Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000739 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000739
Unique NameTCONS_00000739
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1904

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000739 ID=TCONS_00000739|Name=TCONS_00000739|organism=Clytia hemisphaerica|type=transcript|length=1904bp
CGATAGAAGATTGAGCTCCAAAAATCTAATCTAAATCCTTCTATGATCAT
CCCTTATCGGTCTTTTTTTCATAATCAATCCCTGGTCTATTGAATACACA
agGGATCTCCTATGTGACTTGTGGACGGAGCCCTGTTGTCATTGTCCCAG
GAACAGGTGGAAACCAGTTACAAGCGAAACTTACAGGGAAACCATCCAAA
CCAGCATGGTATTGTTATTCCACAACAAGTTCTTACTTCACACTGTGGTT
GGATATCAAATCTTTGTTGCCCCCAGCTATCAATTGTTGGGTTGACAATA
TGAGACTTGATTGGAACATGAAGGATATGACGGTCGCCAATTCTCCTGGT
GTTTTGACAAGAACTTTCGATTTTGGTCAAACAACTTCATTCGAAACAGT
CGATACTTTAGGATTGATTAAATATATCAAACCGTTAGCTGATTACCTTG
AAACTCTTGGATATAAACGTGGAAAAGATATTCGTGGTGCTCCTTATGAT
TTCAGATACTCCCCAGATCGACAACCAGACCACTATCACCTTAAATTGAG
GGATCTGATCGAGGAAACCTATGTATCGAATGGGAATACACCTGTCACTT
TGTTATCTCACAGTTATGGATGTGCAATGAGTTTATACTTCTTATCCATA
CAAAGTCAAGCTtggaaatcaaaatatttgaaacaatgGATTCCAATGTC
AGGAGTGTTTGCCGGTACTAAACAGCAAGTCCAATTATATGCTGCTGGTC
TTTTAATGGGTGTTCCACAAGCTATTGTCAATCCTTTGACAATCCGTGGT
GAACAACGATCTAGTATCTCAAACCTTTACATGCTTCCTGCTGCTAAATT
CTGGTCTAAAAATGACGTGATTGCCAGAACCAAAAGTAAAACATACTATA
TTGGTGATATAGATCAGTTCTTGATCGACGTTGGTTTTCCACAAGGTGCT
ATCATGCGAAAACATATTGTCAATTCAACAGCTTTGATGGATTCTATCCC
TGGAATACCTATCCAATGTTTCTATGGCGTGATCAAGAAATCTACCGTGG
AGACTCTAGAATATGATGGTGGCTTTCCAGATAAATTTGCCAATCTGATA
ATGGGTGATGGAGATGGAACTGTGAATATCGAATCGTTGAGATTGTGTGG
TTCCTTCAAATCTAAACAAAATGAGTCAGTAACTGTCACTGAAGTTCCCA
ATGTTGACCATACGGCGATCATTAGTGATAAATCAGTTATGAGTAAGATC
GGACAGCTATTACAGGATTGAGATATTTTGATATCTTGAAATTAACGTGT
ATAGAATAGCATTATTTCTAAGAAAAGTTTAAAGGATAGTTTTTTGAAGG
TTTATTTGATGCTTAtaaaccctttaagtgccacggtcatttttttctaa
attttttaaaggaaatcactagttcaaactttaaaggcttataagCCTCC
GGATCTGGAAGGAGTTAgaccgctgcgcggacctgcctgaatgatagaaa
ggtgcccagtggtaaaacttcaaattaattcgctggaggacagaatcaag
taaagcaggaCCAAATTTGAAGGTTCTTAGATcgctcgttgaccaaaaat
tgtcaaaaaacggtcaaaatcttaaaaaagtggatttttgtcaaattttt
tgcatttttttgactttttggcttaaaatcttgctggaaagactcacttt
tgatttttgaatttgcttgaccatgaaggacaatccaattcctacgagtt
agaccaaaaatgacgatttctaactcgcCCTCTTACATAGCCCAtttctg
atatatacgacattggcacttaaagggttaatgttgagattgtaattttt
ttagaatataATTCAGTATCCCAGCTTGTTTGTTGTTTATATGTCAAAta
caac
Run BLAST on NCBI

transcript from alignment at sc0000005:1262942..1299191+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000739 ID=TCONS_00000739|Name=TCONS_00000739|organism=Clytia hemisphaerica|type=transcript|length=36250bp|location=Sequence derived from alignment at sc0000005:1262942..1299191+ (Clytia hemisphaerica)
CGATAGAAGATTGAGCTCCAAAAATCTAATCTAAATCCTTCTATGATCAT CCCTTATCGGTCTTTTTTTCATAATCAATCCCTGGTCTATTGAATACACA aggtgagattgggtaacttgcatctcAGTGGAGGCTAAGCGTATTTTTTT CTGCATACGGTTAGAAAAATCTTTAATGGTCAGAAAAATCTTAGCGATAC cgtttggaaaaatctttagacGTCGGAAAAATCTCTTATTAGTCGGAAAA GTCTAAAACTTAGAACTTTCGACATTTTCCTCCGCTCGTGAATTCCCGCG CTTTTGCAAAACGCTTTgtcagcaaaaaaacaaacaaacatggTATATAA CCAAgctatgtaaaaaaaaaaaaaaaacatacacaCAAAATATCTACTTG ATGGTAAAGAAGTTGGTTGCAGTTTTATTGTGAAGATCACGCTCCATCTC TCTATATTCAACTTCTTTATCATCAAGTAGATATGTTCTTCAGCAGCATA AcatttttagagttaatgtATAGTAAAAACTGAAGCTAACAAATCCAAAA TACAAACTCCATAGCCATACAAATATTGATAATTCGATGAGGTTTTGGGT GCGGTGATTGGCTAAAGTAAGGAAAATAGTTGCACCAAATCAAACGTTGG TCATAAACAATCCTGAACATTAGACCCAGCCTTGTCCCTGTGTATCCATT GCCTTATTTACGTTATTACGCAAGGGTTGTAGCACGAACGTGCAAAAGat atcattttatttgtaagaaaagcaattaaaaaaatttcattatacGCATA ggtcattatgacgtcatttgtcaattagttttttatatttatcaatTAAT GTCTCCCGTGAGCATTCGAGAGCTCCCATATCAGATCtcacttttcagct tttttcaCTCTCATTCAATAACATATCATAAGGCGTGAGTGCAGGTGAGT GTGGTATGAAGAGATCAGAATGTTTTCAAGAAATCATTGagcaaatttga aatcaatataAATCAAGTTTCGTACATCCAGTTTTGAACATTTACATTTA CATTGAACATTTGGAATCATTTTTACACATCACTTCACATTTGGCAGGCT GGTAAGCTAATATTTtctataatttattttttatatcaaGGTTTTGTCAa ctcaatttttctaaagtaaagtacatttcaatcaaatttgtaACTTATCA ACTTAGATCAATTtgtatcaattttatttttcagtttgaacatactTTCA ATATCGATCAATCATAAGTTACGAACACCTGTGTCCGATAATTCCACAAG GGTCGTACAGTATGCACGCTATGAGGGGGTAGGGGCTCTTCAAAAAGCAT ACAAAAGCGTGCGTGGGGGAGGGGGGAAGTGTTGAAATAACAAGTGTGGA TATACGTGtacgtttttttcaaattgtttttcccCTTCTGTTTTTAACCT TCTGTTTGAAAAATGCCGtctgcgaaattaagtccacaaaaatattcatt ccaTTAAAGTACCCGGAAAAATCTACTTATGTCGCTACTACCGTTATAAG TTTTAGATTGATATAAGATCGATAATTAATTGATATCAATTGGATCGATA TATTTTTAGTATCGATTGTTTGATTAGATTAATAAGATCGAATAGTAAAC AATATCATATGGGATcgatataattctacgataaatAATTTGATTGGATC GATGTaagatcgataagtaatccataaATAATCCTAACCAAAAAattctt gagtatcgatcccaCTCGACCCCTTATCAGAATCGATAATTAGTTTATTA TCGATCCAACCGCCTGGTTTCCTTTACCAATAAGTCACAATACCCAATAG TTATTTTGGAGAACACGACGGTCTaatgaataactaattactccacactt CAGTGGATGCAAGTAAAACAACCAACAAGCGGGAAATTAGATatttaatc tcatggttgattgaaattcgattgacgtttttgcttacgttaatttgtaa tttcccgcgaacttgtaatttctctcctagcttttgtaatttccctccta gattttgtaatttcccgcaaaagtgaaattttcttcgTTTGGAATATCAT CACGATTTTTGACTTTCTTACTAACTNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNga atactatccaattaaaactcgattcgcgtttctatgacttttttgagacc tctttttaaattttcagattgatttccagtgttaaattgacgtcttacag aattgttagaatttcaatccaaaccatgagattaaccaggaatcccatgc ttgtttNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNttgttttcgtgaaattc tggataaattaccctcggtcaaatttcgaaatgttttaaatttccctcgt