Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000728 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000728
Unique NameTCONS_00000728
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length6094

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000728 ID=TCONS_00000728|Name=TCONS_00000728|organism=Clytia hemisphaerica|type=transcript|length=6094bp
ATTTGTTTTCATAAACCAACACGATGAATAGATACAAAGGATAATATAAA
CCATACAAcacaaaaaaatcttgagtaatGGATCACCTTGTTCACGCTAT
AGTGTTTCTTACAATTCTAGTCAATTTCCCTTCATCTTCAGATGGGAAAA
CGGCTAATGCTGGTCCTTTCAAGATCGTCAATGGTAACAAAGTGACAGAT
TCTAAACTCATTTTTAAATCAACAAATCTGGATAATGATTTTTATATCGA
CCTCGATGTTTACGCTGGTCAAATTGATTTTTCAGAGAATATAGATTCAA
GTAATTCTGCACACCTCAAGATTCCATTTGGGACAGATATGAACATAACA
TTGCAAGACGATGCTCATCGATATTTTGAGTTGAAGCAATGCCAATGTGA
ATATACGTTCAAAGAGCAAGGTGGTTCTCAAGTCACCAATGGATGTCCCA
AAAATGGCTGCAGTTGTGAACATTTTGGTCGTGAGATTTACCGTAGTTTT
ACGAAATCAAATGCAGTTTATGATGTTGATATTCGTTATGGTGTTTCACC
AAATACGTTTAAAGTTCAGTTCAAGATTCAAGTTGGCCAGCAACCATTTA
CCTATGTTAGTATTGTACCAGATGCGATTATAGGATGCAATACTTACCGA
CTTCTAAAAGGATCCTATGTCACTTTAGATATTCAAAATCCCACAGGTCc
tttaaaatttgtcatcaaacAAGCCAGTGTTGAGAAGGTCTCTCAAACTT
TAGCCGTAGCGACATTCAATCATACTTTTCTCGATAGTGGTACATTCAGT
TTGGAAATTCTGCAATCGAATTCAAAGATTTGGAGTCTATCCGTCTCCAT
CGAACCAGTGAATTTACATGGTCTAATTGGACAATTAAATCGTGCCACGG
AAAAAAACATGACATTAGAAGTCGACCAATGTCTACGTTATAACCCTGGA
TCACCTAAATGGGCAGTTTATAAGCAAGGTAGTGAACTGGTTTACACAGG
ACCCTCTTTTACACATTATTTCGATAAAGTAGGTGCCAAAAGTGTCAATG
CCAATGTCAAATTTATTTACCCTTCCCAGCAAGTGGAGATAGTGTATATT
CAACTTTACGATCGAATCGAAGGactaaatgttactttaaattCGAGTGC
AGTCTGCAAAGGGAATTACGTAAATGTAGACTTATCTATTTCATCTGGCA
GCGCACCTCGACTGAAGTATAAAACCAAAACAAGCGTCAAAAAGGTTCTC
CCAGAAAACCCGTTCGCTCTACAAGTCAATAGTGTGGAGGAATCTGAACT
AATATTTTATGCGGAGAATCCAATATCCGAACAAACACTTGCACGAAATA
TAGAATACCTCGAAAACACTCATTCTGCTATTGTTGATCTACCAAATCAA
ATTTAtggtaaacgtggtgaaagtGTTTTGATTGCTGCAAATAGTATATC
TGGCTTGTATTGTGCATTCAAATACACATGGATAATCAACAGTATTGAAA
TAGATAGTCGGACTCAATCGAACCCCAATCACCCTCCGGTGCTAGATTAC
ACATTCGCAAGTGAAGGAACACACGCTGTTATCCTCAACATATACGGTCA
CGATGGCACTTCATTGATCTCCAGTGCTACTACCTCAGTAATCATTGAGG
AAGTCATTTCTTTCACATTGCCAGAGATTATCGAAGGAGTTATCGGTGAG
TTTATATCCATCAATGCATCATTTGTATCCAAGTCTACTAAATTATCATA
CAAATGGACCTCAATAGGATTAGCCAATGAAAATGATACTGGTTGGATCA
ACGACGTTACAAGTGTACAATCATTAGCTCTTCAGATCACTCAAGATCAA
CCCTTCATTTTGAAACTACATGTCAAAAACTCCATCTCTGAAATGACAGC
TAACGTAACTATAGCACCTAAACAACCAAGAAATGTTACTTTTAAACTGT
TGCATCAACAAAGATGTTTCATCCAGGGGCAACCTTTAACATGGTCACTT
CAAGTTAACGATACATACAATCTCAACGAAAAATTGGTTTGTCGTCTTGA
TCAAGAAACTTTACTGGACATCAACGCTGATCTACCAATTACCGTCTCTA
TTCAACCCAGCCAGCCAATCAACAAAGGCCGCTTAGAAATGACTTGCTTA
CTTAAAGACAACCCACAATATaatcaaactttcattttctaccTGATTGA
