Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000725 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000725
Unique NameTCONS_00000725
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1763

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000725 ID=TCONS_00000725|Name=TCONS_00000725|organism=Clytia hemisphaerica|type=transcript|length=1763bp
TTcagctaaaaatgaaaatcaacttCATAAAAGTCAAGATCTAAGATGTT
ATGCTGCTTGACTTGAGAAAATCTGATTTGTTGTGACATACCATCTGGGA
ATGTCTAATTGTGTTTAATGGGAAATGCCCATACTAAGATACAAAAACCA
AAGCACAAGACAAGTAAAACATACAAGATTAGATGATGATGTAGATTTTG
AACAACACTTTGATTATGGCATCTTACTTGGCAAAGGTAGTTTTGGCACC
GTCAATGAGGCTATTAGAATCGATTCTGGAGAAAAATTTGCAGTCAAAGT
TATTAATAAGGAAAAGGCTGGGAGTGCTGCTGTAAAACTATTAGAAAGGG
AAGTTGCTATTATGAAAAAAGTTGATCATCCAAACATTATCTTCCTGGAG
GAGGTTCTAGAAACACAGACGaaAATGTATCTAGTAATGGAATTATGTTC
TCATGGAGGATTGGAAGAAATGCTCAatgaaaggaaatattttttggaac
AAGATGTGTTGGTAATCATGCAGCAACTTGCAGATGCCATCGCATACATC
CATGAAAATGACATCGTACATCGTGATTTGAAATTGGATAACATATTACT
GGCTGAACCCACAGATGAGCTACCTTTTAATGTTAAGCTGACAGATTTTG
GATTGTCATATACACGTGGTGGTTCGGGTAGTGATTACATGATGAACCAA
GTGGTGGGAACACCTATTTATATGGcgcCAGAAGTGATAACCAACTATGG
ATACAGTCAACAATGTGATATTTGGAGTCTTGGTGTCATACTTTTCAAAC
TGATTACTGGAAATCCACCATTCATGTCATTTTCCGAAGAAGATCTTTTC
GATTTGATAAAGAAAGGAGAACTCCAGTTTTCTCATGAAAATTGGAAGAA
TGTCTCACCCGCTGCTAAAGAATTGGTGGAGGGATTGATGAAAGTTGACC
CTGCTCATCGCTTAACTTCTAAAGAAATTGTCTCGCATCCTTGGATAAAG
GGCGAACAAGAAATGAACGGTACGAAAACAATTAATGTGTTGGAAATGAT
GAAGGAATATAATATCGAACAGAAAAAGctAGCAGAAGAGCAACAGTTAA
AAGAGCAGCAACTACTCCAACAACTAAACAATGCAAATGAACAAAATGCT
GACCCGACCGACAATGAACAAGGTCCTTTGACAGCCATCGCTGAATTGGA
AAGCTCGCAAGAAATTCAAAGGAAGAAATccaaagATATCAAGAAGACTG
GTTCAGCATCAACCCTTAGTGCGTCAGGCTCATCACATAGCAAGAAAGCT
AGTCTCTCATCTCCCGGCCCTTCGACATCAAACAACGGAGACAAAAAAGC
GAGACCGGTACCAAGTTATATGCAACCTACAAAAAGTTCTAGAGCTCCCA
AAAACCCAAATATCAAGGGTAAGAAGAAATAGCTAGAAGGAGATTTGTTT
AGGGCTTTGATATGCTATGGTTTGCGTTCACGCTTGTATGCCGATGTTCA
ACAGTTTTTTTCACGATCCCCTTGATCGAAAGAGTGCGCATGCaccaaaa
agtatattttagatatatagaaaaattaattaatataAAAACGAGTGTGT
ATAGAattgaattattatttttgtttttatttttttgactaTTGAACTTA
AATTAAACCATTTCTTGTTAGGtattgtttttccattttttctccatttt