tgcactcgggaaatttcaaaaaatttcaaaattgacctcaggaaattact agtacatatttatttataaataagttttcttcaaattagtaaGCTAAAAC ATTCTCCCAAATTAGCCATGTGATAACGCTGCAAATCTTCCCGCTTGACA TCCTATAAAGTATTAGCTTGAGTATTAGCATTTTATTTCTGTAATACGGA GCAGATAATCTACTGCCAATATGGGTGGTGGAGTAATTTAATATGCATAA CTGAGTCAATAGGTCCATCAGGACCATCCTTATATATAGGGACCATCCCT ATATTATAGTATATAATTATAGGGACTGTCCTTATATATAGGGATTGCCC TGATATATAGGGATTGCCCTTATACTTAAGGACCTTTTTCCCCACTGATC TTCATCTAATCTACTGGATCAGAAAAAAACCCAAACTAGTAAGCAGAGAT ATAGATATCTGTGTTTTCCGAGAGAATTGTGTGAAGCCTGGTTTACATCA AATGAAAAGTTGTGGTTGTCATTGAACCGCATGCACAAATAATAAATTAG TCTtactgaaaagaaatactagATGTAAAGCATGTTTTACGGTCCTTAAA TATAAGGAGCTCCCTAAAAAGAAGGACTGACTCTATAAAAGAAACATCGA AGGACATGAAAAGATTAGTTTACCCTAAGTAGACTTctcatttttaaaga gaaatttaTCATATAATTCGAATTTTCATCTATTTATCCTTTCCAAAATA TACAATTTCtctacaaaaatcaaaagaaatttttacatttAAATATGCCT GTTTATCaatgttgaaataaaaaaaaaaacataaataaagaATATAAACC AAAAGtttgaaatacaaaaaaaaatataaattttaaacCTTCATTACTAA TACACTGTACTAATACactgtaccaaattttacaGTAATTTTATATTGCC AACACTTGGTCTTTACATACACAGTATGTATTCCTAAAAAACTCAATGAA ATCTCAAGTATTAATATATTATGACATCTAAACATTGGGCAAGCACTATA ATTTTATCCTTGCCCAAAAAATATTGTTCCACATTTTTAAGTCTAAATGT TCTTAATAAAGGTAATGTTTCGTATATTTGATATTATTAAGTTATCTTTT ATAGTGTGTTGTTGTGCGGTGCGTGCATATAATAATTTAGAAAATACTCA AAACAAGGTTCAATAAAGAAACTTCAACCTTCAATACtgtcaaaaaaatg aaattttacagCTAGGATATCAATCAATTCTATCTTTTCGGAACAGATTT AAAgcattttacaaaaatataaacttttgGTATAGAAGGGAAACCCCTTT TTATTCTTACTGATGACACCAAATAATATAGGCATTCTCAGGTGTCTATT TTGGTATAAATAAAGCATAGGTTACATGAGATTTAATTTGGGAGATGAtt taaaagtaaatatcatgaaAGTTGCAACAATGCATTCAAAATATATCGTA AAAGTAGGATGTCGATAAAAACGAAATAAAGTTTGAATGTCGACCTTTTT CAAGATAACAATAATAATTAAAGCCAATAATAGGAGAAGACTCAAGGACT TAGTTAGTAGTTAGTATTATATCTAAATTAATGCAGCATTTTTGTGATTG TGTATAGTGAATGATCAGATATGATTTTTATAATGAACAAAATAATTACA ATAATATAATGAATTGagttaaaaaattgaactttgaGCTTTAAACATTT GGAGATGAAATTTAGATTGCTGTATAACTTAAAGTGTTGTTTCTTGGTCT GGAAATTGACTGTCTCTTATATTGATTTGCCACTCAGGGTTATATTCAAA ATCAATTGTCGAAGCTTTAATTGCTCGTTCATTACAATCAACACTATTTG CTTTTGTAGGACTTCGTAATGGTCCTCCTGTTTTATGGGAAGGCATAACT GGTAATGATATCTTCCTTTGTTTCAATGAATCTTTTGGTGCCAGGATTGA TGGCGCATTCAAAACATCATTCAAAAAGTCTATTTTGGTTCCTTGTGATG TGAAACTTGCATGTCTGTCTAGAGTGGATTTCTCTTCGACATTCTCCAGA TCTTCATTTGGCTCATTAGTTGGTAGACTTAACGAATTGACGTTTGACCT ACGCGATGACATATCAGTCATACCACTTTGGTAAGCTGAATCTCTAGCCA GTCTATCAATACTTGGTCTCCTGTAAACGACGGATGAGGAAGTACTAGGT GATCCTGCTGGTGAAAATTTACTAAAGTCTTTTGATCCACGTAAAGAATT CCTTTGAAACGGTGGTGTAGCATTCATAACAACGCCACTATCACGTGGAC TATGTGAATCTCTTTTACCAAATGCAGTTGTAACTGTCTTTTCATCAATA TCTCGTTGAAATGATTTTCGTTGTCCTTTTTCAGAGTTTGGAGGTGTGAT GAAAGGTGAAGAACGCCTCACACTTGTACGATCTGGTGGATCACTTCGTG AGGATGTTGGACGACTACTGGCACTTTCTTTCCTTCGACGTATGAAAGGT TTATAGGGNTGAATTGagttaaaaaattgaactttgaGCTTTAAACATTT GGAGATGAAATTTAGATTGCTGTATAACTTAAAGTGTTGTTTCTTGGTCT GGAAATTGACTGTCTCTTATATTGATTTGCCACTCAGGGTTATATTCAAA ATCAATTGTCGAAGCTTTAATTGCTCGTTCATTACAATCAACACTATTTG CTTTTGTAGGACTTCGTAATGGTCCTCCTGTTTTATGGGAAGGCATAACT GGTAATGATATCTTCCTTTGTTTCAATGAATCTTTTGGTGCCAGGATTGA TGGCGCATTCAAAACATCATTCAAAAAGTCTATTTTGGTTCCTTGTGATG TGAAACTTGCATGTCTGTCTAGAGTGGATTTCTCTTCGACATTCTCCAGA TCTTCATTTGGCTCATTAGTTGGTAGACTTAACGAATTGACGTTTGACCT ACGCGATGACATATCAGTCATACCACTTTGGTAAGCTGAATCTCTAGCCA GTCTATCAATACTTGGTCTCCTGTAAACGACGGATGAGGAAGTACTAGGT GATCCTGCTGGTGAAAATTTACTAAAGTCTTTTGATCCACGTAAAGAATT CCTTTGAAACGGTGGTGTAGCATTCATAACAACGCCACTATCACGTGGAC TATGTGAATCTCTTTTACCAAATGCAGTTGTAACTGTCTTTTCATCAATA TCTCGTTGAAATGATTTTCGTTGTCCTTTTTCAGAGTTTGGAGGTGTGAT GAAAGGTGAAGAACGCCTCACACTTGTACGATCTGGTGGATCACTTCGTG AGGATGTTGGACGACTACTGGCACTTTCTTTCCTTCGACGTATGAAAGGT TTATAGGGCTGGTTAAACGAATTCGTTTTATGGAAGTAGACTTCTTCTAT GCTGTATCGGGTTCTTGGACCGGCGCTATTTGGCCGTCGTAAACTTCCAC CCGACACCTTCTTTACAGGTGCTTCGCTTTTGTCTGTATTTGATGATTCG TCGAAGCTAGAAAGAAAGATATTGTTTGTAATGGTTGGTACTTTCTGGAC TTCTACAGGGTGTTTATTAAAAAGCGAAATCGATTATGATATagaagttg ttgttgttgttatatGCACCCTATATGAACTTGAAAACTTATTCTCCTCA ATGTAGTCGACTTATAACATGTCTTAGAATTTGAAACTTGTGAGAGCAAT CAAAGAATTGGTTAAAATTTGGTATTAATTTTGATTAAATCTTTTGAGCA TAGTTTGAGGCTATATTACAGTACTTACACAAACATTTTTCGACTTGCTT CTTTCCTCAGCACAAAGTCTACAGTCTCTGGTTCAACGTCCAATAGTTTC TTTAAAACTTTGTCATGAACTGTAGATGGAATCTAAGAACGAATGGATAT ACTTGAGATTTTAAAAGCAGTAGTTAGACCATGGCGTTTTAAACCTAAat ggtttagagggtttactttctgtttttctttctttatttttaacaaaatt cgACAGAAAGTCGACTGTCTAAATTCGATATGAGGTTTTCTCCGTTTCTC TTGACGTCAAAAGCTGTTTTCATTTAAATTGGGAAATTCATTACACGTAT TGAACGAAGACTTCATTGGTTATTATTCTGAGTCCCGAACCATCAAAATA AGCAACCTTCATTTTCTTCAATGAAACCTTCCTCTCGACATGGACTAAAT GGCAAGTCAAAATATTGCTGAAAAAACTTTGTTTGTTGAAATACCTCAAA AAGCTCTTCATTAAGTTCGATCATCCTCAGGACAACGTCAATTGCTGCTT TATTGTCTTCAGGGTTTAATATTTCTGCGGTACTTTGTGATGGTTTGTAT GgctatgaaataaaaaagatgaattCTTTTGCTCTAAAGTGATTTGCTAa tgcttttttaattttggcagtACTAAGGGGAGCTATTACTTTTGTATTTG CCCGTCATGACATCTGACGTTCGTTTTTGTCGATTGAAACGCTCGAAAGG CTTCTTTTAAAGAGTGTTTTTAATTCCAATTTTGTCGTGAATCTTTGAAA GAGTTTCCGTGTAGTTTCGCAACGATAATGAATCTTNCTTTTGTCTGTAT TTGATGATTCGTCGAAGCTAAAGAGAAAGATATTGTTTGTAATGGTTGGT ACTTTCTGGACTTCTACAGGGTGTTTATTAAAAAGCGAAATCGATTATGA TATagaagttgttgttgttgttatatGCACCCTATATGAACTTGAAAACT TATTCTCCTCAATGTAGTCGACTTATAACATGTCTTAGAATTTGAAACTT GTGAGAGCAATCAAAGAATTGGTTAAAATTTGGTATTAATTTTGATTAAA TCTTTTGAGCATAGTTTGAGNTCAAAAAATGCTGACCTTTAATCTATGAA GAATATTTGGTGCCATTAAGGTTGCCAGGTTCTTGGAATCCATCTTATTA CCAGAGATGAGATTACCATCATCATCTAAACTATCCATTGAATTCTCTGC TACTTTGTTCAGACATGCTAATGTTACTTCTAAAGTATCTCGATTGGCAG