TAGAATAAACGTTAGTTTTACCAATGACCTTATGGCCGGTGAGAATCTGA
CCGGATCCATTAACAACCCCGTAGAGACCATTCCATACTCGTGGTACATA
CGTGAGCGAGATTCCTTATCTTCTGATTGGAGTAAAATTGCTGAGAATGT
CATCATTGAGCATTTGATCACAAAACCTGGTTTATACGAAGTGAGAGTTG
TCATTGATGATGATTTAGACGCGATCGATTGTTCAGTAGTTGAGCAATTT
ACTGTCAATATACCACTTGTTCTCAAAATCAATGGCAAAATTGTACAATC
AGGAAGTCATCATTTCGTTGGTACAAACACTGAACTTAATTTTTCGGCTG
CTGTAAATTTAGAAACAGAAGAACAATATTATATGACGTGGACTGACAGT
ACAGTAAGATACCCTGTTGACAAAGGTTTCGGACGAGACCGATACAATTT
TTATACATTTAAACAAGGTACTATTAAAGTTCAAGTTTCGGCAAAATTTA
ATAATGTGACTGCATCTGCTTTCGTTTTCGTATGGGTACAATTGGAAGTC
ACTGGAGTCAAGTTCTCATCGGAATATGGTAACCATTCAACCGACATTGA
AAATGTGATCAAAAGCCAAGAATCCTTCGCATTGACAGTAAAACCAATAC
CAGCCGATGCTGCCTTAGTAACAGGCATTCTGACGTGTCATTCCCTCAAA
AACCTGACTTTCtatcaaaataatcaaaccCTGGACAATCCATACCAGAT
TCCACTGCAATGGCCGTCTGGTGAAAACATCTTTGGTGAGGTTTCATGTA
AACTCGTTATTGGAAACTATATCAGTCAACTCACACGTCACATCACTTTT
TTCATCAACCCTGGCAATGCACCTGTATTGAGGATCTTAGACATTCTGAC
CTACACTAACAACAAACCAAATATTCAAGTCGAAGTCATCAACAATACCC
TTCCATCAAGTCTTTCCTGGTTTTACGGGCATATCAGATTATCACAATGT
TCAAACACAGTGCCACCATCAATGTCAAATCAAATCTTTAGCTGTACTGT
CGAGCTCAATAACAGTGCTGCTCGTCTATTGGTCAAAGTcgaaagtgaaa
acaaaaaggGTTACACCACAGATACAATCCTATATTCTATCAGATCTGCA
TCAATTTCACCAAGCATCATCCAAGTGGGCCATCCTACCAACATTTCGTT
GTTCATCAATGTTAGTGACGTGGATATCGATTTCAGATTCAAAGAGAACC
GTTCAACGTCTCGCCAAATTAGCATACAAGAACCACAAATCGGTACATAT
TCAATCAACATTACGTTGAAAAATCGAATCACATTGTACCAACTACAAAC
ACCGATTCAAGTTATTGATGCCAGCAATTTCACTTTAACTTCAAATCAAG
ATGGTACAATCTACACTGATAATATTCAAGTGGTAAACGGTGCACAGATA
GAATTCAGAATTAACAATTTCAACCCGAATGTTCAttacgtcatcaaagt
tgatgATGTAATACTACCAGCTCTGAATCTCCCAACATTCTCTCACTCAT
TTTCTCATATTGTCTCGTCATCCAAACCAATTATACTTAGCATAGATGCC
AGTTTAAATGGAGTTCTTGTCAAAGATCGACAATACCGAGTTATCTGCAT
TGCTCCCGTCAAGAACGCGTCTATTGAGCTGCCAACGAACTTTATACACC
TAAACTCTAGATATTCCTTCAACGTTACTTTCTCTGGGCAAAATGGTAAC
TGTTACATATCGCAATTCAAACAAAGTGATTGCATTAACCCATACAAAGA
TGTGACTGGATTTGAAATCGAACCATACGAAACATATTGCACAATCAACT
TCCATACTGAATCTACACACAAATGTTACAATNAACCCATACAAAGATGT
GACCGGATTTGAAATCGAACCATACGAAACATATTGCACAATCAACTTCC
ATACTGAATCTACACACAAATGTTACAATATCACAATTGAAGTTGGAAAC
ATGGCTGGTGTAAACACAGTCCATTGGTTTTACGAACCATTCCACCAAGT
ACCTCTTGTCATCGAATCAGTAAAACATGTGCAGAAAGGGCAAATCTCTC
ATGCTTCAATCAAGAACCCTATCCCAAATACAAAATACATTTGGTACCTT
ATTTCTCCATTGGATCCATCATTTTACAATGTCACATTGGGAGAATCACC
AGCAATTAACTTCACAATACCAGATGACCTCAAATTTGGTGAATATCAGA
TACAAGTAAAATCAATCTACAAAAATCAAGTCTTCATGACCAAAACTGTT
GTCAGCTCCATACTTATCTTACCCAATACATCAAACACTTTAAATTCAAC
ACTCAACGTACACCGTGCTAAGGAGGATAGTTTCATTTTAATCGAGCTTG
ACGTCACTAATTATTACGCTGGTTTGGATTATCGATGGAGTATATGTCGA
AAATCAGACATTTCGGAAGACTGTTCAGGGCCTTCTAAACATATTGGTAT
