttgatttttactgTATTGTAAATAGTAAGTAAGGATTGATTTT
TTATTACGAATAATTAGTATGATACTTTGGAATAGTCGCTGGCTCGACAC
GAAATAACATTTTTGTATTTCTATCTATTTAACCAATTTCcaataatttt
tgctttttattcATGAAATATAACtctaatatataaaatattgtcttAAA
AATCATGTTTTCTGTTCAAAGTTAGTCTACAATAGAAAAAAACGAAGGCT
TATTTACAATATGGTTCATAAAAAATAGTGTTGAATTTATACCGTGGGTA
CGGGCATAGTACATATGGTTAACAAGCCGAAAGTTCGCcgaaaatcaaat
gaaaacgtTTCCGCTGACCAAGCTTGCCTGcctaaaggttttgtttttac
gtaagtgttcccgtttcatatcagacacatatttcatatcaggacagtgt
ctgcctattgttatattatgctgttataagcaaaaaaatgttttcttttt
ccctTCCTGACCTCTGTCAAAGtcagcaaacgatatcactcttatttaaa
aacaaaacctttatttAAAATGATTCTGCGAGAAGTGTTTGGCAGATAAA
GTGCGAGCttggtttttccttttttaaagtGGCTGTTCCGCATCACTATC
CGAAGTTTTGTTATTCTGGCGCGTTTAATTGTTGAGCAATTTTCGGATTG
TTAACTGTAGCTATGGTGTTATTTTGAGAAACAGAACGAGATTAAGATTC
AGACCGGATTCAGAGCGCGAGatctcaggcaaattaaggcatATCCAAAT
TTaccttaattttttatcaccgtttccacttgtcatatcATATTACTTCA
TACGTCTAAAGAAGcgtattggagtgtagatcactggaatagctgtgcca
taaataattttttcacccaaaaaaaagatatcaggcaaaaaccaaaaaat
gctgacgtcagcaaaac
Run BLAST on NCBI

transcript from alignment at sc0000005:1314839..1330987+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000744 ID=TCONS_00000744|Name=TCONS_00000744|organism=Clytia hemisphaerica|type=transcript|length=16149bp|location=Sequence derived from alignment at sc0000005:1314839..1330987+ (Clytia hemisphaerica)
tttttggacaataatctgaaaattttattattgatgtttttaaaaGGTAG ATCATCAgtctttttgactgattttgactttcgattcatcattattatta ttaacccAATCCATGTCTAGGGAGTGGGAAAGGTGCTCTACTAGTTGGGA AAAGAAGATTTCTTTCGTATAATAAATCTAACAAATGTCATCATCATTAT GGTTAAGCTAAATGCTTTCTATTcatggaaagaaaattttaagttaaTTG TTGTGTGCAGTCGAAACCAAATACACATGTCTCCTCATAGCAACTTTAAT AAATAATCATCAGTCAGACAGAAAATAAGATTTAATGACTTTCCAGAAAA AGTATATATCGAGGAGCACTTAAAGAGAAATTTCGTTGTTATTATAGCTC TTTATGAGTGTTATTACGTTGTGTTAATCTGTATTACGTTACGAGGTCGA GTTGAGACTCTGTATTTATTCTTTATATGTGATCGTATGTGATGATTTTA ATGTTGCAATCATTTCTTTGAAATACATAGGTTTGCAACCTCTGCTTCTT GGTCATGCCTCATATGTTTCTTTTCAACCAAGTTGATCAATCAATCAACA ACCAATCTTCAAGATTGTCGAATTGGACCTGTTGTTGAATctgttttatt gtttcaaatatCTCATTTTTGTATTGTTTGCATTGTAAAACTATTTCTTT TATCTTCCTTTTCAGAGAATAATTTCATGAACTAATAAACAacaaattca ataaaaagaatataCAAAAATGGCAACCGAAAATGTCATCATCTCTGTCG ACGGTATGGTCTGTATGTCGTGCGTCAACAGTATACAAGACGTCATTTCA CAACGTGACGGTGTCACTTCTATCAAAGTTAGCCTAGAGGACGAAGAAGC AGNCAACGTGACGGTGTCACATCTATCAAAGTTAGCCTAGAGGACGAAGA AGCAGGTATAGTATACGACCCGACGATAACAACTGTCGCCGATTTAGTCA GTGCAATCGAGGATATGGGATTTGATGCTTGTGAGAAACCTGGCGACACA CAAGATGACAGCGTTAGTCTAGAGACTGTCCTTATTGATATCCAAGGCAT GAAATGTAATTCTTGCGTTAATAATATAGAAAACACTATAGGTGGACGAG AATCTGTGCATCAGATCAAAGTCTCATTGGAAGATAAAAATGCAACCATA GACTATGATTCATGTGTTGAATCACCAGAACAAATTTGTGACGCTATTTG TGAAATGGGATTTGatgcttttttgaaaaacaacaaTATGAAGACTGTTT TGTTAGCTATTGAAGGTATGACTTGTCAATCGTGTGTTAAAACTATCACA GAGGTTATGTCCAAGAAGGATGGTGTGAAAAATATCAACGTCTCTTTGGA GAAGAATAATGCTCTTATTGAGTATGATTCTGATAATGTCGATGTTTCAT TTCTATGTCAGAGTATTGAAGAAATGGGCTTTGATGCATACTTGGAATCA ACTAAACTTAAAGGTAACttctaaattatttttcattttttgtctcAGTA CACGTTTTGCGCCGATTTACTGTTGAAGGCTTTGGATATTACCctttagg ttccaaataaacgggggacctaattgccgggagGGTTggagaaaacccaa aaataaggtaaatataggctaaaatcaggctttttggagcaaaataaggg acttctttttgccaactgaaaatattcttaaaaattaataaaggtccggg gggttggaaaaattttcgaaaaattaacaagcggggagGTGTTTATTTGG AGTAAGAGCATTCATTcattaaagaagatttttaagTTCGGTGCTATCTT CATTAAGACTTTCATCATCAACATGTATTGCATGATACAAATCGTTGTCA GTGGTGTACAGAATAAATCAATATGCTAAACATACAGagggttttttgaa aagttaaagTTGGTACTCAATCTCCATGGCAAAATGTGCTTTTGTCTAAA CAAGAAAATACTTCTTCGCTTTGAAGAAAACTATTCTTTCTTGTTCGATG TATTTTCAATAGGATTTTAATTAAATTCCTCTCTCGATTACTCGAATACT CCATTTTAACATAAAAAATTATTCGAGCTAAAAGGAACCTAATGCAACAA AGAGAGAACTTGCGAATTTTGAGTAATTGCTATTTTTAGGGATTTATTTT CGATGGATTTCAGAACCATTGGAggatatataaaatttttgaggAAAAGT TTCAGAAGGATAATTATTTTAAGAGAAAAGTTTTGTGTCAAAATGTTTTG GGACTATACCCCCTCTTGGATATCACAACTGGTGGGGTcataaatgaaat ttttaatgataGAAAATATCAATTGATTCAGATTTATTCAAACTAGTACA AAATAGGgtataatttttaaaacctgAAATACCTCAATCTTTCTTTAGAA ATAAGAGCAggataagaataattttaaacCTCCTGATTTGATAATCGACG ATCGCAAATGTAGAACACATAGACTATTCATTGCGTGCGCTCTGTCTGAA AGTGGGACAAATTGTAATGTCGGTATTCAGTATGTGTGGTTTTTACATTA