CGGGTAGTAATCGTACTAAATTGATAATTGCACTATTGATTGTTTCCTCG TCTTTCAATTCTTGAAAACaaagacaggaaaaaaattatgatcTTGATAA ACAGtgttcaaattttatttcagtcaaaaaatcagcaaatttGCTGTTTT AAGGAGCAAATTTGGTGTGTAAGATTTTTGATGAGAATTCTACTTTGAAT AATACCAGATGAGGGATTGTACGAAAAAAGTTACAAGCAATTCTTGTAGT CCTGGTTCCTGGTTTTAATGATAGcaacattttgactttttaaggAAAAG TAAACAAACAGCTTGCATGATGAAAAATCTAtataaacgtgtttttttat ttctcattttaattctttttaattggttaattttttgatgagaccGAAAA TGATCTCAATTGACTTACTCGCTACTGCTAAGAAAGCTGGGTACAAGTCA CGTGTCAGTAAAGGGTCAGGTAAACAGCgtagaaattctttgaaaatggc AGCCACATCGTGAGGATTGCTGTCTTCTGTGATAACGTCTGTATAACCAC TATCGAAATTTGCTTTCatctaaaaatacaaaacaGCCCAGTTGCCTTAA GTGTACTCAACCTACAGATATCATAATAATAAAAGGCCTAGATCTCCTTC GAAAGTCTGACCAGTTGACATTTGACATCAGCTGACTAATTTCCATGTTG CTTTCTATATTTTGTCGGATTTTCGCACGTTTCAagttcaaaacattcga atcgaacGTTTCAAGTTCAAAACATTCTATCCCCGTAGGGtgtataaaaa gattttttaggtTGGCACAGTGTACTTGCTGTACCCGGTGTGTCGTTACT GTAGGAATGCTGAGTTTCTAGATTAGTATAATTTACCTGTTTGACTCGCT TGTGTGATCCACCAGTCCTGAAAATACCAACTGTCGTCAACGCATGCGCA TTTATATATTCTACCGCTCTCAATATGACTTTTGGTACTTGAGGTTTCGG TGGTTGAAATTCTAATTCTTTGTCTAAAATGCAGACTGAAGATGCTGACG TAGATGATAAAGTTAAAGCTTCAATAAGTCGAGATTTTCGTCTATTCAAC GGGACTaaatcttcttcatcttcttctttcaaTGTATCAATAGTCCTTAA TCCTGATAAAGAAAAGTCTAAAAGTTCAGAATCACTCCCGTCGTTTGGGA CGGTCGGGTCACTCATTCGACGATGACTGTTTTTACGATATGTGTCCAAT AAATCGTCGTCATTTTCTGACGAGACGGTTGCTTTGTCGACGACATCTTC AACGTCGCCGTGATTGATGGAGCTATTATTGATTTTCTCCAATGCTATTT GATGTGCTTTTTCAACTGCTTTATCGTTTTCAATAACTTGTGATAGATCG ATGGAAAATACTGGGTTTTGTGGCTTTGCACCTGTAGGTTCGTAAAGAAG GGAAGATAATTAGCAAGGCTAGTCTAGCCTAAGGTTCAATAGAAAAATTG ATAGGACTTCCTAAGAGAGTGGCGAATTCTATACAAAACTACAGCAATTT GTTATATCTAGAGAGAAAGCGAATGATTTGGTTCCAAGGTTATACTACTA TTTTGATCAAATGGGTGTCATTTCAAGCACATTAGAGATAACTCTTACCT TGATTTTCAGCATGATGTTTCCTTTTACCAAATAATAGTTTCCATCTTCG TCTAACAACTGCGCTATGATTTTCTGAAAGGATTAAAAAAAGGTTAAGGA AAgatgaaatagaaatagaagAGGGAGTTATTGTCGtgactttttcttgt tttatcTTCTGTAAAagcaactttttgagtttatgtGCATCTTAAACAAA ACTGTTTCAAATAGTGTACATCAAAGTATTTTCTttagtgtattttgttt tttacaagGCTTCAGATTTAGAGTTCAAAAGAATCAGAGGCATATTCAcg accaaaaatcttttttcagatACAAACCCAAGAGCTATTAAGAGATAAAA AGAGATAGATACACATTTTATTCATTAGAAAGTCCAAGTCTATGCCATAA AATgctcttatttttaccattttgtgaatttttttttccattttttccat aTCCGttctagagtccgcaaagccttaaatgtttttaacttgtttttcaa tattttgctttgTCCATCAAaactatgttcttatatagtttgcttaAGAA ACGTGTATCAGCCCTCTGATAGCTGTCGGACTGGGTCCTTACCCCGAAGA GATAGGAATTAGAATATTGATATTAATTTTAAAAGGCAGTCAACAAGTAT ACAAGAATATGAAAGTAAATCATAATTAtcattttggctcaaatttcttt ttatgaTAAAAACATTCCAATTATGGGGTTGTCGTTATGTTACttcaatt aattaaaaaaaacgaatagtGATTGTAATTACGCATGAAATAAAAAACTT CTGTTGATGGAAGCATTCGTAAAGCATTTTTCTACAAAGCTTCTCTTAAG GAACGTGACTTGTAAATTTCAATGAGATTGAGCAATAATAGTTAAAGACT TAATATTTACTCTCACTTTTTTTCTGAACTAATCCAAATTCTATTGGTCT AGGAAGTTTTAATAAGGGATCCTGTGCAGCTATTTCCTGTATAGTTGAAA ACTACAAATAAGATAGAAAAAAACCTGACAAGACTCTCATAGTTAATAGA GCGACGTGACttataattttaaagaaaataagcaATATTGAATTGCTTGC GAAGATTTTTTGAAGCTTTAATCTAAAAAActtataatttaatttttctc agCTCAATATAATACCAGTGCAGGCctttgaaaattaaccatctgaggaa aatgttcctcccgcggaaaattcaaCAACAAGAgccttgttgtgcgccgg aaagtcaaaaactaaattttcctgataggGCGCCCTATTTCAACTTTGTC TCGCTACTTTGTTATCATTCCCAGTCCACTCTTGACGATATACGGACCTC AAGAAAATTAGATAGCATATTCATCAGACTGTTTGTTTTCGCCCTTCCCT TTATGAGCTTctgcgtggtgggcagaaaacaatcacgatctgatctcagg ttaattATTAGTGGATCGATGACGTTCGTGATTTTCTTATAGCTAATGGT TTGCGTCTTTTGTTTTATGATTAACAATTTTACACTACATCTAAATCCAC AGTTGTATAATTTTTAGGGTTACGTCATTACTAGAATAGTCAAACAAATT CCTCTTTAACGTAGAGCCTTTGAATATCAAGATTAATATGTTTGAATGAA AGTAATGAAAAAATggttaaataattccttttttgctttttttttgctca gaattcaGGAGGACAAATagatcttttcatttttttatcgtATTTAATGC TTAATAATCTTAAGCTATTAATTGATTCAGTAGGGGGTCAGTCATTTTGT TCTTGATTCGGAGTCTTATGATCTCTTAAGTATACTAGTTCCATGCAGAC ATAAATGACGACTTAGTGTAATTATGGGCCTATAAAAATGTTTATGAGGC TTCATCAAAATGCAAGGAAACCAAAAATAGAATGCCTGATTTAAATATTT CagatgttttgaaaagaaaaagtcattttcagcACTTTTGATTAAATCAT GAAGTCAATTCATTTCATTTGCCTTAAGTTTATGATgcttaaaaatatat aacattttATACTTTTGAGATGATTTTAAAAGATAACCAAAGATTATGAC ATTCAATTTCACGTTTCTCTATTACTCTTTTGTTCCTATAGAATTGGCCT GAAGAAGAAGAGTAAGTGAGAAATTAAATATTAAGTCTCATACGCTAGTT TGATAGTTTATGTAatcattgaaagttttaaaattgatataaaaggAGGA AATTAATTGAAGGTTTGATCTAAAGGCGATTTTGATTATATACGATCTAT TAAATTATGTTGAAGCTCTTATCGACCGGGTATGCAATGAGAGATATAAG ACttattttaacaatattttaaaagacGTACTACAGGAGCTCTTTAGGTC TTTAGGGCGTATGTCCAAGTGGCGTTTTCATCAGGGATTCTCACCCCTGC CtgtttcccgggggggggggggcctNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNCCGACCTACGGCATGTGCCACCCTT TAGGGTAGGTTTTTTGAGGTCCTCGAAATGCACTGCAAGGGTGTACTTTT AGAGGATTGTACTTTAAGGGTacatttttgggcaaaaatcaaaataatcg aGAGAGTCAAAAGCAGAATCAGTTCAATTCATTATATGTTCAGCCAAAAC TGTCCTGATAACTGTGTTTTTACTTTATAAAccccaaaatttatattttt gaccattttactGACAGACAAGGCTCagtttaaggaaaatttttccaagA CATTGTTCTATGCTACACTATAAAGGTTGGAAATTGGTGGTaagaatgca ctgtaagggtaccctTTTAACGATTaagagctgcactgtaagggtccgaa tTTGAAAGCCAAGTTTTGGGCGGCAtatgccgtcgtttagaaatccaGTG CCCCCGGTTTCTTTTCAGCAAATCTAAAGACGACCTGACTAAATTTGAAc ccaaacagaaaaaaaaaacagaggaACGCGCTCTATCTACGTGAAATGCA AAACTTGTCTATCTAGTTTTACAGCTAGATATTAAATAAAGATACTTCAG TATAGTTATTGATATACCTAGATTGTAGCAGAGTCTATCCTACTACACCT TTAAGAATAAGACGGCCTTAGCACGAACGAGGACGTACAACCGGATATCA AATAAGGATATTCGTATATTACAAGAGATGATAATacaaagcataaaaaa gaaggCGTTTGGAATTCCTGACATGATTGACAAAAAGTACACAATAATAA TATTTCCGCTGTTGAGTGACAGTCATTCCTTTATATGGAAACTTTCTTTA TTTAAAGACACGCATATCAAGAAAGCTCAGTTAATTAATCATAGACCCGG