CAATAAAACATTATCTTATCCATTCCCTAAGAATTCCAGTGAAGGTGTTT
ACTTATTCACCGTTATTGGTACTGGAACAGACACGAAAAATCCTCTAATC
ACAGAACAAATTCGATATTCACATTGCAAACTTGATAATTTAACTATAAC
GCCCTCTGTAATGAAAAACGCCACCGAGCGGTATCGAAATCACGTGATGT
CCAAATGGTATTACAGTGAAATTGAAATCCCAACCAAATGTCCAGTCAAA
TATAAATGGTCGTTCCATTGTAAAGGTCTTGGACACCGGACATGTAATGA
TACGGAATTAATTCAACCGGAACTCTTAAAGGGCATGCAATTTATCGATA
ACCGCCCTGTGTTGGAACTTCCACCAAGAGCGTTCAAAGTTGGAACATAT
TTCATGTACATTACGGTTGTTGTAGGTAAATACTTTCCAGCTTCCTACGA
TTACCATGTTTATTTAACTGTCACATATTCGCCCTTAGTTCCGGTTATCT
CCGGTGGCTCTTTCCGTGTCATCGGAGACGAGAATGAGGCTTATTTAGAT
GCAACCGGTACCATAGATCCGGACGCTAATTTTGGTACCGTTGGTGATAT
AACATATAAATGGAATGTTTCTGATCAACATTGTTATGTCAATCTACGGA
ACTCGTCTATTCCGGTCAATGAATGGAGTCCGGAACATGGGAAGCTACGA
ATCAAACCGCAGTGTTTATCACCGAGTTTGAATAAAAGGGATGGGTATTG
GCATGAAGTCGAAGTAAAACGCATCGGACAATCCCGTGTGGAGAAAACAT
CGCAGCAGatcgTTGTCGTTGACGGAGCAGCGCCTCTCGTAGAAATCAAC
TGTTTAACTTGTCAAGCATACAAAACATTCAAGTACATACGTACTAAAGA
TATTAAGATGTCTGCTGACTGTACCAATTGTCAAGCCGTAGATGTTACGT
ACTCTTGGTCTATTGAAGGTGTAGACAATGGAAAACGAATTGTGCTAGAT
GAAACGACAGTCAAAAGCCCTTTACAATCTAAAGTTTTATTGTTAAGGGA
AAATGTATTGGATGGCAAACAATCGTATAAAGTCACAGTCGAAGCCCGTG
TTAAAGGATGGAATGCCGTCGGTTCAACAACTCTTGAGCTTCAAATGAAC
AAGAGCCCATCCGGAGGTGAATGTACTTTCACACCTGACGAAGGTGAAGC
TTTGACAACGTCATTCGAAATGTCATGTAAAAGATGGACTGATGAGGACA
ATAAAGAACAACCTCTCCTCTACTGGTTGGTGGTGGGAGAAGAAGAGACC
ATCTTCTTCAGAGGGATTCAGACACAAATACAAGAGCTTTTACCAGTAGG
AGACGGAGATGATTACACTCTACCTGTTCAAATTTGGGTTCAAG
Run BLAST on NCBI

transcript from alignment at sc0000005:969917..979457+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000728 ID=TCONS_00000728|Name=TCONS_00000728|organism=Clytia hemisphaerica|type=transcript|length=9541bp|location=Sequence derived from alignment at sc0000005:969917..979457+ (Clytia hemisphaerica)
ATTTGTTTTCATAAACCAACACGATGAATAGATACAAAGGATAATATAAA CCATACAAcacaaaaaaatcttgagtaatGGATCACCTTGTTCACGCTAT AGTGTTTCTTACAATTCTAGTCAATTTCCCTTCATCTTCAGATGGGAAAA CGGCTAATGCTGGTCCTTTCAAGATCGTCAATGGTAACAAAGTGACAGAT TCTAAACTCATTTTTAAATCAACAAATCTGGATAATGATTTTTATATCGA CCTCGATGTTTACGCTGGTCAAATTGATTTTTCAGAGAATATAGATTCAA GTAATTCTGCACACCTCAAGATTCCATTTGGGACAGATATGAACATAACA TTGCAAGACGATGCTCATCGATATTTTGAGTTGAAGCAATGCCAATGTGA ATATACGTTCAAAGAGCAAGGTGGTTCTCAAGTCACCAATGGATGTCCCA AAAATGGCTGCAGTTGTGAACATTTTGGTCGTGAGATTTACCGTAGTTTT ACGAAATCAAATGCAGTTTATGATGTTGATATTCGTTATGGTGTTTCACC AAATACGTTTAAAGTTCAGTTCAAGATTCAAGTTGGCCAGCAACCATTTA CCTATGTTAGTATTGTACCAGATGCGATTATAGGATGCAATACTTACCGA CTTCTAAAAGGATCCTATGTCACTTTAGATATTCAAAATCCCACAGGTCc tttaaaatttgtcatcaaacAAGCCAGTGTTGAGAAGGTCTCTCAAACTT TAGCCGTAGCGACATTCAATCATACTTTTCTCGATAGTGGTACATTCAGT TTGGAAATTCTGCAATCGAATTCAAAGATTTGGAGTCTATCCGTCTCCAT