TGATAACCTCTCTATATTCACTGTTTTATCGTAGATTGaggaaaaaagat taaaaacaGCTTGATTTACTAAGTTTCTAACCTCTTCTTTTCTCTGTTTT TATTTAACACATTGCAATCGAAGCTGTAGCCGTTTTTAAAGTTGTGGTAG CAAACTTTTACTGCAAAACTTTTAAATGATGGTTTTTTCTTGACCTGATA AAGTTTACTCACCTATTTAAACATTTCTCTACGTTTTATACCattttact tactttttaaatgaaacaattttttgccAAGTTGAATCAATGTAAATTGA CAtacatagttttttttttcagtttgacTTGCTTTGTAGTTTAAAAAAGT GCTCAATGGTTTACTTAGTGATATTTTATAGGGAAAAGACTTACTTTAAT TACAATCAGCCTGTTTCAAAGGGATGAAGCTAGAAGTATTTTTGCCGACC ACCTTCAGCTTATGAAATTGCTACCCCTGTCTGCCCTCTCCCTGCTCTTA TACGAAACAAAATGCTGGATTTTATCTCCAAATTCTAAANCTCTCCCTGc tcttatacaaaacaaaatGCTGGATTTTATCTCCAAATTCTAAAATTTGT TGGATAAGATTAGAGAAAGGGGATTTTTTTCCCATCTGCTTCTTCACAGA TAAAGTTCTTATTTGAAGTATTATATTTCCTGCTAAAACTTTTAGTGTTT TTCACTTTATCTGGAAAGGAATAATTATTAGTGAAATGAAGTGGTTTTCT TTTTCCACCTCAAACggctgtttacatttttttcggaaaggtgTAAAATC TGTTGGGTAATAATTTAAGTACCCTTGACATCCGCAAGATGTATCTTTGC TCCTGGAAGGATAACTTATTGAACATGAATCATTGGCTAATTTGTGAAGT TATATGAAACGAAGACGAGAAAATTGATTCCATCAAGGATTGGACAACCT CGATCTGGTAATGAAATTTGATCTTAAATATATttcaagtatttaatttt tgatttttagaaacTTATTTATCCAATACATCACTCGATGATTTATCCGT CACTTACACCAAGAAAGGACTACCGTCAAACTCTCTCCGCCCTTCCCCGT TAACGCCATCACCAACACGCCTTCTGAATGTCTTGTCTCCTGGTATACAA GCCATGAGTGCAATTGATATGGAGGCGACAAAGAAAAGTTTCTTCCATGT GACTGGAATGTCGTGCTCCTCCTGTGTTGGCAAAATCGAACGAGAACTGA AGAAAAAGACAGGTATCAACAAATGATTCCCTCTCTACGATCGACTAAAT TTGAGCCTCTATTATTTAAAGTTTTCTGAATTTTGAATCCTTCCCCAATT CAAAGAAATTCTTGCTTTCTCGAAGATTGAGACTCAAGAGTCTTAAAATT CCATGGAGGTGGCTTTGTTCTTAGCTTCTTATTTAAAGATACCTGATGGT CTTTCAACCTTCAGATCAATTCACATATTCCGAAATTCTCCGGGAACCTT TTTTATCAATCCAGAAAAGTTCCAAGCATATCTCGATGAAATGAAGATCT TTGCTCGTACCTTAGATAACATAGGCTAACTGCTACACATTCCCTGGTGA TTTTTGAACGTTTGAACATTAGAATCGCGCTGTTGATGACCAGAAttaaa aacaagatggcggacttGTCAGCTCTAAAACTGGACACGCTTCCTTTAAT AGAAAAGGCtcgatccagtcaagtagttagtGGTCTGTACCTTCATATTT ATTATTTTCCAGGTGTGTACAATGTGACAGTCGGACTATTAGCGCAAAAA GCTGAAGTTCTTTATGACCCTGATGAAACCAACGAGGAGACGCTAAAGAA CCATATCGAAGCTCTTGGGTTTGGTGCAAGCGTATTACAAAATCACAACT TGAAAGAACGAACTGTTCAATTTGAGGTCAGTAAAGCTTTTTAAAATCGT AATGTAGGAAATTGTCCCTATAATCACTCATTAGTTCTGAAATTCTAATT AGGAAACGAAATTTACGGTAAAGTAAGGGAAGTCATAAAAACACAACTTC CTTGCTCACTTTCTCCACCCACGCTACTTCACTTTACTATTATATAATTA TgataattatgataattatGATAAGCTTGAAGATAGTGATCGAATATCGC CtgattgttttcaaatttttaagccttgaaaaaatggcttcaaattataA CATTATCAATTGTGATTTAAGGAACAAGTTAAGAGTTTTATGATGGAGAA TACTAAAGTATACAGGATGTCTGGCAAAAAGTATAATATCCAAACATTTA CTTaagtataatttttttgtaaattctcaataatgcaaaaaatatatata ctcACAGACATGTTTTGATGTTATACTTTTTTTCCAAACACCCTGTAAGG AATCAGCATAAATGCTACCGACCATCTCCCATTTTATTCATTGTTAAAGT ACTAAAGATTTTATCACATTAAATTATTGAAGTCTACTGAGTCTACTACT AATTTATTATTTCTTTGCTATTTAAGCCAGTGATCAACTTGTAGGTAACT CGGTTATAGATCTTATCGAAGttcttgattttttctaaaaaagcggtgca ttgtgggattgtttcggggtattacaatagaaatctcttaggaattcctc ggtggatttctattgtaatacccccgaaacaatcccacaatgcatcgctg ttttagaaagatcaaaaactccgataaggtctattattcTGTACTTTGCT AAATGTGCTCCCTTTTGTTCTTTTAGATATTTGGTTTTGAAAAAGGCGTC AGTTCTCTGTATCTGATTGAAAATAGTATCTTGAGACTGAATGGTATCCT GGATATTAGTATCCTTCAAGACGGTACCCATATCACCTGTACGTATGACC CGACCGAATGTGGACCGCGCGATATCAAAGATTCAATTGAGAAGTTGGGT TTCCAAGCTAGATTGGATACAAACCAAAAAGAAGATGACTTTCTGAGTCA TACGAAAGAAATTAATCAGTAagtattataattttttattcggAACGTAT TTTGGACCATTCAACCTAATCTTATTTTCGACCCAATATCATCGTCAGTT GAGCTCTAGTGTGAAGATGTGAACCGTTCTTTGAGCAGTTGAAAATGGTC TGGCTCCTTCCGCTAAGATACATAAATTTAGTGGTTATTAAATTgcatat tttttaaattctggaCTAtaactcaaaactttttttgaaattaaaaatcg tCGGGTCTGCGTTTTACACTTTGTTTGCAATACTGTACTTTTGGGGAGTA CAATTAACAATTACTTGTACTACTCAAAATCGTTTTCGACCAACTTAATT CGATGTTAGGTTGACGAGTATTCGATAATTCAGGTCATTGTGTgtgattt ttcttaattttcaactctcttttttaactctttttttcgTCAGATGGAAG AAATCGTTCTTATTCTCCTTGATCTTCGGCTTGCCGGTCCTGATCATCAC CTTTACATACATGGCATTGATGGCTTACGGTATCCATGATCTTCATGTCA TCCCTGGACTGTCCTTGGAAAATCTGGTGGTTTTTACACTGTGTTCCATT GTTCAGGTATGGGCGACAAAAAGTTATATCATATATATCATATGAGAAct tttttagaatttcaatGTAAAAGTTTTAACagactttctttgtatttggt GGGCGCTGGAGATCTTATCTAGAAGCTTCTTTTTTGTGATTcgttgaaaa ttttaacttctgAAGAAAACTAATTTATTTTTGGATCCACTGTGATTGCT GCACAATGACTTTTcctgtttttcataatttctcCTTGAAGAGGTGAAAA ATTTCACTACACGCAAACAAATGCCGAAATACTAACGCTGTTTGAAAGTT