CATAAACATTCTTTCTTGAATTCTTTTTAAACTGACAAAATAATACACTC AAGTTTTTTAAAAGTGTTCTATCAgcaaaatgtttgttttttaatgtATA ATATGTCCTGCATGATAAGGGAGGGTTTTAAACGCCTCCTTTGCAAAATG CAAAACTTTGTCAACACAGGTTTCTAAATGGAGTTCTTTCAAACATAAAT ATTATGAATTCTAGGCGTATAGCATGCTGATATTTATTTGGAAGAGCAAA GTACTTGAATGAGATGTTAACGCCCTTTGAAATGTTAAGTATTTTGTCAA GTATGTTTAACTCGAAATCAAAGTTTTCTAAATTCTTTTGAATCTTTCAC AAATCATTTATAAAACGTTTGACATTTGACACTATTCATTATTGCTGACC CTTAACGTTAGATCGAACTTATAATCTTAACTCCTATTAAGGACAAAGTA AAGAAATTGCGTTGCAACATTGTTCATGCAACAGAAACCCACTTGAAAAA TTGGAATCCCTCTGTGAAATTACAGAGCGAAAAAAGGCAAAATtagaaac aaaattaaaaaagattacCGTACCTTTAGGGATGACCAGTTGACAATCTA AACATTTATCTTGTAAGAATTCCAACGAAACAGTTCTTAGTGCGTTTTGT TCAGTTTCATATAGCTTCGAAATGTTTGTATCTTCAAGTTTTATTATTCG TCCTGCAGCTGACTTCCAGCAACATGTTTGCtataatgataataaaaatt AGAGACATTTTTTCCAAGGACTTTGGGGTTTGATATCGTCTAAATCACTG ACCTCTACAAAaaagtataaggagcacgaatgaTTACTTAAGATAGTGGA TGCTAGCCTAGGGTTTTTCGAAATGGGATATTCGAAGAGAACTCTTTTGA GAAGTGATTTTTCCgaattatttgaaatttaagaTGTTTGAAAAGTGAAC TATTTTAAGGTGAATCTCATTCTTGCCATTAGTTAATGAActccttttca aattttattcttTACTATATTGAACTCGATGAATAGATGATGAATGATCA AGCAATATCTAGAAGTCTTTTATAAATATTATATCATTGATTGATGACAA GCAATTAAGCATTTAAGTTTGCTACCTATAGACGATAGGTGGGTCTTTTC TTTCACTCACTCGCTAACAAGCCTGCCCATTTTGTCTGCtattatgaaaa tgaaagatgTTTTAACCGCAAGGCTTAGTTTAGTGATTAGTAAGAACCAT ATACAGTTGATTTTATCTAATTTGACCtgtagagaaagattcgaattaca gagagaaattttaacccctttccagctgaggggaccaacatattagttcg aattacagagagatttgaatAATAAAAGGTCGAATTAGAGTGAGTTGACT CTAGTAATACTTATTTGAGGATTCAAAACccttacagaccagaattaagG TAATGTTTGgtataaaactttttaaagttaaCATTTGTGTACAATCTTTT ACAATTTGCCAATTCTCATCAATCCGTGTCAtgttagcctatactagacg tcacccgcgtttttttacgcaattaacgtctattccactttgcgactttt tcgaatgttttgagcccgggttttcgggctctaaactttcgattttttga cgtcacttttaaatttcgaagctcctgcagagCGAAAAAATCGactttgc gtcaaagcacttgaaagacttatattttcgaaaatcgtcattagtggaac tcactaagaaacgagatgaaaaatcccggtttttagtgaggtactCGCTA GTGTCGTGTAGGcacatttttcaaattcccgatcaaaatattttgatctg CCTATTTTTGATTGCCATATTCTCTCACTGACAGCCTTCTATGAATCATT GAATATTATCAATTCTTGATGTTTATCTCATTGATAAAAATCTATCAACT ATCGATCTTAGATTTTCAAGAATTTCGAATCTCTTGATAAATGTTTAAGA ATTAGTCATGAAAATACTCTGTTTCTCATTTTGACGTTGGATAGACGTCA ATTAGACGTGTTAtgacagctgaaaataataTGTATAGGAGAAAAAGAAA ctggaaaatttttaacaatgaCAATGTGATTAAACCCTTCAATCCCATCC CTTGTTACATATCAATTTCAATGAGGGTCTATGAGACGAAATCACCCATG AGATATTTAATACATTGTAGATATTTTGATACAGGGGTAGTTCAACAATT TGCAATAGTTTCCCATAAAACCTTCCTGTAACTTTATACCTTTCCAATAA CGTCAAAAACTTCCATGTGACATTGGTTATACTGGGGATGTATACTATTG AAACTGGTTTTTAATAATTTGATGTTGAGACAGGGGTGGTACAAATAATT AGAAAGAATGGACTTACCATCGGTTGCCATAGGGATGCACCTCCATTGGG TATAACTCTCGATCTTCTGTTACGCTTCTTTCGATATTTCGCTAAACCTT TTTTACGATGTTTCCTCTCATGGTGGTGACGATGACTATCATTTTGAGTG TCTTTTTTACTGTCTGTTCTTTGATGATGGTGGTTTCTATGGTGATTTGT AGAGTTCGTTTTTGATGGAGTTGAAGAGGAAGGAGATTCCGGTGTTTTGT TTGGTGAATTTGATGTGTTCATGAATTGATGGTTAGCTTCTAAAGTCACA ACTGTTGTCCTGACtaaatttcgaaagttttgtatggcagatgatttctt ttttgttttgcgTTCTGTTATCTCTGTTGCGGTTACTTCGCATACATTAG TTGGTGATAGATGGTCTATAGTATTTGATTGTGTCTCAATAAGACTGTTA CGGTTCTCATCTGATGATATGAATTTTAAAATCGTCCCTGATGGTGTCTC TATAGGTGGATAATCATTTGAGGTACATTTTGTGTCTTTTACGCATGCGT TAGTTGATGATGTATTGTTGTCACCACAAGtagttgtttgttgtttttca acAGTGATATCAACATTGAGTCCGAGTAAATTACGTCCGCCTCTCCGATT GGACATTTGTTCATTTGGTTGGTGGCTAACGAATAATGGACCGTCAGTGC CAACCGTATATTTATCAGAATAAACCATCAAAAGGAATAATTCACTTGAC TTGTATTATAATGGAGATAAAAAACCTTCATGTGTCGTTTGTTATCTTCC AActttaaatttttctcttttttcacgAATTTTCACGAAATTATTGATAA TCGCTCCGCACTCAGATTAACCATCAAAATCAAATGTAAATTGTATTTCC CTCAAAATTCCAACGTATCAGCATAAATTCAATCCAATTAATTTCAATTG AAATCTACTTTCTAATCATCActtgatttttaatttcaaatagttaaaaa ccaaaaatgccaaaaatcccTAAATGTCAAATTGCAGTCACTAATGAATA AACTCTCTTTTTTTCCTGAAATGAAAGTAGGTTTGATAAATATTGTAACC GTGTTGTCAAAAAATCTATTTactttagagaaaaaaaaatacctAAAACC ATATTACCTACTATACCTTATGCTCTCAGTTCAGTTTTATCAGTAAAATA TAGAttatagattaaaaaaaaatgggtTTGTTTTCTCTCTTCGTCTTGTA TACCTATCTACATACatcattttttttgttaatCAATTGTCCCATTGGCT ATTTTATTATAATATCTTATCATTTGTCGTATATGTAAGACGCTTATCAA ATCTTAAGCCGGTACCAATCGACAGAATATTTATGTCAAAACATAGGTAT AATTATAAAACCATGCTACAATGCAATAATTTAACGTAATCAATAAAAAT AATGACTTTGAAAAATTCACCAATCTTAtgatttttgtgtaatttttttC TGTGTGTAATAGAGTTATTCAACCTTTTTACTCCGTCGAATTCGGTAGCT TGCTGATAGATCTAAAACTAAAGtgttttacatttttatgtGCCCCATCT TGAGTCTTGCTGTTTTTGTTCTAAAGATAATTTATGATGTTTTTTTGAAC TGTTTCTCATCGCTTTTCTGTTATTTTTAAAGACCTAGTAGCCTCATGGT CATGTGGAGATTTTAGTGTATAGTTTTAATGTATAAGCTCTTCAAAAGGT TCATTAACCTTTATAATATTATCGTGTTTTTTTTACTCCAGTACGGTCCC ATTTGACCAAACTGATCACACAAATATTCATGAAAGCCATTTTGAATTCG TTCTTTTATTTATAGAAATctcaatttcgaatgttttgcttTTCTTAACC AATTCTAGCCTGGCTTTTCCCCTCCACAATAAACCCATGAGCCTTAAGAC CActttttgaacatctaaatttcaGTCATATTAAACCCAGATTCCAGATA AAGAGGCTCATTCATTTCACCAGCCATAAAAATGTGTTCCCTTGATAGAT CCAACAtgatttcaattaaaaaaccCTTTTATTCATCCtctggaaaaaaa aagaaattattttctaGGCTTAGCATTATTCAATTAAGACANACCTttgg aaataaaaagaaattattttctaGGCTTAGCATTATTCAATTAAGACAAA CATTATAAAAATCCTCCTACACTGTGTTGAAAAATGGGTGTAGCTTACCA CTTAAAGGTATAAAAGAAACCTCAATGTAGGAGTGCTTTGTACTAACTTG TttgtagaaaaaaattgactagAATTAAATAGGCAGTATGCTATTGTCTT TTTACAAATGCCATTAATCACTGGGTACTCTTTTATATCTCTCATTCAAa atgtgttttttataagaagccaGTATTTCTATCAGAAAATATTACTTCAA ATTTTATAAGTACTAAAGGTAGTGTAATATGAATTCTTCGTTGAAACACA CCAACATTGTTAACTCAGAGACTTTTATTGGTATCCAGTCAGCTTTGGTT AGACCAGTCAAGGTTGTCGAATTATATATTAAGTAGCGGTTGATTTTAAG TCGGGCTAGTGGAGAATTGATACAAGAATGTACAACGATCATTTACTTAg