CGAACCAGTGAATTTACATGGTCTAATTGGACAATTAAATCGTGCCACGG AAAAAAACATGACATTAGAAGTCGACCAATGTCTACGTTATAACCCTGGA TCACCTAAATGGGCAGTTTATAAGCAAGGTAGTGAACTGGTTTACACAGG ACCCTCTTTTACACATTATTTCGATAAAGTAGGTGCCAAAAGTGTCAATG CCAATGTCAAATTTATTTACCCTTCCCAGCAAGTGGAGATAGTGTATATT CAACTTTACGATCGAATCGAAGGactaaatgttactttaaattCGAGTGC AGTCTGCAAAGGGAATTACGTAAATGTAGACTTATCTATTTCATCTGGCA GCGCACCTCGACTGAAGTATAAAACCAAAACAAGCGTCAAAAAGGTTCTC CCAGAAAACCCGTTCGCTCTACAAGTCAATAGTGTGGAGGAATCTGAACT AATATTTTATGCGGAGAATCCAATATCCGAACAAACACTTGCACGAAATA TAGAATACCTCGAAAACACTCATTCTGCTATTGTTGATCTACCAAATCAA ATTTAtggtaaacgtggtgaaagtGTTTTGATTGCTGCAAATAGTATATC TGGCTTGTATTGTGCATTCAAATACACATGGATAATCAACAGTATTGAAA TAGATAGTCGGACTCAATCGAACCCCAATCACCCTCCGGTGCTAGATTAC ACATTCGCAAGTGAAGGAACACACGCTGTTATCCTCAACATATACGGTCA CGATGGCACTTCATTGATCTCCAGTGCTACTACCTCAGTAATCATTGAGG AAGTCATTTCTTTCACATTGCCAGAGATTATCGAAGGAGTTATCGGTGAG TTTATATCCATCAATGCATCATTTGTATCCAAGTCTACTAAATTATCATA CAAATGGACCTCAATAGGATTAGCCAATGAAAATGATACTGGTTGGATCA ACGACGTTACAAGTGTACAATCATTAGCTCTTCAGATCACTCAAGATCAA CCCTTCATTTTGAAACTACATGTCAAAAACTCCATCTCTGAAATGACAGC TAACGTAACTATAGCACCTAAACAACCAAGAAATGTTACTTTTAAACTGT TGCATCAACAAAGATGTTTCATCCAGGGGCAACCTTTAACATGGTCACTT CAAGTTAACGATACATACAATCTCAACGAAAAATTGGTTTGTCGTCTTGA TCAAGAAACTTTACTGGACATCAACGCTGATCTACCAATTACCGTCTCTA TTCAACCCAGCCAGCCAATCAACAAAGGCCGCTTAGAAATGACTTGCTTA CTTAAAGACAACCCACAATATaatcaaactttcattttctaccTGATTGA TAGAATAAACGTTAGTTTTACCAATGACCTTATGGCCGGTGAGAATCTGA CCGGATCCATTAACAACCCCGTAGAGACCATTCCATACTCGTGGTACATA CGTGAGCGAGATTCCTTATCTTCTGATTGGAGTAAAATTGCTGAGAATGT CATCATTGAGCATTTGATCACAAAACCTGGTTTATACGAAGTGAGAGTTG TCATTGATGATGATTTAGACGCGATCGATTGTTCAGTAGTTGAGCAATTT ACTGTCAATATACCACTTGTTCTCAAAATCAATGGCAAAATTGTACAATC AGGAAGTCATCATTTCGTTGGTACAAACACTGAACTTAATTTTTCGGCTG CTGTAAATTTAGAAACAGAAGAACAATATTATATGACGTGGACTGACAGT ACAGTAAGATACCCTGTTGACAAAGGTTTCGGACGAGACCGATACAATTT TTATACATTTAAACAAGGTACTATTAAAGTTCAAGTTTCGGCAAAATTTA ATAATGTGACTGCATCTGCTTTCGTTTTCGTATGGGTACAATTGGAAGTC ACTGGAGTCAAGTTCTCATCGGAATATGGTAACCATTCAACCGACATTGA AAATGTGATCAAAAGCCAAGAATCCTTCGCATTGACAGTAAAACCAATAC CAGCCGATGCTGCCTTAGTAACAGGCATTCTGACGTGTCATTCCCTCAAA AACCTGACTTTCtatcaaaataatcaaaccCTGGACAATCCATACCAGAT TCCACTGCAATGGCCGTCTGGTGAAAACATCTTTGGTGAGGTTTCATGTA AACTCGTTATTGGAAACTATATCAGTCAACTCACACGTCACATCACTTTT TTCATCAACCCTGGCAATGCACCTGTATTGAGGATCTTAGACATTCTGAC CTACACTAACAACAAACCAAATATTCAAGTCGAAGTCATCAACAATACCC TTCCATCAAGTCTTTCCTGGTTTTACGGGCATATCAGATTATCACAATGT TCAAACACAGTGCCACCATCAATGTCAAATCAAATCTTTAGCTGTACTGT CGAGCTCAATAACAGTGCTGCTCGTCTATTGGTCAAAGTcgaaagtgaaa acaaaaaggGTTACACCACAGATACAATCCTATATTCTATCAGGTATGTT GATTTAATTCATTTTATAAAACGAACCTTTTTACGCCTACCCTTATTTGG