gtatGAGTTTGTATATAGAAGTAtcagtttgagtaaagaaataGCTTGAA
TGACCCAAAAAAA
Run BLAST on NCBI

protein sequence of TCONS_00000725-protein

>TCONS_00000725-protein ID=TCONS_00000725-protein|Name=TCONS_00000725-protein|organism=Clytia hemisphaerica|type=polypeptide|length=435bp
MPILRYKNQSTRQVKHTRLDDDVDFEQHFDYGILLGKGSFGTVNEAIRID
SGEKFAVKVINKEKAGSAAVKLLEREVAIMKKVDHPNIIFLEEVLETQTK
MYLVMELCSHGGLEEMLNERKYFLEQDVLVIMQQLADAIAYIHENDIVHR
DLKLDNILLAEPTDELPFNVKLTDFGLSYTRGGSGSDYMMNQVVGTPIYM
APEVITNYGYSQQCDIWSLGVILFKLITGNPPFMSFSEEDLFDLIKKGEL
QFSHENWKNVSPAAKELVEGLMKVDPAHRLTSKEIVSHPWIKGEQEMNGT
KTINVLEMMKEYNIEQKKLAEEQQLKEQQLLQQLNNANEQNADPTDNEQG
PLTAIAELESSQEIQRKKSKDIKKTGSASTLSASGSSHSKKASLSSPGPS
TSNNGDKKARPVPSYMQPTKSSRAPKNPNIKGKKK
Run BLAST on NCBI

transcript from alignment at sc0000005:945087..959262+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000725 ID=TCONS_00000725|Name=TCONS_00000725|organism=Clytia hemisphaerica|type=transcript|length=14176bp|location=Sequence derived from alignment at sc0000005:945087..959262+ (Clytia hemisphaerica)
TTcagctaaaaatgaaaatcaacttCATAAAAGTCAAGATCTAAGATGTT ATGCTGCTTGACTTGAGAAAATCTGATTTGTTGTGACATACCATCTGGGA ATGTCTAATTGTGTTTAATGGGAAATGCCCATACTAAGATACAAAAACCA AAGCACAAGACAAGTAAAACATACAAGATTAGATGATGATGTAGATTTTG AACAACACTTTGATTATGGCATCTTACTTGGCAAAGGTAGTTTTGGCACC GTCAATGAGGCTATTAGAATCGATTCTGGAGAAAAATTTGCAGTCAAAGT TATTAATAAGGAAAAGGTAATACTACAGAAATTTACTTGAACAAAAGCAT CATTTAATATAGTGCAGGACAATCATATAATAAATATAtcataattttga aattgaaaacaagTGTAGGATACATCTTTACATTAGGGTATTCACAGATA TGGATGTACAAGTTGTATTAAATTTCAGGTGCTACACTTGCCACTGTTTT TTAACCATCTAGACTTGTGGCACAGTgtaggaaaaaaaatcatagCTATT CTAGTAAAtatttattgttattgttatatTGATAATATCAATTTATATGG ATTTTAATTTTAGGCTGGGAGTGCTGCTGTAAAACTATTAGAAAGGGAAG TTGCTATTATGAAAAAAGTTGATCATCCAAACATTATCTTCCTGGAGGAG GTTCTAGAAACACAGACGGTAAGATAAAATTCTTTGACTTTATAGATGTG AATGTACGAAAttttaatacaaaattttgaatccagCCAAGGCAAATGAC TTGTAACAACTTGAAATAAGTACAGCTTACAGTAggacgaaattttggca gggactttaatttggcggatttggtatAAAATTTACTAAATTTAAATCAT CTTACCCCTCCTCCAAATTGTATGCTTTTGTCAGGACttgaaacaggttt ttttcttATGTAGCATttattggccaaaatatccTTCATTCgccaaattt