attatttatttgtttatagGGCTGTACAGGCAATCATTTGCTTTGTTATT ACacctctgtgtcacagacccggtaggacccCCAACCCAACTTGACAATT TGGTCAATACTTCATCTTCATTTGAACTAGAATTTATATCCTCGCGAGTT GAGATAAACAAGATGaataaaaacttttctacaAGCTCGCAGTGCTTGAT AGGCGATAAAAAGGCTTCATCGATTAAAAGTCGGTTTAAGTACGAGTGGA TATGTACGATGGTTATCACCCTATTTTAGCTATATTGGCATTAAAATTTC AGAAGCCTTACATACGAGCAGTAACAGTAAAAGAAAGCATTGCTAggttc tgttcttataaataacctAATAAATTAAATTACAATACCATTGTCATAGT AATGTATGACAAAAAAGTTCGTTTTGTCTTTTGATGAGGAAATATTAAGA TCTGGTAAAAGGAAATTACATATAAAGCATTAAGCAGAATGTTTTTCCTG CCATGTGCCATTCAGACACCCAATAAATCCCTGCTGGGTATTATAAAGGC TGTGTGAGAAAAACCTTTTCCTTACGGTACTGTCAGTCCGTATGAACATT TCCCGCTAGCCTttggtatccagactcaaaatttcaaaacttagcCATAC AATGCATTGAATTCCAAGCCCGGAGGGCTAGACCAATGAAGtagaagccg aaggctagaagtcaatctctttggtaggatgtgaagccaacaaatcctac caaagttgcgcggccttgagcggctcgcctggtttttacacaaatgacag attgaaattaaaaattatcgctaaatttcgaaaaaaatatcaatcgtaaa caaaggaattgctagattcaatctgtcgtaaaaaatacggcgcatttttt aaggcttcaccttttcttgcctgagaaaggttagtgattctactctagcc cttcgggctttaaactcaatgggctagactcgagactcctagatgtgaaa tgaagccacttgtttcccatccagaacgccccgcgtggtttttacacaaa cgccggatcgaaagtaaaatctatcgctagattttaaagaaatgcagtcc tcaaaaacaaaggaaccgctagatacaatctgtcgtcatgattgcggcac tctagcccttcgggctttaaaatcaatggcACAAAGTCATCCAGGTGAAC CAAAAACATcgagataaaaaaattcttaaagatTTCAAGTTTTAAGGCTA GTTTTGGATACGAGCTTTCTGTCATACTTTAACTATTAAATTATACGATC CTTCAAAATgcaaaattgagatttttttgagaATAACCCTCAGGCCATCC AATAAAACTTTCTTGTGAGctaattttaagcaaaatcaaaactttgaaag cagcaatgaaaaaaaattcatcttctaaaaaacaaatgaatatTCGCtca aagtattgaaaaattcaaaacagaccAGCCTCAACGAGAGTAAATAGTTT TCTATATTTTAATGTGACCAGACctaaaaatctcaagaaaacATAGCTAC GATTGTCCAAAAAATACAATTCTGTATgtgaagaaataaaaatttctgtc caactatattcactcaggagatttgggtggcagagcagtaCATgcatttt gtccttatttggGACTCGCCAGCACTGCGTTATATTAGATGCACTGAAAA TGCTCACACGCTTAAGTTTGCTTTTCTcttgttttcgaaaaaaaagcttt aataTGAAAATAGAAATCGGAACCCAGGATGGGTGGAACGTCCAATCGAC AAAGACAAAGATACAATATATTGAGATGTTGTATGTATGATGCTATTGTA TACAAATAGAAACGAAATGATTATCGTTATATATTGCTCTTCTCTTCTTG TAGGTGAGGTTATGCCTATTTCCATATGTGTGCATGGTCATGCTATGACC ACGATCGGGAAGCTGTATGTTGGTATCGGAGAGAATGTCAGGCAGTATAG GACGGTTCAAGACAAGTGATTTTCTCGACTGCTGATCATCAACATGAGTC CCTTNAATGTCAGGCAGTATAGGACGGTTTAAGACAAGTGATTTTCTCGA CTGCTGATCATCAACATGAGTCCCTTTCTGAAAAAGTGTAATGTCTTGTG ACGGTCAAAGACTTGTTTTTGGTAAATGAGGTACATTTGTTTCGTAATAC ATGATGCTTTTCGCTTTTGGCAggaaaaagttatatttttaacCAAAATA TGTACAAGGTATTTGTGATGTGTAGTCACTCGTACTGCAACTTCCTTTCC TTTCTTCTTCCTTTCTTTGCTTTTCGGATGTATGTATCGAAGTCCAACCA ACACGCCAACATCAGCAAAAAACAATACAGCACTTAATCTTCTTCTGAAG GAAATTGCAATGAATAAGAAATACAGTCATAAGTGTATCGTCGGAGACTT CAACTATAAAGATATCAATTGGGAAAATTGGTCAACTCTTCACGACGACA CAAAGGAAGACGAGCAATTTCTCAAAGCTTTAAGAGACTCCTTCTTTTAC CAACACGTCGATGAACCAACGAGAGCTAGAGGTACCTATACGCCATCACT TATTGACCTGAttctgacaaatgaaaaaagcCAGGTTAGCAACATATCCT ATCTTTCACCACTTCATAAAAGTGATCACAGTGTTCTATCATTTACGTTC GAATGTTACCTTGAAACAGAATGCATTATTGAAAACTATAACTACAATAN CAGAATGCATTATTGAAAACTATAACTATAATAAGGCAAATTTTGAAGCA ATGAAAGGACATCTCGAGAACTCTGACTGGGTTAGAGGTTTCCATCAAAA AGCAGGAAATGCAAACGTAAATGATTGCTGGAAGATGTTACGAGATAAAT TATTCGAGCTTAGGAATCGGTACGTTCCTCGTACGAAGGGAAAAATGCTT ACGGAAAAAGGGAAGTTTTGCATACGATCAAGATATTCAACAAagcttaa aagaaaaacgtcGCCTTCATCGCAAACGGATAAGATCAATAGGTACAACT TCGGAACAGAGAAATAGAGCTATTTATGCTACTGCAAGAAACAAGGTTAC AGGAAAGATTTagacgagaaagaagaagactaGAAAAACGAATTTgtggt caagcaaaaagaagCCCTAAGAAATTTTGGAAGCATATCCGGAACTCAAT GAAGACCAAATCGGGAGTTTCCCCTCTTCTCCTTGATCCAAATGATAAAT CATAACTTTGTTTTACTGATGAGGATAAAGCTGACATCCTACAGGATcag ttttgcagtgtttttacgAATGAACCTGCTGGATCACTACCTGAGTTTCC GTAGCATTCGATCTAACAATCGACATGGTCAGAAAGGAACTGAAAGGTTT GAATCCTAATAAATCGCTAGGACCTGATGAGATTCACCCAGTCACGCTGA AAAAGCTGGCCTTTTACATAGCCGGTCGTCCTTTACATACTATCATGGCC AAGTCCTTCGTAGAAAGTAAACTACACGATGATTGGAAGACTGCACATGT GTCCCCGATCTACAAGAagggaaaaaaaaaacttgccgAAAATTACAGGC CCGTTAGTTTAACATCAGTTGCGTGTAGAGTAATGGAAAGAATcctaaag aaacaaataatGGAACACCTCACGAATGAGAAATTGCTATCAAACAAACA ACATGGGTTCATGGGTAAGCGATCGACAGTGACACTATTACTTCACTACT TAGACAAATGTGCGGACTCGATATCCGTCGATAAGGTTGTTGAGGTAATC TATTTCGACTTCGCAAAGGCCTTTTACACCGTTCCACATCGCAGATTACT AAGAAAACTCGAAGCGTATGGTATCAGAGGAAGGGTACTTGGTTGGATGA AAGCATTTTTGTCCGATCGTTACCAATATGTGNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNGCAATGGAAAAGTGGTCTGATGACTGGTTGTTGA AATTCCATCCTGACAAGTGCCACGTGTTGACACTAGGGAAATTCTGGAAC ATTCAACATGCACATCCTTACGAGATCGCTGGCTCTGTCCTAGAACATGT CGATCAAGAGAAGGATCTTGGAGTGATTATTGATAGtgaattgaattttg aagaGCACATCTACACCAAGATCAAGAAGGCTAACTCGATCGTTGGATTG ATTAACAGAAGCTTTGACTTCCTTTTTCCCGAGATGCTCCGCacactttt cattgcatttgtgagACCTCACCTTGAGTACGCGCAAGCAGTTTGGTCTC CACGGCTGATGCAATTGAAAGTGTCCAACGTAGGGCCACAAGACTTGTCG GTGGTTATAGAAACCATTCATATGTAGAACGTTTACAAGTCATGTACCTA CCCAGCCTCAAGATCCGGCGTAAAATCGGGGACATGGTggaagtatataa acatcttaATGTCTATGATAAATCTTCCCTATGTCAGAAACTCGTTCTTC GAAATCGACCTCAACGTAAGCATAATCTTAGCATTAGCATTAGAGGATAC CAAACGAATTCACTTTACTATAGGAGCATCGATACTTGATACTTGGAACG GTTTGGCAACAAATGTTGTAAACGGACCGTCCgtagggaaattcaaacta gaattgACAAACCAATGGAATGATAatatctataaattgtaaagatgtaa gattgtttcatagaggtcaatagacctgagaaatacacttctataaatta aatttattaAGAAGAACATCAAATACTACGTTTAGGTAATATTCTCCCAT TTCCTATGGCTAGgatattttaaatgaattttaaagtGCAGTGGTTCTGa gctacacttttttttttttataagaaccagtaaatatttgttgaggctcg gctgttcttatttttttggcacttcgagcctcaaattgttcttatcctgt tcttatttttagggcaaatttggggGNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNTAAAACTCAGCAACTCCAGgctcaggattg