GTCATTTTTTAGCTTGCGGTGAATCAAAGGCCAGCATATAATGGACTGAC GTCTACTAAGGGTCGGCATTAAAATGACCCATAAGGTAGTTTGGGATATT GTAACATTGATAAGCAGTTTAATGTGTAGAGAatcgatttttttcaaaat tatcaatttgttttcatttttggtaCGTAGAAATATGATTTGAAACTCGT GTCGATATTTGATATCAAAATTGTAACAATCTCTTTGTTCCAATCTCAGA TCTGCATCAATTTCACCAAGCATCATCCAAGTGGGCCATCCTACCAACAT TTCGTTGTTCATCAATGTTAGTGACGTGGATATCGATTTCAGATTCAAAG AGAACCGTTCAACGTCTCGCCAAATTAGCATACAAGAACCACAAATCGGT ACATATTCAATCAACATTACGTTGAAAAATCGAATCACATTGTACCAACT ACAAACACCGATTCAAGTTATTGATGCCAGCAATTTCACTTTAACTTCAA ATCAAGATGGTACAATCTACACTGATAATATTCAAGTGGTAAACGGTGCA CAGATAGAATTCAGAATTAACAATTTCAACCCGAATGTTCAttacgtcat caaagttgatgATGTAATACTACCAGCTCTGAATCTCCCAACATTCTCTC ACTCATTTTCTCATATTGTCTCGTCATCCAAACCAATTATACTTAGCATA GATGCCAGTTTAAATGGAGTTCTTGTCAAAGATCGACAATACCGAGTTAT CTGCATTGCTCCCGTCAAGAACGCGTCTATTGAGCTGCCAACGAACTTTA TACACCTAAACTCTAGGTAAGATGTTTCGTTTATGCTTATCGTTAAGTTT AAAATGTCTCTCTTTCTCAACATTTATCCTGCGATGATGACAAGGCCGTT CTCCCGTCCCCCAGGCAGAGctccaaattaaaaaatattggcaaaaaaaa aaaaaaaaatcgtaaCCGTAACCACTTATACCAATCGAAAATTATTAtat atataattattattatatCTACATTCCGTACAGTTCTTATATGCAAAGAA ATGACGGACTGTTCACAAAATGGACGTAACTTTTTTCTTAGCAAGCCCAC TGAAGGACATCTTTGGTTAAatatatgataaaaaattaggGCTAGTTCCC TGACATGCTTGGGTTCTTTTCTTTACATTATAAGTTTATAATAGTTGCCA CTTTCTCCTATCTCCGAGAGAATTCGAGAGATAAAAGAacttactttagg cgtacaaactttcgcgagcagaaactttcgcgattttcgcgaattttggc cttttcacgaaagtaaatgtatttgaaaattcttaatagGGTaagttcgc gaaagtttatgctcgcgaaaaattctcaaaaaagtggaaatctataaaaa cctcgaaatcgtaataaatatcgaattttcggcatatttctatcctttaa tgcctttttaaagtcgaagagcaaccgtctttatcagatttaaggaatat ttCTCACTTTTGAGGCAATTTTCATTCgacaattctcatttttatccaac gattcgcgaaagtttatgctcgcgaaaaacattttttcattaaattcgcg aaagtaaatgtcgtacatttcgcgatttttcgtcctcgcgaaagtttctg ctcgcgaaagtttgtacgcctaaagtacaaGTGACGCAATAAGCTTAAAG TTTAAGTAGTTTTAAACAGCCAAGTACAATTTTAACTCATTGATGTCCCA CTagcgaattttttttctctcaggAACGATATTTTCGGCTGCCGGTAGTT TTGATTGAGGACCTAATTCAAAAATCTGGCATGATTAAAAGATAGAGCtt tgaaagagctttccaactgTATTAAACATTAAGGATTTAGCTATCACCAA GGCCgaataatcttaaaaaaattgtttgccTTTTTGAGAACGTCAAGAAG TTAATGCACCTTTTCCATTCTAAAATCATATTTATTATACTTTTCCATTA TGATTTCTTTGATTATAGATATTCCTTCAACGTTACTTTCTCTGGGCAAA ATGGTAACTGTTACATATCGCAATTCAAACAAAGTGATTGCATTAACCCA TACAAAGATGTGACTGGATTTGAAATCGAACCATACGAAACATATTGCAC AATCAACTTCCATACTGAATCTACACACAAATGTTACAATNAACCCATAC AAAGATGTGACCGGATTTGAAATCGAACCATACGAAACATATTGCACAAT CAACTTCCATACTGAATCTACACACAAATGTTACAATATCACAATTGAAG TTGGAAACATGGCTGGTGTAAACACAGTCCATTGGTTTTACGAACCATTC CACCAAGTACCTCTTGTCATCGAATCAGTAAAACATGTGCAGAAAGGGCA AATCTCTCATGCTTCAATCAAGAACCCTATCCCAAATACAAAATACATTT GGTACCTTATTTCTCCATTGGATCCATCATTTTACAATGTCACATTGGGA GAATCACCAGCAATTAACTTCACAATACCAGATGACCTCAAATTTGGTGA