ttaataattcaaggccaaatttgatttttcaagctaCTTTCCAAATTAAA CCCATGCCAAagttaactttttttctgcCATCGGCCAAATTAAATTACCa ccgaaaaatcttttttgaccatccgccaaatttcttcctttaaggtaagt GACGATGGATGGATTAGATTCCAAAGCTTGTCAATAAATCAACTGATTCT TCAACGAATCTTTTTATCCAAAAATTCACAttactttttttttcctttag aaAATGTATCTAGTAATGGAATTATGTTCTCATGGAGGATTGGAAGAAAT GCTCAatgaaaggaaatattttttggaacAAGTAGGTTTTCTAGGAATTt cggttttttagttttttcactttcaattgAATTTAAATTGTCAAATATCA ATATGTATTCATTCAAAAGTTAGaatttatctatttattttactgtataa ttcttttttttccatTCAGGATGTGTTGGTAATCATGCAGCAACTTGCAG ATGCCATCGCATACATCCATGAAAATGGTACGTTATTTTTAGTCAAATAC TGTAGAACCAatcagaattttattttttattatattgtggTGGTTGTTAC CATAGACTCTTTGAAATTCCTTTTATAAAAGAGGCTAACTCTGCTGGTTT TTTAGCAACCTTTTGGTTTGAAGCTGTCCAACCTTTTTTAGGACATTCTA CTTGAtacaatacactcttctcgagatgcataaatttattgttgtcctcg ttgagacattttgaatttcaagtacttttgttttagagttaatgtttgcc ttttgggaatttaaattggtttaattgtataatttcatagcaatgaaatc tgttttgAATTACTACGTGTCTAAACCCCTGAAAGCTTCTTCCATCTTAA TTCTTACTCACCATGCATTCAAGAATCCCAAAATAACAGTTCATTATCAG ATATTGTTCTCATCATTTTTCCTTTATTTCAGACATCGTACATCGTGATT TGAAATTGGATAACATATTACTGGCTGAACCCACAGATGAGCTACCTTTT AATGTTAAGGTGTCTGTCTCCTTTAAATTCCTAATACAGTACTACCTTCT TCATATATACATTTCAATTAAAGAGTTGAAGTACTAAACAACGACAATTG ATAGACGGTTTTAATGTGTCATCNTATATACATTTCAATTAAAGAGTTGA AGTACTAAACAACGACAATTGATACACGGTTTTAATGTGTCATCGCAAGC AACTTTAAATACAAATAAAACGAACTTTCTTGAACGTTGAGTAACGCTAG GACTAGAGAACTTTCTTGAACATTCAGTGGACACAAAGGATCGTTCGCGA GCGTTTAGGAACGTCCTGAACATTCAGAAACGTTCTGGAACGTTTAGAAA TGATCGAGAACGTTCTGGAACGTTCTAGGAACGCTATGGAAGTTCAGGAA CGTCTCAAGAACGTTCCATTTAAtttgtacttcaaatcgcttgtggtaat TGCACATCATGTTTCACGTCAATGAAATTCTCATATGTTTTTCTTACAGC TGACAGATTTTGGATTGTCATATACACGTGGTGGTTCGGGTAGTGATTAC ATGATGAACCAAGTGGTGGGAACACCTATTTATATGGGTATGATATTTTC AGctctaatttcatttttttttgtcttttctcCTTAGCTTTTAGTTCCCA ACGGAACTTCGTATCAGGGGCACACTACATGGCTTCTATATTAATTGTAT GAgcatgaaaatatttcaaagcctTTGGAATTTCTCAAGATGATCTTAAG TTATTTGTCCTCGAAGGCTaatgttttttatataatttgtatGTTTTTAC AACACATGTAGAAATTTAGTTCATTCTGTTATAGTTCCTTACTTTGCTTA GTTTAATAAACATATAGGCTTACAATAAGTTTTAATTTGAACCAGAGATA TAGCTGCTTTGACGTGTGTCTACTCCTGTGTTCTtatatcattatttttc tttttcagcgcCAGAAGTGATAACCAACTATGGATACAGTCAACAATGTG