CTGGCATTCTAAGTCCAATTCTATAAGAAAGTATTGAAGAAAGGAAAAAG GACACTTCGTTGCTTGTTGAAAACTGGAGCAAAATAGACGAAAATGTTct ccaaatttcatttttatgtttctttcatttttttctcgatagATTCTTGG AGGTCGACGTTTCTATGTGTCAGCTTACAGATCATTAAGTCATGGAAGTG CAAACATGGATGTCTTAATTGCTTTGGCTACCACTGTCTCTTATGTTTAT TCTGTAAGTGCAAATCTTTTTCGGTCATCAACACTTTCAGGGGAGTCGTT TTAGGTCGTTAGCTCATTTCTACACTGCATTTGTTTGGTTTTTTCAATAT GGTGAAATTTAGTATCATAGTTGTGTTGTTTTGAGCAGCATAGTTTACGA ATCGATTTTTAACAGTACTTTATGAGTGCATTGTTTACTTGGTGTTCGTG CCTTTcgcgaaatttattttttgtaaaaacgaGAATAGACAATGTTGAGA TTTAAATTTAGATCTCATTGaactatttcatttttaaggttaTTGTTTTG GCCATCGCAATGGTTGAGAAACTTGACCACAGCCCAAAGACCTTCTTCGA GACACCACCAATGTTATTCACCTTCATCTCATTGGGAAGGTGGTTGGAAC ACATTGCTAAACGCAAAACGTCTGAAGCACTCAACCGACTGCTTTCATTA CAACCTACTGAAGCTCTTCTAGTCACCCTTGAGAAAGGAAGCATGCAGAT CTTAAGTGAGGAACAGATTGATGTTGCTCTTGTACAGACTGGTGATATTC TCTTGGTAAGGTTTTACTGGTCActtaaacttttatttttaatcttgaAA AGAAGGAACTTAGGTTAACTTAAGCTAGTTTTAGATTTAATCACTTTTGG GTCATATTCTTTCGAAGTTTGATCTTTGCTGTAATCACGAGAATTATGTT TTACTCGTGCACGAAATTTTGTTTCCCACGGGAGTCTCAACGTATTTCTG ATTCATTGAAGTAGAtcgataaagaataaaaagctcaaatctttcatttt taacatCTAAGGTGAAACCAGGTTCAAAAATCCCATGTGACGGTAAAGTC ATCTCTGGTCGTACTTCAGTCAACGAATCTCTGATTACCGGTGAAGCGAT GCCAGTCGTCAAAGAAGTTGGAGATTCTGTCATCGGTGGAACTGTCAACC AAGTTGGTGCTGTATTGATACAAGCTACTCATGTTGGACAAGATTCAGCG CTGTCACAGATCGTCAAATTGGTTGAAGATGCCCAAACCTCCAAAGTAAT GCTCATTTGCTTAACAGCGACTGTCTTTTGTATCTCTCTTGCAATCTATT CATCCATCATCCAAGGATTATATTGGTTTTGTTGTCGCAgttaactctcg ctaattcgaactcgaactgGAAGTctgatttgttcgaattacggTTTTAC GAAGGTTTTTTTACTGTTGTAGACTTAGTTTACATGAATACATTCACGAC ATTTTGCAATAATATCTCATCCTTCTCTGGTAATTTTACCTGTGATCACC AGGCAGTACAAAACAAAAACTCATGCTTTCACTGGCTTTTCTTAAATGTT TTAAGGTTTTTGAGGAGAGATTAACAAGACCGAGCTCCTGTGTTCCAATA AGCTCTTAGATAGCCCGAGCCCTTGAAACCCGTCAAAAGCAATCTAAAGA CTACCTTAAAGTCTTAGATTACTTGGCTATTAAAGATAAATATCGACTCT ATTATTCTTTCTATACCAGGCACCAATCCAGCGAGTAGCAGATACGATCG CAAGTGTGTTTGTCCCTATCATTGTCGTTCTATCGATGATAACACTTACT GTTTGGATTGTTATTGGTTACCAGTATTTCGAATGGGTACATACACACGA TCATGTAAGCATAACCAGAATAATGTTTTGTTTGGGATAGGTTTTTGGTC AAACTCTCCCGTCAGTAGCATTTTTTCAATGGCTAATTTATAAGGCATAG ATTGCAATTCCAGGCCATTCCGTATAATTCATGCAgatttgagaattttt cagtATGTGTTTTTAGAGTGGTTTGAATCGGATCTCGGCGAAAGCACATG CGATTTACACAAACTAGAATTCATTCAAACCTCTCTAAAAACACACTCTC AAATCTGTTTGTGAATAACTTGCTCATTATTTTCTCTTCTCTAGTCTTCA CTTCATGGCCACAATGAGATTATTATTCAGTTTGCATTCCGTTGCGCTAT CTCCGTTCTTTGTATTGCATGTCCATGTGCACTTGGTCTTGCAACGCCCA CTGCTGTCATGGTTGGAACGGGCGTTGGGGCGTTGAATGGAGTTCTTATC AAGGGTGGTGAACCATTGGAGCTGGCACATAAGGTGAGACTTAACCGAAT GAGTTTTAAATTTTCACTTATATTTGCATATAGATttggaatgttttgtt tttattttctaggACAATTTAGTTTCTTGAAAATATTGGCCAATCAAGTT AAAAGTTATggctcaaaaaacaaaaaacataaattttgaatttgtgtATG GTTTTATTTTAGATCAAAACAGTTGTGTTTGACAAGACGGGTACACTGAC CATTGGGAAGCCACAGGTTGTAGCTACAAANNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNGTCACTTAGTACCATcaagtactaactgattttt gaaaattttgtaggtataccaccacggtactaaccggcatgatgtcttgt actaactgcttgacccccccctggtTTGAAACATTTACACAAACTAGAAT TCATTCAAACCTCTCTAAAACACATTCTCAAATCTGTTTGTGAATAACTT GCTCATTATTTTCTCTTCTCTAGTCTTCACTTCATGGTCACAATGAGATC ATTATTCAGTTTGCATTTCGTTGCGCTATCTCCGTTCTTTGCATCGCTTG TCCATGTGCACTTGGTCTTGCAACGCCAACTGCTGTCATGGTTGGAACGG GCGTTGGGGCGTTGAATGGAATTCTTATCAAGGGTGGCGAACCATTGGAG CTGGCACATAAGGTGAGACTTAACCGAACGAAATTTGCATATAGATTtgg attgttttgtttttcttttctaggACAATTTAGTTTCTTGAAAATATTGG CCAATCAAGTTAAAAGTTAtggctcaaaaacaaaaaaacaaaattttgaa tttgtgtATGGTtttattgtagatcaaaacagTTGTGTTTGACAAGACGG GTACACTGACCATTGGGAAGCCACAGGTTGTagctacaaaaatttttgca gaGGGCCTTTCCCTTCAATGGAAAGAGTTCATGGCCATCGCTGGAACCGC CGAAATGAAAAGCGAACATCCATTGGGTATTGCTTTGAAGGATTACGTCA TCGAGGTAAAAGATTACATTACTTTTAAATCTACCCTTTCTAATAGTTGA ATTTCTATTATTGTCGATACTCGGGATATTCAAGGGTTTTCGAGATTATT AGGTACTCCAAACCGAGAAGACGACTATTTTTGTGTGAAATACAGAAATA CTCGACTGtttcaaacagaaaaaaataGGGAAAGtgattatatatatata atatatatccTTTGATCTTTCAGAACCTTGGATCCCACAGCCTTGGAGAT GCAGATGATTTTGAAGGGTTTCCAGGGAAAGGTTTGAAATGTACTGTCAC CAATATTGATATTTCCAATACTGCTCCCGACCAATCAACTGTCGATATAG AGGTCAGTGGAATACCTGTGGATAAAGTCAATGTACCTAAACCAAATATT GGTAAGACCTTTTGATCTTTtcatttctcaattttaaaggactaattttt