ATATCAGATACAAGTAAAATCAATCTACAAAAATCAAGTCTTCATGACCA AAACTGTTGTCAGCTCCATACTTATCTTACCCAATACATCAAACACTTTA AATTCAACACTCAACGTACACCGTGCTAAGGAGGATAGTTTCATTTTAAT CGAGCTTGACGTCACTAATTATTACGCTGGTTTGGATTATCGATGGAGTA TATGTCGAAAATCAGACATTTCGGAAGACTGTTCAGGGCCTTCTAAACAT ATTGGTATCAATAAAACATTATCTTATCCATTCCCTAAGAATTCCAGTGA AGGTGTTTACTTATTCACCGTTATTGGTACTGGAACAGACACGAAAAATC CTCTAATCACAGAACAAATTCGATATTCACATTGCAAACTTGATAATTTA ACTATAACGCCCTCTGTAATGAAAAACGCCACCGAGCGGTATCGAAATCA CGTGATGTCCAAATGGTATTACAGTGAAATTGAAATCCCAACCAAATGTC CAGTCAAATATAAATGGTCGTTCCATTGTAAAGGTCTTGGACACCGGACA TGTAATGATACGGAATTAATTCAACCGGAACTCTTAAAGGGCATGCAATT TATCGATAACCGCCCTGTGTTGGAACTTCCACCAAGAGCGTTCAAAGTTG GAACATATTTCATGTACATTACGGTTGTTGTAGGTAAATACTTTCCAGCT TCCTACGATTACCATGTTTATTTAACTGTCACATATTCGCCCTTAGTTCC GGTTATCTCCGGTGGCTCTTTCCGTGTCATCGGAGACGAGAATGAGGCTT ATTTAGATGCAACCGGTACCATAGATCCGGACGCTAATTTTGGTACCGTT GGTGATATAACATATAAATGGAATGTTTCTGATCAACATTGTTATGTCAA TCTACGGAACTCGTCTATTCCGGTCAATGAATGGAGTCCGGAACATGGGA AGCTACGAATCAAACCGCAGTGTTTATCACCGAGTTTGAATAAAAGGGAT GGGTATTGGCATGAAGTCGAAGTAAAACGCATCGGACAATCCCGTGTGGA GAAAACATCGCAGCAGGTAATTGTCCTGTATTTACGgtttatttttttct ctatATGAGCTCTTATTTCTTAGTTTAGTAATTAATCTTAGCAATAAAAA GCGAATCTTTTTTCGATTTATTCTGGTGATCGTTGTTGTTATCGTACCGT AAGCCCTTTTTTAAAGAGTATATACACTGTATGAATTAGCAATTGCAAAG ATTTCActttggatttaatttcgtaAATCAGCCAAAAATCAGTTAAAACT GTCCTTGAAAAACGATTCACGTGGATATCGCGAATCAGCGATCTCACATT ATTATTTCGTGAGATTTATTCACGCGTGAACGGCTAGAATATATTGTGTA GTTGATATGCAGTCTTTTGAGATTATTTATGTAGGATAACGAAGAATTAC GTTAATTACGAAGAATCTTTAAACACTTTATTCCTTTGGAATTTCAATAC TAGCTTTCTCCAAAAGTCAACCtttatcatcaaaatctttttttttcaga tcgTTGTCGTTGACGGAGCAGCGCCTCTCGTAGAAATCAACTGTTTAACT TGTCAAGCATACAAAACATTCAAGTATATACGTACTAAAGATATTAAGAT GTCTGCTGACTGTACCAATTGTCAAGCCGTAGATGTTACGTACTCTTGGT CTATTGAAGGTGTAGACAATGGAAAACGAATTGTGCTAGATGAAACGACA GTCAAAAGCCCTTTACAATCTAAAGTTTTATTGTTAAGGGAAAATGTATT GGATGGCAAACAATCGTATAAAGTCACAGTCGAAGCCCGTGTTAAAGGTA TGTCTTAATAGTtgattttttgacaaatttcttttaaccAAAGACTCTTT TAATACGGGCGCCGCTATACACTTAGACTTCCACTTGGTTCTTTGATCAA CTTTTTACCTTTCCCCGGATCAACTAATGCCACATAAGGGAAGTTGGATA ACATTCTCTGATACAAGAGCGTGTGAAGATNCTTTTTCTCTATATGAGCT CTTATTTCTTAGTTTAGTAATTAATCTTAGCAATAAAAAGCGAATCTTTT TTCGATTCATTCTGGTGATTGTTATCGTACTGTAAGCCCTTTTTTAAAGA GTATATACACTGTATGAATTAGCAATTGCAAAGATTTCActgtggattta atttcgtaAATCAGCCAAAAATCAGTTAAAATGTCCTTGAAAAACGATTC ACGTGGATATCGCGAATCAGCGATCTCACATTATTTCGTGAAATTTATTC ACGCGTAAACGGCTAGAATATATTGTGTAGTTGATATGCAGGCTTTTAAG ATTATTTATGTAGGATTACAAAGAATTACGTTAATTGCGAAGAATCTTTA AACACTTTATTCCTTTGGAATTCCAATACTAGCTTTCTCCAAAAGTCAAC CtttatcatcaaaatctttttttttcagatcgTTGTCGTTGACGGAGCAG