ATATTTGGAGTCTTGGTGTCATACTTTTCAAACTGTAAgcttattcaaca tttttaaaagcattttctCTGAATTCTTTATACCGCAGCTCGATATTCAA ACTGCTGAGTTTGTTGGtgtctttctttattttcagtCCTCATTTCTCTT GAAAGTATGACGCTGCTCAATAACTTTATCAGGAACATAACAAATGCCAT TGCAAGCGGCATACAAAGGAAATCTAAAACTCTATATTAATAACTCTTTT TTCTCAGGATTACTGGAAATCCACCATTCATGTCATTTTCCGAAGAAGAT CTTTTCGATTTGATAAAGAAAGGAGAACTCCAGTTTTCTCATGAAAATTG GAAGAATGTCTCACCCGCTGGTATcattaaaatacttttttatttttatc ataattCTCCACTTTGCCTCCACTCTCCTTATCCCGTTGTTctgaaaata atttataaattaCCAAATTACCAAATATCTTACATTTTAAGCTATTGACA AGTATTCTAACATTAATTCAATGAATTATGGCACAAACTTATAATATTTC TATAttaaatgtaattttttctgGGGACCTTTCTGACCATATAAAGGGGT CATGTATCAAAATTTGGGAATGGCGTTATCTTCCGTATAACATTCTAAGT ATCATGGGCTTTTTAGACCATAATTAAATTAATCACCAACTCCCGTAATT GTTTTTGATGGTGTCAAGACAATGTCTCTGTGTAATGATTATTGCCCATA ATGATATTGCacaattgaaattattttattttacatttttgtcGATAGCT AAAGAATTGGTGGAGGGATTGATGAAAGTTGACCCTGCTCATCGCTTAAC TTCTAAAGAAATTGTCTCGCATCCTTGGATAAAGGTAATGGTATATGATG GCTCATAACACATTAAGTGTTTTATTATTTATCATAAAAAGGCCAAATAA CAGCTAGAatctgtgttcgttcgttcgttcgttcgttcgttcgtctgtta ccaacttttctcaggattgaatcataggaatcttttgatttttggtccAA AGGTGCAAAagggtggtggccaaaatgtgacggagcccgattttcgaaaa aaaattttcttaggcaaatttgggccaaaaaacggctaaaaaacgatAGA tagagatagatgttttttttgctcatttagggcttacttttgataaatat tagtgtttagacatgaaattttggctgattggcgtttttttatagaaaca ctggccaaattcgatatttttttataagcacattatcaattacttaggta ttgccttttttcgagattggctctttcatgctttatgaatttttgcacaa agatacatAACTATaagccctcgaatgtgacggagcccgattttcgaaaa aaaaatgtttttgggcaaattaggaccaaaaaacggctaaaaaacgggtt ttttggactttgtgaaatattggatcattgtttttttctgattttttgca tgaaagcaggtaaaagatgactcaagcagattcaaaaaacgcatctttat ctataagaatcactattaataagatacatcaatgttcttagccaaattac tcaatttttttgatgagatagatttttttttctcacgaagtcttgaatat gaaagaatatttcaggagcatgaaattttggtttctaaacggttttttat aagaaacaaacgactaattttgatagatcgtcactatttgtgttctgaat gattgtttaatgatcacgtcacgtagatatcaattatatatgtgttaaat acataaccaggtaggtccataaaagtatcacttgtttcggTCTGTTACGA TTAGATTAATTTTGTCTCTCGGTACTAGCAACTATTTGGTCACCGAAAAA CTGGTCCTTAGGAGTGTTGTTTTGTAAAATTAAAGATAATATCGCACTGT GGTGGATGAAGTAGCTTCACTTAAGTTGAAGTAGTTCTCGCACTAAAAGT