gttgttttttgtgaaatttgccCCAAGCCATTGTCTAATCAGCTCAAATA ATTCACATCACGACTGAAATTCTAAAGTccataaaatttagaaaaacttg TAATTTTACTATTTACTATTATTTAAGAATTAGATTTACTTACTTTACTG TAATGACAACCACCTATATTTTCGCATTAGGTTCGATTCGATCAAAGAAG AGATACGAAGTTTTGATTGGTACACGCTTATTTATGTTCGACAACTCGAT TGTTATAAGTGATGACGTGGAACAGATCATGCAGTCTCATGAACGTCAAG GAAGGACTTCAGTCCTTATTGCTGTCGATAGTGAGTGTTTTCTGTGTTAT AAAACATCATCAATAGTGTATGTGTATGATAATACAAATAGTAGGGTAGA ACATTTTTCCGATCTAACGTTTGGCTCCTCCAGGTCATCATGTGGTGTTT AATAACGGCTACGTTTTCAGTAATAGAATATTGGCGATATGGAATTTGTG TTTCTTGGTTGGCCAACGCATAGTCCTGTCTGCCAAAGGATTTGGCATAA GATATTTTTACAAGTCTCGGGTGGAGATTTCACGTCCTGAATCAATTAAT GACTCATCAAACTAACTAAAAACCATGTTTTTTAATGGCTCTGTCGTTTG TTTCCTTAGATCATATCTGTGGTTTGGTTGCGTTTTCTGATTCAATCAAA GAGGACGCGCGTAAAGCGATCATCACGTTGAAGAAGATGGGAATGAAAGT CGTCATGTTAACAGGCGATAATGAGAAAACTGCAGAAGCGATCGGTAGAC AGGTAAGGCGGATGATTTTATTTCCTATCTCGAGTTGAAActacagtaga ctctcgctcactcaggggggggggtcatgcagttattatataaacactat gacaattactaccgtggtggtatagaaaccaaaatttgggaaaacagtta ctccaccagtggactaactgcaacatgggtggtgcctaagcccaaaattg tcgattttggtaggatatggtgtactNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaatttttcaatttttcac ttaaaattttaggtttttaaaaattccggaagcaaaaaaattcaaaacat ttttttcaaaagtcaaaaaaaaatcacaaaattatttcttcaatcaagac atgaaagatattttaacaaacttggatatttaactcttgaacggtcgttg ataagacgtacccagtaaaatggtatcaaaaatgaggaattcagtgaaaa aattgccaaatttggcatttttgggggtggtatacaccgattttgagggt aaaatcagttagtacactatggaataactgcaagggtggtggtgtctgta gaaaatgtccaaaattgcagttactccacatagtgtcaaggagtaactgc aagaccccccctgGCTCACTTGGACTTCTATCATTCCTATTCCTATTCCC CATCAAGGAGAAACCATCTTGATAAactttctataactcgaatctctctg taattcgaacaaatacgattccccgttcgagttcggATTAGCGAAAGTCA ACTGTATTAACTGCTGGTAGTGATACTTTAAGTCTGCAATATTTTCTTGC TAAATTTTTCAACCACTGAATCAATCCTGACAAAACTATATACTGTCGAG AAGATTCTGAGCACtataatttttaagaaaacacaatttttagaaaatgt ttcgTAATGAAAATGaagtagaaaaaaataattgtttATCTTTTGGTGCt tgaaacttaaattttggtatgaAAGTACTTGAGAGTTCTCAAAGAATTTC TTCGCTCAAGAACGACATTTTCTCTCAACCAGGTGAATGTGGATAAAATC TACGCCAAAGTGTTACCATCCAACAAAGTGGATAAGATCAAAATGTTTCA ACGTAACGGAGACGTCGTCGCCATGGTCGGTGACGGAATTAACGATTCAC CGGCCCTTGCGCAAGCTGATGTCGGTATCGCTGTCGGTACTGGTACTGAT GTCGCCGTGGAAGCAGCCGATGTCGTCTTGATTAAGGTATGAATGCAGAT TATATCTCAATAATATTCTCGAACCAAGGTGGTTGATAGGCCGGTTGGGG TTTTTAAAGTTTAATACTATACTCAAATTTGCTTGgggtttataaaaaat atcatcttTTGAATAAACCAGTTTCTGTGAAAACGTTATAGCTACGAACT TGATTTTGTAGCGTTTTTTAAATTTGCAGGAATATAAACTGATTGAACTC GTGAACCTGTTCACCCCCTCCCTGATGCTAAAAACTTattttggaaaagt tttttttttatctgggaaaccttaactttttattttacccAACTTTCTAG AACAACTTAATGGACGTAGTAGCTGCAATTGACTTGTCGAGGAAGACAGT acgcaaaatcaaaacaaatttcatttttgcaCTTATCTACAATTTGATTG GAATCCCGATAGCGGCAGGTGTTTTCATGCCCTTGAACTTCGTTTTGAAA CCGTGGATGGCGTCTGGTGCGATGGCTATGTCCTCCGTATCGGTTGTCTC TTCATCTCTATTGTTAAAAACGTAAGTTGTTTTACGAGTTTTCTGGTTCC TTTTGTAACATAACACGGTAATCAGTTTGATGGATTGATCCACTTGGCAT CACGcttgatgttttgtttcgacATTAACAAATCTAAATCTTTCTGCTTT TTGATTGGTAACATCCCATATCATACGTATGTGACTTGGCGTATAGAAAC TTTTGCCATTGTCATCTTCACTCTTACaaaatttcttacatttttcgTAT GTCTATTTCTGTACGTCTTCttgttcttcaattttcttgacTCTGtaact tagaagagctaaacttttTCATTCCCGGGGAAACATTACTGGCACATTTT CGGGAtctttttgctgtttttcagGTCTTGACCATTCCATTTCTCCTTTC CTTTCATTTCAGGTATAAGAAACCACAGTATGACGAAGACGGCTCACGAC TCTACGAAACATTCAAACAGAAGAAACGAAAAGTATTGAAGGCTTTCCAA CGTTCCTTTTATAAAGGTGGTAAAGTGGACAATCGGAGATCAAAACTCAG ATCGTATTCGGATAGTGAACACGGTTTATTGGATAGTGACCGCGAGGATT GACTAGATTGAAGAAGGATTGGTTGAAGGTTATGAGTGTGTCAGTGAGAT ATTGTTCTCATCCTGGTAGTGATTGCTTCGTTCAGAGATGGAATGTTTTG AGCATTTATTGACGATCTACCTCATAACCTCTTAGAAATTTGGCTCTGAG CAATATCGATGAGCAAGTGGTATGAATAACCTTCATCCCTATGTCACAGA CTGAAGTGATTTTATTGGTTTATTTGAGAATTATGATGTCATTCGTAATC AATAGAATGGTTTTGCATCATTTCCAACTTATCAATACTTACAAAATTGA AACGCGGTTTCGTACAGTAGATTAGTTTCATATTTAGAAATCAAGTCTTT GTCGTCAAGAAAAGTTCATTTGACTCCTTTGGTTGAGCAGTAAAGGAAAA TGAACCTTAATTTTTCTTGGACGAAAAAGAATTGTTGTGTTAACTGAACT TTTATACCCTACTGGTAAATAGAGTCTTTGGGTCGATGGTAATtcaaaat ttgagtcactgcaatGGCTGCAGTTCATAACATGCCACGAATTATacgtt gttgttttgtttttttgtttttttgtttttttgtttgttttttttcaatg tgaagAATCACCTTTTTGTATAATGAACTTTTCAAACCTGTCTTTCTCAA ACTGTTGGATATTTTTCGAGGTTTCTAtgttcaaatttgtttttgtaaag