CGCCTCTCGTAGAAATCAACTGTTTAACTTGTCAAGCATACAAAACATTC AAGTACATACGTACTAAAGATATTAAGATGTCTGCTGACTGTACCAATTG TCAAGCCGTAGATGTTACGTACTCTTGGTCTATTGAAGGTGTAGACAATG GAAAACGAATTGTGCTAGATGAAACGACAGTCAAAAGCCCTTTACAATCT AAAGTTTTATTGTTAAGGGAAAATGTATTGGATGGCAAACAATCGTATAA AGTCACAGTCGAAGCCCGTGTTAAAGGTATGTCTTAATAGTtgatttttt gacaaatttcttttaaccAAAGACTCTTTTAATACGGGCGCCGCTATACA CTTAGACTTCCACTTGGTTCTTTGATCAACTTTGTACCTTTCCCCGGATC AACTAATGCCACATAAGGGAAGTTGGATAACATTCTCTGATACAAGAGCG TGTGAAGATATGCCTGGCTCTTGATGTGGTTACTATAATGCTTATCAGGT TCAACCAGGCGAGGGCGCACTTTCCTATCGAGTGTAGTGTAGCTTCGAGT CCGTTAAGCGCAGTGAGTTCCCTAAGCGCAGCGAGTTCCCTATCTTAGGA TGTGAATGCTGTTTTGGAATAAAAGtgagcatgttaagaacaatatcaga acattttagaTTGAAAATCATGACAGAATAAGCCTAATTTTACTATTTCT CATTAAAATTCgatataatatatatattttcacgATATGATATATGCAAA TTAACGTCGTCTTATCAAAACGGTATCTGTATCCCTTTTCCTAATCTTGC CAGGATGGAATGCCGTCGGTTCAACAACTCTTGAGCTTCAAATGAACAAG AGCCCATCCGGAGGTGAATGTACTTTCACACCTGACGAAGGTGAAGCTTT GACAACGTCATTCGAAATGTCATGTAAAAGATGGACTGATGAGGACAATA AAGAACAACCTCTCCTCTACTGGTTGGTGGTGGGAGAAGAAGAGACCATC TTCTTCAGAGGGATTCAGACACAAATACAAGAGCTTTTACCAGTAGGAGA CGGAGATGATTACACTCTACCTGTTCAAATTTGGGTTCAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000458XLOC_000458Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000728-exon-sc0000005-1491911889:969917..973259TCONS_00000728-exon-sc0000005-1491911889:969917..973259Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1510915933:969917..973259TCONS_00000728-exon-sc0000005-1510915933:969917..973259Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1575043694:969917..973259TCONS_00000728-exon-sc0000005-1575043694:969917..973259Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1491911889:973566..974132TCONS_00000728-exon-sc0000005-1491911889:973566..974132Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1510915933:973566..974132TCONS_00000728-exon-sc0000005-1510915933:973566..974132Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1575043694:973566..974132TCONS_00000728-exon-sc0000005-1575043694:973566..974132Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1491911889:975335..976932TCONS_00000728-exon-sc0000005-1491911889:975335..976932Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1510915933:975335..976932TCONS_00000728-exon-sc0000005-1510915933:975335..976932Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1575043694:975335..976932TCONS_00000728-exon-sc0000005-1575043694:975335..976932Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1491911889:978345..978642TCONS_00000728-exon-sc0000005-1491911889:978345..978642Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1510915933:978345..978642TCONS_00000728-exon-sc0000005-1510915933:978345..978642Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1575043694:978345..978642TCONS_00000728-exon-sc0000005-1575043694:978345..978642Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1491911889:979170..979457TCONS_00000728-exon-sc0000005-1491911889:979170..979457Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1510915933:979170..979457TCONS_00000728-exon-sc0000005-1510915933:979170..979457Clytia hemisphaericaexon
TCONS_00000728-exon-sc0000005-1575043694:979170..979457TCONS_00000728-exon-sc0000005-1575043694:979170..979457Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000005supercontigsc0000005:969917..979457 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0212233 0.0375269 0 0.00806826 3.82056 0.934333 0.00616059 0.751665 1.40003 0.440524 2.08925 0.000282513 0.136892 0.57269 0.350758 0.66831 0.119793 0.287478 0.297651 1.58473 0.0889224 0.104438 0.0604288 0.0181896 0.351402 0.65662 1.20706 0.309863 0 0
Blast
BLAST of TCONS_00000728 vs. Swiss-Prot (Human)
Match: PKD1 (Polycystin-1 OS=Homo sapiens GN=PKD1 PE=1 SV=3)

HSP 1 Score: 124.79 bits (312), Expect = 4.082e-28
Identity = 98/363 (27.00%), Postives = 156/363 (42.98%), Query Frame = 1
Query: 5050 NRPVLELPPRAFKVGTYFMYITVVVGKYFPASYDYHVYLTVTYSPLVPVISGGSFRVIGDENEAYLDATGTIDPDANFGTVGDITYKWN--VSDQH----CYVNL--RNSSIPVNEWSPEHGKLRIKPQCLSPSLNKRDGYWHEVEVKRIGQSRVEKTSQQIVVVDGAAPLVEINCLTCQAYKTFKYIRTKDIKMSADCTNCQAVDVTYSWSIEGVDNGKRIVLDETTVKSPLQSKVLLLRENVLDGKQSYKVTVEARVKGWNAVGSTTLELQMNKSPSGGECTFTP-DEGEALTTSFEMSCKRWTDEDNKEQPLLYWLVVGE------EETIFFRGIQTQIQELLPVGDGDDYTLPVQIWVQ 6093
            +RP L LP  A  VG Y     V  G   P +      +TV    LVP+I GGS+RV  D  +  LD + + DP+   G    +++ W    S Q     C +N   R SS            + I  + L+  +     Y   + V + G+   E T+Q +++  G  P+V + C++C+A   ++  R+  + +   C NC +      W+     N K +VLDETT  +      L+LR  VL   + Y  T+    +     G  ++ L  N+ P GG C   P     ALTT     C  W D ++   PL+Y L++        EE   ++G  +    +LP G    + + + + VQ
Sbjct: 2212 SRPRLVLPRLALPVGHYCFVFVVSFGDT-PLTQSIQANVTVAPERLVPIIEGGSYRVWSDTRDLVLDGSESYDPNLEDGDQTPLSFHWACVASTQREAGGCALNFGPRGSS-----------TVTIPRERLAAGVE----YTFSLTVWKAGRKE-EATNQTVLIRSGRVPIVSLECVSCKAQAVYEVSRSSYVYLEGRCLNCSSGSKRGRWAARTFSN-KTLVLDETTTSTGSAGMRLVLRRGVLRDGEGYTFTLTVLGRSGEEEGCASIRLSPNRPPLGGSCRLFPLGAVHALTTKVHFECTGWHDAEDAGAPLVYALLLRRCRQGHCEEFCVYKGSLSSYGAVLPPGFRPHFEVGLAVVVQ 2556          
The following BLAST results are available for this feature:
BLAST of TCONS_00000728 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PKD14.082e-2827.00Polycystin-1 OS=Homo sapiens GN=PKD1 PE=1 SV=3[more]
back to top