AAAACATTAATCCATCACAGCGGCAATATAAGAGGCATTCGATAAATAGT ATCAGACACGAAATGGTGTCTAACTTATTTAACGAACCGTACCTTTTGGT TTATTTAATTTCCTGCAAAGAAGAGTTTGAGTTCTCTTCCTGCGAGGAAG AATTTGGTAAAAGCTGATAGAAAAAGTGTATATTTTTTCTATAGGGCGAA CAAGAAATGAACGGTACGAAAACAATTAATGTGTTGGAAATGATGAAGGA ATATAATATCGAACAGAAAAAGGTATCAAATAAAAACGtctcaaaaaaaa catcttaacCATTGATATAAAAGGAGGCTTTGCCGCCTCAAAAATTTGTG GGATAATTAAGAGCACGAAAAGAGCACGAAAAGACTTTGATCCTGTTTGA TTGCCACTGATCTTTGTCGTCTTGCGTCGtccttttttgaaatatttaca aagtTCCTATTAAAAACAGAGACTTTTCGAAATTCGGGAAAATTATGCAA AGTGTAAAACAAttcaagtttttatttctttagctAGCAGAAGAGCAACA GTTAAAAGAGCAGCAACTACTCCAACAACTAAACAATGCAAATGAACAAA ATGCTGACCCGACCGACAATGAACAAGGTCCTTTGACAGCCATCGCTGAA TTGGTAACGTTTtgtcttctttatttttttttggtattatgatttttttt aaaggatGCAGCGGGTTTCAATACAAATTTACAAGCTCATCGACTCATTA TCATAACATACCTTTAGAGGAAAATTTGGCGGGAAAGATTTTGCCAAACG CGGGCCAATACttggcggaatttatttttggtgatttacgattttttttt taattaagcgAGAAAGAATTTTGGCAAACAGCACGttattttgttagttt tttttagctgaaaaaaagaagaaataaaggtatttttttaagaaaaaatc ttgtgCATATTAAAAGGtgattaaatttggcaaaagttattttcaaCGAT TTAAGAAATTCGCATCTCGGCAAAATTTTATCTCGTCAAAACTTCTTTCC ATTAGgtaattattttcttcttttaatcaAACTGAAATAACATGGCGTCT CATCGCAGGGCTGTTCCATAATAACTTTTAATAATAACTTTTTCAAGTCT TAGAATTTTCTTAAGTTAAGTAATACCTTATcgaccctttttacgccggc cctaatttaacaccggcccttattacgccacagcctaattttgggcttac gccaattagggccgttaataacgccaaaatttgaaaaatggctacttatg cATCAAATTAGTAAATGATGACTAGAATTTACatataaaatgtcattttt cagtagtaaactgttgaaaattccatagaaaatatattaaatatttcact gaagttttaaatatggagtaaatcaatggataattttcgtcttcgaatca taactaaaatcctttaaattgagaaataatgataaaaaattaacgcatta atataataatataaacAGAATATAGTAGAGGCCAGAGGTGAGATTGGCAG TTATAGATTAAACGCATATGAAAAGATTGTATCTTCACTAAGAAGCTATC GATAATGACTCAATTTGGATAATTGGAGCTGAGTGGATGAAGAGCTGAAA TATACCTTGGTGTCTAGACTTTAGATTCccttttaaaattgaataattat aaataataaatcaaataatacacgttttttacaagaacattttgaagcct tcagatattcttaacttttcgggtttcgagcctaaaattgttcttaacat gtttttattttcagcatttttgagtatttttgtccattttcctaagaaaa caggtgttttaaagcccaaaaagccttaaaatgttcttaacttgctctta agattttggccaccgaagccttcatgttcttatacagtttgttcttatga aaaataacGTGTATTGCTAATATGTAATAGACGGGTAATAAGAACGGTTG ACAGACTATTCGTTATCATAGTATTGAGATTTTACTGCTGACTTTTTTGA