ttcttaaattgttcttattttttggcatttttgagcctcattgttcttat aaaattgttctcataaaaaaaaaagtgtattgccTAATGGTAGGACTGAT AAAGTGTTTATATTTCGAAGCTATAATGTTTGAGTATTTATAAACAAGAA ACTGCGCGGGAGGTCACGTTTTCATGAATGACACACATTATGAATAAAAC AATGGAAACAATACATTAAACAAAAACGTGTCGAAATATCATAAAACTGT ATGCTGTATTTTAACACATGCTGCATAATTAGCTTCTcagtttcttttgt ttaaaatattttcaaatttatgaacattagataaaagATTTTGAGGAGAG CGCAGGGCCGCAGGTTGAAGCGCTTCTGCGCGTTCCTTTTTCGTGACTAA AATGGCTTCTCAAAAATCAATGGCGTTATTCCTTGGAATAATAGTGACAT TTTGCTCCAGTTTGAATGAAATGTATTTTACAGCTTCGGAGCTGAAGGAT TTGGTTAGTTTTGAACGGGACATTGGTGCTGAGTTCTTGGCTTACTATCA AAGGGAAACTGCACGTTTAGACCGATTGGAATGGTTTTTAAACGACGTAG AAATGCTTCATAACAGAGGGCTAACCAAAGATATTGTCATCTCAAACCCG CCCGATTCTTACAAGCtgcttaaaagatttttaacgGACTGGAAAGATTT GGATTGGATAAGAACCTCTGAAGAATCTTTACGACATTTTGAGGTTTTGA CACATTACCAGAAAGGTATAACTGGTTTCAAGGAAAGTAACGAACTGAGA GGTTCCCATCTTCTGCTTTTCAGACTCCAGGACACTTACAAACTAAGTGT GTCTGAAATGGTTTCTGGTTTGAGACAGCCTGCGCATGAGCTCTCTTACG ATGATATTCACGATATCGCTATGTATGCAAATCACTTTTGGATGTTTCAA CACGGTATAGAGTGGGCGTCTTATGTTACAAGACAGTTTGAAAATCTAGA AGTAGCTGATGATTTAACGCTAGGGCAATATACCCGATTGTCGGATATCT ATGATATTATATCATGGGGAAACTTTAAGCTTAGGAACTACTCTGAAGCT ATCAAAGCCAGTAAGAAAGCATTAAAGTTGGATAGAACTGGCAAACGTGC GATCAAACGCAAAGAAAATATCGGTTGGTATGAATCTTACTTAGTTAGTG GAATACACCCTGAAGGAACTGTGGAACCATCAAATGAAGATCCATTAAAC CGAACATTACAAGAGAAACGATGTCGACGTGAGGAGATTTTGGATCAGGA ATACGTGGATACGTTGTTCTGCAAGTACCACACTCCTCATCCTCAATTTT ACTTGAAACCTTTGAAACAGGAAAGAGTATACCATGAACCGCGCATCGAT TTATACCATGGTATATTAAGTGATTTCGAAGTCGACCATATCAAAGAATC GGCGAGAATGAAGTTACATTTCGCTCAAGTTTATGATGTAGATACGGGGA AGTTAAGAGTAGCCGAATACCGGACGAGTAAAAACACGTGGCTACATCCG TATAACGACAGCGTCGTTGCTCGAGTCATTAACAGAGTCGGAGCTCTTGG CAACTTGGATATGACGTATTCAGAACCTTTACAAGTCGCAAATTACGGAA TAGGTGGCAATTATGAGGCACATTATGATTTCGCAGAACCACCGCACGAT TCGAGTATCTTTGGTGCATACGACTTTGGAAATCGAATCGCAACTATGTT ATTCTATTTTGAGACAGTCGAACGAGGAGGTGACACAACCTTTATAAAAG TCCGACCGGGAATTTCAACGTCTGCTGTCAAAGGTTCGGGTGTTTTCTGG CATAATTTGAAGAAGAATGGAGAAGGTGATTTTGAAACGAAACATGCAGC GTGTCCAGTTCTTCTTGGTGAGAAATGGGTTTCCAATCTCTGGATACACG AACATGGCCAAGAGTTTAGACATCCATGTTCTTTGAACCCTGATGAATAA GAATACTGCAATGGACATAGTTTATTACATTCTTATATTTATAGTACCTC GATATTTgatattaatttttctttagtttttttttggttttccaGACTTT AACATTTATTTAAGCCCAGGTTTTGAGGAGGTTTTGCGAATATATACCGA TCAACGAGTAATCGTTTTAATATGTGGtattcaaaatataaattggGTGA CGTTCCACTATTCGATACCCTCCcatattcaataaaaaccaaTACCCCTT GAACTCCTTGAGAATCGAATTAGAGATCGTcaactgcatttttgaaaaac tccTTTGCAAAAGTTAACGCTCGCGAAATACAAAGATTTTGTGAACTTTC TTATATTCGTGAAAGTTTCTTTCCgtgaaagtaaattttatcCAATAAAC TTTGCGTATCATTTATTTTATAGAATATGTTGCTACCTTGATTAGCGAGA TTTATATTGTTCTAAGCTTAGCAAAAACCCTGTTACATTTTTGTTCATTG CTCagggatgaattttttttcgattcctgacttttaaattataaactttt aaactgTGTACATGTGTACATTAATATTTCGAAATAAAACCTAGACTAAG CTATAGTCTAAGAGGAaccactatctaagaaaaaagccgaagaaaattcg cataCGGATAGGAGTGGGCTATACAgggtgatttttcaaaaaatgtcaaa ctaaatttttttgaggtCTAAATTATAAGTGTAGACAGGATCAAAtagaa tttttgaacaaaaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA ATCAATCTTTTTCCATCTACCCAACTACCCAAATTATGTTGGAAATGAGA CACACAGTGATTGAATTCCGCTCAAATTTGGCACATTCACTTCTCAGGGA TAGAAATAAAGtatatcaaaacatttattcgagaaatataattttggaca ttttgggCGTAGCCCAAAGGCTTTACACAGGCAAAAAAGAGGAAGGCTTG ACTATAAAGGCGAGAAAACATTCTTTCCTGCTTAAATTTGGCACATTACC TCTTCAGGTGAAGATTTGTCAGTGTAAAttgtgaaatcttaaaattttta tttttcctacctAGAGGGAGTGACTTCTCGTCCTAAATATATGAAAACTG GACAACCTTTTATTTCTATGATCTCGAACAACagaaaatccatcaaaatt tatgtttgaATTGTAAGCACTTCTTTTATATCTGAAATAATGTAAATTCT CGTAGAACTGCCGACAATTTGCTCTATGTGATAAAAACACTTTCCTTAAT TTAGCACTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgta attatatgactgattttatttagGTTGCGCGCTCTTATCCTACGGCGGGG TATTATTTTGTAATACCCCGCTTGATTTGTAATACCCCGCTCCCGCCAAA AAATTTCTGATAATACGCCCTCTTTTCCGCCGTCCCGCCACAAACAAAAC GCAGTTTACAAATACGGAAACAACAAAACTGTTGAACCATTCAGGAGAAN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACATAATTTCACGCG CCGAGTAGTGTTCgaatttccaaaacattcgattatttttgacaacattc gatttttttaaaaacaaacacaaataTTTTGAAGATAGCCGTTCGACCAA AATCAAAGGaggaaaagtataaaaaaaatgtataaagATGACAACAAATT CGAGCTGTTGGATGATGATGTTATTATTCTTCTATTAtggcaaaattcta aaaacaaaaacacgaaCATTTGGATAAATGCACTTCGGAAATGGGCAAAG TCTCGTGGACTTGAGGAGAACGGGAGAACATATCCGAATACGAACCATAT AATTTGAACACTTCATTTGTGAccattttatgttttatgttttatgtttt atgtGGAGATACCCGAAGAAAGAGTATGGCACTGATTACGAACCTGACTC GCGGATAATAATGCAGGCGTCTTTGCAAAGGAGccgaaaatacaattttt atgaAGAATCTTCTTACCGATAATATTGTTTGAAAGTTTGGATAATGGAT NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATGGAA TGATTTGTGTTTTGAAGCAATACATCATATTTCTACAATACATCATAAAT TTTCTGTCTTAATTCTGGAATCCCCATTTCGGATAGCTCTTTATGAAATG ATAAAATTAGTCATATAATTATATATTTATATGAGTCTAATAGGGGGCCA GAAAAGGGGCTcccacattttttatatttaaaatatctcaaaaattcttt ttaatccTGCCTAGATATGCCATACGGAGctaaagaaaatttagtttgac atgatttgacgaaaaaaatgaaaatgaccctGTATAGCCCACTCCTAGTA ATACGAATCTTTTTTTCCGAAAAGAGTTTCAAGCCGGTGTCACAGTAAAT AAGTACtctagtagggggaattttgttcgattttttggaatcgcttgcct gttttgttagaagcacttgttatacatttttggaaagctaaggggtagag gaatcgaaattactatgtttccaattttttttcggacactttggtgtgat tttcggacaaatatgacggtctcagacAAAAATCATAGGGNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNtttttgcctgagaccgtcatatttgtccgaaaatca caccaaagtgtccgaaaaaaaattggaaacatagtaatttcgattcccct accccttagctttccaaaaaggtataacaagtgcttctaacaaaacagtc gagcgattttacaaaatgccctctacagTGTTTATTTCCGGGAAATATGT ACTCCCCAGTAtatatttcctaggaaattgaTACTCCCGGGAGTGCTCTT