CCCAAAAGAGCTGCCGTAGTATTGTTTCCCATGGGATACAATACGACTTA GCCTGAGTATACAGAGtcgaaatttcagaaaatatataaattgcCACAGC atgcagtgctgcaaataacggccggtgactggtaattaccggtcattttg tagtttctacCGGCCAATCTGAAGTTCAATctttcattttgtccggttaa aattAAAGACTAGAAAGAGGCTTAGATAAATACTTAATAACGTTTCTTAA AAGAGGGatagattttgaattaataCATGTGTTTAGCCAATCTTAAGGTC ATTTCAGACTTTTCTAATGCCCAAATTATTTTCGTGACACTcaaaaaatt accggccaactgaaatttccttatttgcagcactggcATGTATTAATGCT ATTTCAAATAGTTATACACCAGTTGTAAGATATTTCCAAAGAGAATAACT TAAAAGATTGAAGATTTTCTACTGGTTCAAAATCATGACATCagactttt taaaatattttaacctTGCTCAGATTTTTTGCATCTTTGTAGGATAAAAA GCCCTTTGAAGTAGACCTAAAACGattcaaaaaccaaaaacaacaaaaat gatCTTATCCACGGTgctttcgagacagactttaaaacTTTAGAGCTTTT AGTCACAATACTGTTTTACAACCAACATAAAGAAACTGTTAGGTATAgac taggctgcacgcatcccctctgatatgatttgatataacaaaataaattc tggggatgcgcgcagcctagGTATAGACAGAtactaaatttgatttttac tgTATTGTAAATAGTAAGTAAGGATTGATTTTTTATTACGAATAATTAGT ATGATACTTTGGAATAGTCGCTGGCTCGACACGAAATAACATTTTTGTAT TTCTATCTATTTAACCAATTTCcaataatttttgctttttattcATGAAA TATAACtctaatatataaaatattgtcttAAAAATCATGTTTTCTGTTCA AAGTTAGTCTACAATAGAAAAAAACGAAGGCTTATTTACAATATGGTTCA TAAAAAATAGTGTTGAATTTATACCGTGGGTACGGGCATAGTACATATGG TTAACAAGCCGAAAGTTCGCcgaaaatcaaatgaaaacgtTTCCGCTGAC CAAGCTTGCCTGcctaaaggttttgtttttacgtaagtgttcccgtttca tatcagacacatatttcatatcaggacagtgtctgcctattgttatatta tgctgttataagcaaaaaaatgttttctttttccctTCCTGACCTCTGTC AAAGtcagcaaacgatatcactcttatttaaaaacaaaacctttatttAA AATGATTCTGCGAGAAGTGTTTGGCAGATAAAGTGCGAGCttggtttttc cttttttaaagtGGCTGTTCCGCATCACTATCCGAAGTTTTGTTATTCTG GCGCGTTTAATTGTTGAGCAATTTTCGGATTGTTAACTGTAGCTATGGTG TTATTTTGAGAAACAGAACGAGATTAAGATTCAGACCGGATTCAGAGCGC GAGatctcaggcaaattaaggcatATCCAAATTTaccttaattttttatc accgtttccacttgtcatatcATATTACTTCATACGTCTAAAGAAGcgta ttggagtgtagatcactggaatagctgtgccataaataattttttcaccc aaaaaaaagatatcaggcaaaaaccaaaaaatgctgacgtcagcaaaac
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000463XLOC_000463Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000744-exon-sc0000005-1491911889:1314839..1314884TCONS_00000744-exon-sc0000005-1491911889:1314839..1314884Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1314839..1314884TCONS_00000744-exon-sc0000005-1510915933:1314839..1314884Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1314839..1314884TCONS_00000744-exon-sc0000005-1575043694:1314839..1314884Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1315554..1316351TCONS_00000744-exon-sc0000005-1491911889:1315554..1316351Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1315554..1316351TCONS_00000744-exon-sc0000005-1510915933:1315554..1316351Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1315554..1316351TCONS_00000744-exon-sc0000005-1575043694:1315554..1316351Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1318449..1318700TCONS_00000744-exon-sc0000005-1491911889:1318449..1318700Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1318449..1318700TCONS_00000744-exon-sc0000005-1510915933:1318449..1318700Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1318449..1318700TCONS_00000744-exon-sc0000005-1575043694:1318449..1318700Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1319201..1319364TCONS_00000744-exon-sc0000005-1491911889:1319201..1319364Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1319201..1319364TCONS_00000744-exon-sc0000005-1510915933:1319201..1319364Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1319201..1319364TCONS_00000744-exon-sc0000005-1575043694:1319201..1319364Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1320215..1320456TCONS_00000744-exon-sc0000005-1491911889:1320215..1320456Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1320215..1320456TCONS_00000744-exon-sc0000005-1510915933:1320215..1320456Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1320215..1320456TCONS_00000744-exon-sc0000005-1575043694:1320215..1320456Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1320882..1321044TCONS_00000744-exon-sc0000005-1491911889:1320882..1321044Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1320882..1321