TTTTCGCATTTGATCTGAAAAACTGTGTGTCACTGTCTCGCAAGTTGGCA GCTAGTATAAACTACAGCGTAAGATTCTAGCGAGACTAGTTTAAACTGCC TGACAATTTGCGAGACAGTGACACAATGTTTTTCAGATCCAGTGTGATAA TCCGGCGTGAATAACCTGGGGGGGGCAAGGGCAGCGTACCTTTACCTCAT CCTTGATGTATTGTAGAATCTATACCTAGCACAGTGACCAATTTTCTGTC TACCCACGACTCGCATGGTTGGCCCGGGTGAACGTACATGTACTTGCCAA GTAAATCACAGCACCGAGTTGGAAACAAATTCCGACCTCCTGGACTGTGG TTAAGATTGATACACTacactacactactgcgccaTCTCATAGTAGTGAG ATATTAGGTGCATCAATGTTCGATCTAAATATGAGATTGATTCAGCTGAA TTAAACCTGCTACAAGAGAAACAGCTTCAATACCTCTCCAAAACAGGTGT AAATTGAAGAACTCTTCTTCGAATATTTCTTTTGCTTcggttattaggta cccgagagtagagcTTAAATATTGTCATTGCACTACTACTATCGCTATAT CTTCATCTTTACTCAAAGAATTCAGTTACGTCTTTATAATCTTTCtggac aaaattttcaaataaagagaAATTTATTTCGACATTTGTTAGTGTATTTA AATCTCCACTCCATTCCCAAGAAGACTTGAGCATGAAATCTCATTTCTAA GTACTATGTTGGTTAAGGTAATCGATAGTGTTCCTTTTTTTCTTATGGAA TTAATAAACCATGATTTCAGCAAGACCCATGTATCTTCGCGATCCAATAT CAAGTTGTGACAACTTTACGTACCGTGCTAAAAGAGGCTTAGTGCATTGA GCAAAATAAACCAAAGCAACAGTATCCCCAATATGTGTACAAAATCGTTG ATTGTTGCCTGGACTATCGAAGACGTTGATATCAGTTTGTGATAGGCGCC TTAATATATTCAAATCTTCTGTATGTCGGTTATGTAAAATTAAGAATGTG ATAATTTTTCGTGAACCAAGATCGATTTGGATCCATTCATTTTTACTACT GCCTGTGATACAGAATGAGGAGTCTGCGCCGAATTCGCCATCAGTACAAT GCGAACCGTAGTTGGATGCATACGTCTTTGCCATCAGTACAGGTTTGTGG ATTGCCatgttttctttcaataaagaGAAGAATAAAATATGTCACAATAA AAATCTGCAGCAGAGACAATAACGACAGTACTTTTGATAGGATTCGAATT AAATAGCCGTTTTAatgtttgttgaaaagatattcaacaGTGTAACATTA TCCAATATAAAATAATCcagcaaaaatttggaaaatgacgatgaaaaatg aggaaaaaaacTTCTTCTTAGTTTATCGACTCATCAATGGACAAGAGTAA GGTTAAACCAAggtcaaattttcaacaaagaaattcattgttctttgatc ttttttggtaaaagttttaaaatgttaatATTGAATTCCAAAAAGATTTC CTTTGAGGTTTCGCTTAAGACCCTGGAATGAATCTGCAggcaaaagatta aaaaaacataTGCTTCACAATGACCATTGTACAATACCTGTTAGCTCATT CATGCAATGTTCATCGTAGGTTTGAAACGGACATAGACATTCATAAGTTT CATTGTCATAATGTGGTATACATTTATGGTTTGGATTGATGCACGTCTCT TCCCATTCACAATCATGCTATAAAAGCAATGAGAAGACTTTCATTTAGCG GACATCATTATTTCAATATTAGAGTTAAAAAGAAGAACACGTCTTGCGTT AAATTCCTATCAGAGGTTGAAGATAACcactttttacattttttgcatgc CTCGTGCATACTTCTCAAGAAATGTAACttgaaaatttccatttcatcaa tttttattttcaagcccccagtatataaaaatggGTATGAAATGTATGTG TACTTCATGAATACTATActaccgggtgtttcaaaaaagtgtacaagttt