ATCCTAGGAAATAACGACTCCTTTGGGAAATAAGTACTTCCGGGAGTAta aatttcctaggaaataagCACGCCTAATTAAAAAAGCGCTCATTTATCAT AATTCTTAGCACCTCATGAATCCAGGAAACGTTTTGATTTCTCTGTTGAT GCTTATCTTTTCTAGTATGAGCGTATGTTTGAACGCTGTACTTGTATCTC AGCATGAAGTATGAaatcacggaaaaatgaaatagAAAGTGCTCACTTTG AGATCGGGAAATTTTTCATTACAGTACCTTGTATCTGACTTTTTTCTTGA TCGTTATGAAATTTTTAATGGATTGGTATGCCTTATTTGTCAATTTGAAA ACAAGAACAAGGGTAATTTGAACTTTTAAGTAGTTAGGAGTTTcgccatt ttcatttttttgccaaaaacctGTTCGTGACTAAAGTATTTGATTGAAGG CAAAATCAATATGGGAAATGAAAGANNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTATTTTCTGCTACaccggt agagtttgccagtcttcgccgtttcttcgaaactctaccGCCGATTTATT TTAACGACTGTAAACTCCGCGCGTATTGTATTTTCCCGccttactatcac tgtaacggacgataacatcgtctaatcTTTCCCTTTTTGGGTACATTTCC ATGTCATTCAAGAGAGGTAATATTATACTAGTTATAGCAAACAGTTTGAC CGGAACAAAATGGAGAGTATTAGGTACTTGCGGTTGGAAAAGACCCAGAT TCTAGGACCCAGACTCTAAGGATAATCGAAATCGATTTAAGTTTATTAAG TGGGGATGGATATACGATTGCATTTCATTGAGTTAGAAGCTTATAGAAGG TCAAAAATGTTAACGAATTTCGCTGAGaatcttaaaaactttcaaCTGGG AAATTTTGATAAATCATCACGAAAGAACGTGACTCAGCAACAAACATTAC CTGACCAACTATCTTCGTGTACAAGCTTCTAACGTTCTCGAATCTTTTGT TATGTAATTTTACACGTGATAAAAGAAGTTTATAATGACGTTTTACTTGT TTATTTGTGTGatcagttttcaaaatattttcccctATCAAACAGCagag aaaacagctgaaaaaatTCTGAATGTTATATGTTTAAAAGTGAAATGTAT ATTATGCAACGGTCACATTCACTATAAATTGATCAGATTTACTTCAGGGA CTGTTGTTAGATTTCTACATAAGTGTAACTATACACAATGAAGTTGGTAC TCTTATTTAACCTTCTGGTTCTAGGGATCTCCTATGTGACTTGTGGACGG AGCCCTGTTGTCATTGGTAAGTTTGAAATTGATGATATTTTGATATAAGG CATTTTTTACGAATCAGTTTAATACTAAAGGTTTTCTTACGTTTTAATCC AATTACATAGAATTTTGGGTATAAAATTCTGTTAGATGATGCACTTGCTA TTGATGCAATGTGATAACGTTTGTGCAAAGTTTTGGAGTCGAAATATCAA ATGGTTTGGGAGTTGTGGCCATATTCTGAagattactttaggcgtacaaa cttttgcgagcagaaacttttgcgaggtcgaaaaatcgcgaaatttacga catttactttcgcgaaactgaggaaaaaatgtttatcGCGTTCGTGAATA GCCctgttaaaaattttcaaagacatttactctcgcgaaaatggccaaaa ttcgcgaaaatcgttTCTATtcacgaaagtttgtacgcctaaagtagtaa TCAGCAGAATGGGGAGTCTTTAAATTTAAAAGTGAAATCTTAAATTAATA CGAGCCgtttaaaaaacactatttttaatCTACTTTTAGTCCCAGGAACA GGTGGAAACCAGTTACAAGCGAAACTTACAGGGAAACCATCCAAACCAGC ATGGTATTGTTATTCCACAACAAGTTCTTACTTCACACTGTGGTTGGATA TCAAATCTTTGTTGCCCCCAGCTATCAATTGTTGGGTTGACAATATGAGG TTAGAAATtacgcgttttttataagaacaaactatatatgaacataaggt ttcgatggccaaaatattaagaacaagttcagaatattttaaggctttat atACAGGCTCTAGAACACCCGATTTCTTCGGAAAATggaaatactcacaa aatggtgaaaatactAACATGTTATAAGAACATTCGTAGGGCTTGGAACT GAAAAAGCTAGAACATCCGAAtgcttcaaaacttttggatgttcttacaa aaacgtTTACATTTGCGGCATTTTTTGATAAGATCTGGTAGCTTACTTAG CGTAAAACGAGTTTTCTGAAAGTTGTAACCTGGAAAATTCGTGTTCATTA AGCACATTTACTGGGAGTTAGAAATAAGGAGTACTGTTATTTTTTGCCCG GTTCTAATCTCCTAGCAGATCCTGATCACTACGCGCTGGATCGTATACTC TCTAAATACCATGGCTGTGTAAGATGAGAATCTGCCAACGTTGGCGACAC CAAAAGAAACGTTGAtcataaacataaaaattaaaacccaATCACTTTTG TTCTCAAGCCAAAGGCAACGcggttttgaatattttggctgaacaaccag CACAGATCGCCCATATTCGCCACATCCCTTTAAAGCAGAGTGGTGTCCGC AGAATAGATTAAAACTTTGAGAtcgcaacgttgtttcaacattcatctaa aACTGAATGAACATTAATTTGGCGTTGGTTTGTAGTGAGTAGGTAAATAA GATCATCTTCAGACGTTACTGTTCCGtatcgttccgaaacgaaacggttc cgaaactaGTGTGaatgtcaaaattcgaaacgtcaaaaaagaagacgtta caaagtaaaacagatcgaaactattttcatcggaacggaactgcttcgtt ttcttgctccgaaacgttccaaaACCAATAcatatgaacactctcgatcc gtaacaGAAACCATACCGGAATGATACGAAACcataacgtctgaacatga CCTAAATGTTAACCctggtttattttattttatttctataGACTTGATTG GAACATGAAGGATATGACGGTCGCCAATTCTCCTGGTGTTTTGACAAGAA CTTTCGATTTTGGTCAAACAACTTCATTCGAAACAGTCGATACTTTAGGA TTGATTAAATATATCAAACCGTTAGCTGATTACCTTGAAACTCTTGGATA TAAACGTGGAAAAGATATTCGTGGTGCTCCTTATGATTTCAGATACTCCC CAGGTATGTGAAGTTCGTTCCCTAAAGTTTTGCAGAAAGTTTACAAAATC GACgatgtgaaaaagtgacccttagagaaacttttttttaacttcTCGTT GTTTTTCTACCCCTTAGAGGGGACTTGGGAAGTTCAAAAACCCTTTACCG TCCGCACTTTTACCGAGCCACCTAGGGTATTTTTGCCGAGGTATCCCCAG GGTTTCCTCTTACAACGATCTTATCCCCTTAAATCCTCTGTGACGATAAA ACTCAACATACAAGATTTTCTTCTTGAAATCCCAGTATTCCTATTTCCTT GGAAACTATTTTATTTGGGCTTAGGTTGGACTTCATTCAAAAGTAGCAGT TATTAATTTTATCCATTAAGGACTTTATTGCATCTAATTTGTTGAAAAGT AACCATAcgaaaaggttttcttttttctcaggAAAATGTCACTCACGACC ATTAACATTTACTCTACCGGAGCAAATTCATAGATTTTTTGATATAGAAA TCACTCCATTTGTCTTTAATTTTATTCTTTCGAATCTTCACTAGATCGAC AACCAGACCACTATCACCTTAAATTGAGGGATCTGATCGAGGAAACCTAT GTATCGAATGGGAATACACCTGTCACTTTGTTATCTCACAGTTATGGATG TGCAATGAGTTTATACTTCTTATCCATACAAAGTCAAGCTtggaaatcaa aatatttgaaacaatgGATTCCAATGTCAGGTCAGGATTCGAAGTAACTC GTCAATTTTCAGTGTATTTTAACTGTGATTGATACTGTGATAAATTTTTG GACAACCTCTTCTCCTCCAATTATACAACATGGGCGGCCACCCCTGAGAC ATGCCTTTGCTGCTCCTCACTACCTCACCACCTGCGCAGATTCTAATTTT TTCGTAAGGGTTGCAAAGTTTAAAATTCCGAACAATGTTACCATCAGAAC GGACCCCTCCTTTCttcattttgatgattttggatttttctCAAACTCTC CCTATATTTGGTATATTTACTATTATAGTGGAATATTTTGAGGTAGAATT CTTAATCCTTCCATTCATGTCTGATGCTTGTGGGATTTGATCGATCCATG TAGGTATGTGTCATTTAACTAATTATCGTTTCACATTTTAATCTTCAGGA GTGTTTGCCGGTACTAAACAGCAAGTCCAATTATATGCTGCTGGTCTTTT AATGGGTGTTCCACAAGCTATTGTCAATCCTTTGACAATCCGTGGTGAAC AACGATCTAGTATCTCAAACCTTTACATGCTTCCTGCTGCTAAATTCTGG TCTAAAAATGACGTGATTGCCAGAACCAAAAGTAAAACATACTATATTGG TGATATAGATCAGTTCTTGATCGACGTTGGTTTTCCACAAGGTGCTATCA TGCGAAAACATATTGTCAATTCAACAGCTTTGATGGATTCTATCCCTGGA ATACCTATCCAATGTTTCTATGGCGTGATCAAGAAATCTACCGTGGAGAC TCTAGAATATGATGGTGGCTTTCCAGATAAATTTGCCAATCTGATAATGG GTGATGGAGATGGAACTGTGAATATCGAATCGTTGAGATTGTGTGGTTCC TTCAAATCTAAACAAAATGAGTCAGTAACTGTCACTGAAGTTCCCAATGT TGACCATACGGCGATCATTAGTGATAAATCAGTTATGAGTAAGATCGGAC AGCTATTACAGGATTGAGATATTTTGATATCTTGAAATTAACGTGTATAG AATAGCATTATTTCTAAGAAAAGTTTAAAGGATAGTTTTTTGAAGGTTTA TTTGATGCTTAtaaaccctttaagtgccacggtcatttttttctaaattt tttaaaggaaatcactagttcaaactttaaaggcttataagCCTCCGGAT CTGGAAGGAGTTAgaccgctgcgcggacctgcctgaatgatagaaaggtg cccagtggtaaaacttcaaattaattcgctggaggacagaatcaagtaaa gcaggaCCAAATTTGAAGGTTCTTAGATcgctcgttgaccaaaaattgtc aaaaaacggtcaaaatcttaaaaaagtggatttttgtcaaattttttgca tttttttgactttttggcttaaaatcttgctggaaagactcacttttgat ttttgaatttgcttgaccatgaaggacaatccaattcctacgagttagac caaaaatgacgatttctaactcgcCCTCTTACATAGCCCAtttctgatat atacgacattggcacttaaagggttaatgttgagattgtaatttttttag aatataATTCAGTATCCCAGCTTGTTTGTTGTTTATATGTCAAAtacaac
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000462XLOC_000462Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000739-exon-sc0000005-1491911889:1262942..1263043TCONS_00000739-exon-sc0000005-1491911889:1262942..1263043Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1510915933:1262942..1263043TCONS_00000739-exon-sc0000005-1510915933:1262942..1263043Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1575043694:1262942..1263043TCONS_00000739-exon-sc0000005-1575043694:1262942..1263043Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1491911889:1294866..1294907TCONS_00000739-exon-sc0000005-1491911889:1294866..1294907Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1510915933:1294866..1294907TCONS_00000739-exon-sc0000005-1510915933:1294866..1294907Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1575043694:1294866..1294907TCONS_00000739-exon-sc0000005-1575043694:1294866..1294907Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1491911889:1295431..1295590TCONS_00000739-exon-sc0000005-1491911889:1295431..1295590Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1510915933:1295431..1295590TCONS_00000739-exon-sc0000005-1510915933:1295431..1295590Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1575043694:1295431..1295590TCONS_00000739-exon-sc0000005-1575043694:1295431..1295590Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1491911889:1296633..1296844TCONS_00000739-exon-sc0000005-1491911889:1296633..1296844Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1510915933:1296633..1296844TCONS_00000739-exon-sc0000005-1510915933:1296633..1296844Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1575043694:1296633..1296844TCONS_00000739-exon-sc0000005-1575043694:1296633..1296844Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1491911889:1297386..1297571TCONS_00000739-exon-sc0000005-1491911889:1297386..1297571Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1510915933:1297386..1297571TCONS_00000739-exon-sc0000005-1510915933:1297386..1297571Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1575043694:1297386..1297571TCONS_00000739-exon-sc0000005-1575043694:1297386..1297571Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1491911889:1297990..1299191TCONS_00000739-exon-sc0000005-1491911889:1297990..1299191Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1510915933:1297990..1299191TCONS_00000739-exon-sc0000005-1510915933:1297990..1299191Clytia hemisphaericaexon
TCONS_00000739-exon-sc0000005-1575043694:1297990..1299191TCONS_00000739-exon-sc0000005-1575043694:1297990..1299191Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000005supercontigsc0000005:1262942..1299191 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.846038 0.137663 0 0.434425 0.438205 0 2.35302 0.016908 2.35797 1.49556 0.0027449 3.0161 6.82633 4.66217 2.67369 8.70934 2.28193 4.18803 3.69322 1.60309 13.4608 16.1732 4.42585 4.65867 17.3065 16.149 2.31907 6.34124 38.6925 17.647
Blast
BLAST of TCONS_00000739 vs. Swiss-Prot (Human)
Match: PAG15 (Group XV phospholipase A2 OS=Homo sapiens GN=PLA2G15 PE=1 SV=2)

HSP 1 Score: 253.447 bits (646), Expect = 1.374e-76
Identity = 139/381 (36.48%), Postives = 223/381 (58.53%), Query Frame = 3
Query:  132 PVVIVPGTGGNQLQAKLTGKPSKPAWYCYSTTSSYFTLWLDIKSLLPPAINCWVDNMRLDWNMKDMTVANSPGVLTRTFDFGQTTSFETVD--TLGLIKYIKPLADYLETLGYKRGKDIRGAPYDFRYSPDRQPDHYHLKLRDLIEETYVSNGNTPVTLLSHSYGCAMSLYFLSIQSQAWKSKYLKQWIPMSGVFAGTKQQVQLYAAGLLMGVPQAIVNPLTIRGEQRSSISNLYMLPAAKFWSKNDVIARTKSKTYYIGDIDQFLIDVGFPQGAIMRKHIVNSTALMDSI--PGIPIQCFYGVIKKSTVETLEYDGGFPDKFANLIMGDGDGTVNIESLRLCGSFKSKQNESVTVTEVPNVDHTAIISDKSVMSKIGQLL 1262
            PVV+VPG  GNQL+AKL  KP+   + C   T SYFT+WL+++ LLP  I+CW+DN+RL +N          GV  R   FG+T S E +D     +  Y   + + L   GY RG+D+RGAPYD+R +P+     Y L LR++IEE Y   G  PV L++HS G   +LYFL  Q QAWK KY++ ++ +   + G  + +++ A+G    +P  ++ PL IR +QRS++S  ++LP    WS   V  +T +  Y + D  +F  D+GF  G +MR+   ++  L+++   PG+ + C YG     T ++  Y+  FPD+   +  GDGDGTVN++S   C +++S+Q   V + E+P  +H  ++++ + ++ + ++L
Sbjct:   39 PVVLVPGDLGNQLEAKLD-KPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNEN-GPYFLALREMIEEMYQLYGG-PVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIP--VIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQ---DTEGLVEATMPPGVQLHCLYGT-GVPTPDSFYYE-SFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVL 409          
The following BLAST results are available for this feature:
BLAST of TCONS_00000739 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PAG151.374e-7636.48Group XV phospholipase A2 OS=Homo sapiens GN=PLA2G... [more]
back to top