044TCONS_00000744-exon-sc0000005-1510915933:1320882..1321044Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1320882..1321044TCONS_00000744-exon-sc0000005-1575043694:1320882..1321044Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1321481..1321591TCONS_00000744-exon-sc0000005-1491911889:1321481..1321591Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1321481..1321591TCONS_00000744-exon-sc0000005-1510915933:1321481..1321591Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1321481..1321591TCONS_00000744-exon-sc0000005-1575043694:1321481..1321591Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1321877..1322143TCONS_00000744-exon-sc0000005-1491911889:1321877..1322143Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1321877..1322143TCONS_00000744-exon-sc0000005-1510915933:1321877..1322143Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1321877..1322143TCONS_00000744-exon-sc0000005-1575043694:1321877..1322143Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1322400..1322633TCONS_00000744-exon-sc0000005-1491911889:1322400..1322633Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1322400..1322633TCONS_00000744-exon-sc0000005-1510915933:1322400..1322633Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1322400..1322633TCONS_00000744-exon-sc0000005-1575043694:1322400..1322633Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1323108..1323242TCONS_00000744-exon-sc0000005-1491911889:1323108..1323242Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1323108..1323242TCONS_00000744-exon-sc0000005-1510915933:1323108..1323242Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1323108..1323242TCONS_00000744-exon-sc0000005-1575043694:1323108..1323242Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1323533..1323721TCONS_00000744-exon-sc0000005-1491911889:1323533..1323721Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1323533..1323721TCONS_00000744-exon-sc0000005-1510915933:1323533..1323721Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1323533..1323721TCONS_00000744-exon-sc0000005-1575043694:1323533..1323721Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1324611..1324793TCONS_00000744-exon-sc0000005-1491911889:1324611..1324793Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1324611..1324793TCONS_00000744-exon-sc0000005-1510915933:1324611..1324793Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1324611..1324793TCONS_00000744-exon-sc0000005-1575043694:1324611..1324793Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1325012..1325189TCONS_00000744-exon-sc0000005-1491911889:1325012..1325189Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1325012..1325189TCONS_00000744-exon-sc0000005-1510915933:1325012..1325189Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1325012..1325189TCONS_00000744-exon-sc0000005-1575043694:1325012..1325189Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1325419..1325568TCONS_00000744-exon-sc0000005-1491911889:1325419..1325568Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1325419..1325568TCONS_00000744-exon-sc0000005-1510915933:1325419..1325568Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1325419..1325568TCONS_00000744-exon-sc0000005-1575043694:1325419..1325568Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1325898..1326040TCONS_00000744-exon-sc0000005-1491911889:1325898..1326040Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1325898..1326040TCONS_00000744-exon-sc0000005-1510915933:1325898..1326040Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1325898..1326040TCONS_00000744-exon-sc0000005-1575043694:1325898..1326040Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1327221..1327424TCONS_00000744-exon-sc0000005-1491911889:1327221..1327424Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1327221..1327424TCONS_00000744-exon-sc0000005-1510915933:1327221..1327424Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1327221..1327424TCONS_00000744-exon-sc0000005-1575043694:1327221..1327424Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1327739..1327959TCONS_00000744-exon-sc0000005-1491911889:1327739..1327959Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1327739..1327959TCONS_00000744-exon-sc0000005-1510915933:1327739..1327959Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1327739..1327959TCONS_00000744-exon-sc0000005-1575043694:1327739..1327959Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1491911889:1328351..1330987TCONS_00000744-exon-sc0000005-1491911889:1328351..1330987Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1510915933:1328351..1330987TCONS_00000744-exon-sc0000005-1510915933:1328351..1330987Clytia hemisphaericaexon
TCONS_00000744-exon-sc0000005-1575043694:1328351..1330987TCONS_00000744-exon-sc0000005-1575043694:1328351..1330987Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000005supercontigsc0000005:1314839..1330987 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.974191 0.636878 0.60074 2.40651e-07 6.76104 3.0339 3.81464 5.0583 5.46332 7.25567 4.37415 5.98913 6.31989 6.69727 6.16405 11.1818 8.57738 10.2681 5.26204 7.89288 10.5965 11.8092 5.78056 7.65263 3.11747 2.91995 5.75106 5.50371 4.7329 3.82297
Blast
BLAST of TCONS_00000744 vs. Swiss-Prot (Human)
Match: ATP7A (Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3)

HSP 1 Score: 1011.13 bits (2613), Expect = 0.000e+0
Identity = 582/1254 (46.41%), Postives = 778/1254 (62.04%), Query Frame = 1
Query:  244 GVTSIKVSLEDEEAGIVYDPTITTVADLVSAIEDMGFDACEK-------------------------------PGDTQDDSVSLETVLIDIQGMKCNSCVNNIENTIGGRESVHQIKVSLEDKNATIDYDSCVESPEQICDAICEMGFDAF-------------------LKNNNMKTV--------LLAIEGMTCQSCVKTITEVMSKKDGVKNINVSLEKNNALIEYDSDNVDVSFLCQSIEEMGFDAYLESTKLKETYLSNTSLDDLSVTYTKKGXXXXXXXXXXXXXXXXXXXXVLSPGIQAMSAIDMEATK---KSFFHVTGMSCSSCVGKIERELKKKTGVYNVTVGLLAQKAEVLYDPDETNEETLKNHIEALGFGASVLQNHNLKERTVQFEIFGFEKGVSSLYLIENSILRLNGILDISILQDGTHITCTYDPTECGPRDIKDSIEKLGFQARLDTNQKEDDFLSHTKEINQWKKSFLFSLIFGLPVLIITFTYMALMAYGIHDLH----------------------VIPGLSLENLVVFTLCSIVQILGGRRFYVSAYRSLSHGSANMDVLIALATTVSYVYSVIVLAIAMVEKLDHSPKTFFETPPMLFTFISLGRWLEHIAKRKTSEALNRLLSLQPTEALLVTLEKGSMQILSEEQIDVALVQTGDILLVKPGSKIPCDGKVISGRTSVNESLITGEAMPVVKEVGDSVIGGTVNQVGAVLIQATHVGQDSALSQIVKLVEDAQTSKAPIQRVADTIASVFVPIIVVLSMITLTVWIVIGYQYFEWVHTHDHSSLHGHN------EIIIQFAFRCAISVLCIACPCALGLATPTAVMVGTGVGALNGVLIKGGEPLELAHKIKTVVFDKTGTLTIGKPQVVATKIFAEGLSLQWKEFMAIAGTAEMKSEHPLGIALKDYVIENLGSHSLGDADDFEGFPGKGLKCTVTNID----------ISNTAPDQSTVDIEVSG--IPVDKVNVPKPNIGSIRSKKRYEVLIGTRLFMFDNSIVISDDVEQIMQSHERQGRTSVLIAVDNHICGLVAFSDSIKEDARKAIITLKKMGMKVVMLTGDNEKTAEAIGRQVNVDKIYAKVLPSNKVDKIKMFQRNGDVVAMVGDGINDSPALAQADVGIAVGTGTDVAVEAADVVLIKNNLMDVVAAIDLSRKTVRKIKTNFIFALIYNLIGIPIAAGVFMPLNFVLKPWXXXXXXXXXXXXXXXXXXXXKTYKKPQYD 3702
            GV  IKVSL+++EA IVY P + +V ++   IE MGF A  K                               P  T D   S  T +ID  GM C SCV+NIE+T+   + V  I VSLE+++A + Y++   +PE +  AI  +    +                   L+   +  V        ++ I+GMTC SCV++I  V+SKK GVK+I VSL  +N  +EYD        L  +IE+MGFDA L  T      ++  S +   +T T +                       + G+  +   D E  K   K +  VTGM+C+SCV  IER L+++ G+Y++ V L+A KAEV Y+P       +   I  LGFGA+V++N +  +  ++  + G     S ++ IE+S+ +  GIL  S+          YDP   GPRDI  +IE LGF+A L    +    L H +EI QW++SFL SL F +PV+ +   YM +M +    LH                      ++PGLS+ NL+ F LC  VQ  GG  FY+ AY++L H +ANMDVLI LATT+++ YS+I+L +AM E+   +P TFF+TPPMLF FI+LGRWLEHIAK KTSEAL +L+SLQ TEA +VTL+  ++ +LSEEQ+DV LVQ GDI+ V PG K P DG+VI G + V+ESLITGEAMPV K+ G +VI G++NQ G++LI ATHVG D+ LSQIVKLVE+AQTSKAPIQ+ AD ++  FVP IV +S+ TL VWIVIG+  FE V T+      G+N      E II+FAF+ +I+VLCIACPC+LGLATPTAVMVGTGVGA NG+LIKGGEPLE+AHK+K VVFDKTGT+T G P V   K+  E   +   + +AI GTAE  SEHPLG A+  Y  + L + +LG   DF+  PG G+ C VTNI+            N   + S V I+ S          +    I +  + ++Y+VLIG R +M  N +VI++DV   M  HER+GRT+VL+AVD+ +CGL+A +D++K +A  AI  LK MG++VV++TGDN KTA +I  QV + K++A+VLPS+KV K+K  Q  G  VAMVGDGINDSPALA A+VGIA+GTGTDVA+EAADVVLI+N+L+DVVA+IDLSR+TV++I+ NF+FALIYNL+GIPIAAGVFMP+  VL+PWM S AMA SSVSVV SSL LK Y+KP Y+
Sbjct:  198 GVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYTND---STATFIID--GMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVKYNASSVTPESLRKAIEAVSPGLYRVSITSEVESTSNSPSSSSLQKIPLNVVSQPLTQETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETLRGAIEDMGFDATLSDTNEPLVVIAQPSSEMPLLTSTNE---------------------FYTKGMTPVQ--DKEEGKNSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENADEGDGVLELVVRGM-TCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKKDRSASHLDHKREIRQWRRSFLVSLFFCIPVMGL-MIYMMVMDHHFATLHHNQNMSKEEMINLHSSMFLERQILPGLSVMNLLSFLLCVPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLIILLVAMYERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLDSDNI-LLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLICATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVFVSIATLLVWIVIGFLNFEIVETY----FPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLTESNRISHHKILAIVGTAESNSEHPLGTAITKYCKQELDTETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELCGLIAIADTVKPEAELAIHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRETVKRIRINFVFALIYNLVGIPIAAGVFMPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYE 1416          

HSP 2 Score: 114.005 bits (284), Expect = 6.270e-25
Identity = 125/448 (27.90%), Postives = 192/448 (42.86%), Query Frame = 1
Query:  241 DGVTSIKVSLEDEEAGIVYDPTITTVADLVSAIEDMGFDACEKPGDTQDDSVSLETVLIDIQGMKCNSCVNNIENTIGGRESVHQIKVSLEDKNATIDYDSCVESPEQICDAICEMGFD--------AFLKNNNM----KTVL-LAIEGMTCQSCVKTITEVMSKKDGVKNINVSLEKNNALIEYDSDNVDVSFLCQSIEEMGFDAYLESTKLKETYLSNTSLD--DLSVTYTKKGXXXXXXXXXXXXXXXXXXXXVLSPGIQAMSAIDMEATKKSFFHVTGMSCSSCVGKIERELKKKTGVYNVTVGLLAQKAEVLYDPDETNEETLKNHIEALGFG------------------ASVLQ-------NHNLKERTVQFEIFGFEKGVSSLYLIENSILRLNGILDISILQDGTHITCTYDPTECGPRDIKDSIEKLGFQARL-DTNQ 1461
            +GV  IKVSLE++ A I+YDP + T   L  AI+DMGFDA     D     V  +T+ + +         ++I++T+   + V  IK+  + +   +     + +  QI + + E+  D           ++++M    + VL + +EGMTC SC  TI   + K  GV+ I VSL+   A I Y    + V  + + IE MGF A++   K +  YL   ++D   L  T  K                        S G Q  S      +  +F  + GM C SCV  IE  L     V ++ V L  + A V Y+      E+L+  IEA+  G                  +S LQ       +  L + TV   I G     S +  IE  I +  G+  I +    ++ T  YDP    P  ++ +IE +GF A L DTN+
Sbjct:   34 NGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNPDPL--PVLTDTLFLTVTA-SLTLPWDHIQSTLLKTKGVTDIKIYPQKRTVAVTIIPSIVNANQIKELVPELSLDTGTLEKKSGACEDHSMAQAGEVVLKMKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFV---KKQPKYLKLGAIDVERLKNTPVKS-----------------------SEGSQQRSPSYTNDSTATFI-IDGMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVKYNASSVTPESLRKAIEAVSPGLYRVSITSEVESTSNSPSSSSLQKIPLNVVSQPLTQETV-INIDGMTCN-SCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETLRGAIEDMGFDATLSDTNE 449          

HSP 3 Score: 101.679 bits (252), Expect = 3.398e-21
Identity = 80/282 (28.37%), Postives = 126/282 (44.68%), Query Frame = 1
Query:  385 DDSVSLETVLIDIQGMKCNSCVNNIENTIGGRESVHQIKVSLEDKNATIDYDSCVESPEQICDAICEMGFDAFLKNNNMKTVLLAIEGMTCQSCVKT----ITEVMSKKDGVKNINVSLEKNNALIEYDSDNVDVSFLCQSIEEMGFDAYLESTKLKETYLSNTSLDDLSVTYTKKGXXXXXXXXXXXXXXXXXXXXVLSPGIQAMSAIDMEATKKSFFHVTGMSCSSCVGKIERELKKKTGVYNVTVGLLAQKAEVLYDPDETNEETLKNHIEALGFGASV 1218
            D S+ + +V I ++GM CNSCV  IE  IG    VH IKVSLE+KNATI YD  +++P+ + +AI +MGFDA + N +   VL     +T  + +      I   + K  GV +I +  +K    +      V+ + + + + E+  D      K       + + +D S+    +                     VL   ++ M+                  C SC   IE ++ K  GV  + V L  Q+A ++Y P   + E +K  IEA+GF A V
Sbjct:    2 DPSMGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNPDPLPVLTDTLFLTVTASLTLPWDHIQSTLLKTKGVTDIKIYPQKRTVAVTIIPSIVNANQIKELVPELSLDTGTLEKK-------SGACEDHSMAQAGE--------------------VVLKMKVEGMT------------------CHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFV 238          
The following BLAST results are available for this feature:
BLAST of TCONS_00000744 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ATP7A6.270e-2546.41Copper-transporting ATPase 1 OS=Homo sapiens GN=AT... [more]
back to top