CAATTGAGATAGGAAGAAAACTAAGAAAGTTGTAATTTTCACAatcagaa agaggaaaggcTGACTTAAATTTTTAGCTATCAAACTTTAAGTTTGCTTC ACGTGTTCAAGAGTTataagaaaattcgaaaaaaaaaatttgagaaaaaa gttagGATCAATTTTTATGTCTTTCTCTTTTGTACAAGAAAAGAGCGCCC TATCGAATCTTCAGATGCTAAAACAAAGTATCAGAAAAgctttttttcac tgttttttaagctttaattccagacggtgtcaatggAACAAGTTCGAACA AAACTAGCGATCAAGccaatcgaatgtaatcgaatgcgctcgaataattg caatttgattgtcgaatgcaatgaatctcaatcgaacggccgattcctgg tcGATTactcgattgtgttcgattgtgttcgagttatgttcgattgagat tcgattatgTTCAATTAGTTTAATTAGTTCGATTATGATAATGTTCGATA AGATTGATTGCAATTAAATTAGCCCACTCCTCTAGAGCTTTAGAACTTAT AGCGTGGGCGGCTACCAATATGCCATTGGAAAATCAGATAAGAGCAAGTG CGCAGTACCACACAAGACGAGAGCGATTTATGCGAGCGAatataatcgaa tacaatcgaattTAATCGAAGCAAACGAACGGCAAATCCGGAGTAATANC GAatataatcgaatacaatcgaattTAATCGAGGCAAACGAACGGCAAAT CCGGAGTAATAATATTTGATTACGATTCGATCGGCTACCAATATGCCATT GGAAAATCAGATGAGAGCAAGTGCGCAGTACCACACAAGACGAGAGCGAT TTATGCGAGCGAatataatcgaatacaatcgaattTAATCGAAGCAAACG AACGGCAAATCCGGAGTAATAATATTTGATTACGATtcgattcgattgat tcggcgttcgattcgttcaattgacaccgtctggttaaTTTGATcccttt atttttctaaaatataacgcttttttttaattaaaaaatagctcaaaatt taagttagcctttcctctttctgatgGTGTAAAGTCTAGATTTATAACAT TCTTAGTTTTCTCACAACCTTGCTTCAAGCTTGTACACTATTTTTGTGAA ACACCCGGTACctggaaaattttcctacccatTGAGACCCAGATAAATGT ACCCAACGCTTCACTTTTAAACTACATTGTACATACTACCCAGAAAAGTG CTAAATATGCCACATATCCCCTATTTTACTGAAAGGTACAACCcacaaaa atcttaaatttgatTATACTGATGTTCCTTTGTTTGCGTCGCTTCAATAA AATGTTAATATGAAAGTCTCGATCAACGACGTTGTTCTCTTTGTAATTTT GAGCTTGAAATTTTTCATAGTCAAATAATCTCAAAAATTGTAATCTTTAT GGTGTCCTaccaaattttgggaaaatacGTAGAAGTTCACCTTAAATATC GAGTTGAACTGTAATTCCAAACAGATTAAAAGCGAAAAATCTTTGAATTA ATAGGCAAATTCACTTTTAGACCCTAAACCCAAATTTTGTACACATATAG TAAAAATCTAAATCGATTTCGGACCCTACACCACAAATTATAGTACACAG TTCGTGAcaacttttttctcaaacacccacccaccccatgcCGCCACCAC CTCtcgtacactgaccccccccccctggaaccGCTATATGTGTTATTGAA ATTTATGATAAACTCACACTGATAGCATAATGTGTCGATCCAATTTGTTC AACAAAACTTGTAGAATTTCTGAAACGGTCAGTGCCCAGTAGTTGACATT CAAGGTGGCCAGCACTGGCTAGTGCGTTCTGTACTACAACATTGGTACTG GTGCACGTGTCAAAATTGATACAATGTGCAATGCAATTCGAGTTTGATGT TATGTTACTTGTAATAACTTGTATTGGTGTTACATCAAGGATGTGATTGA CATGGGCCACCATATTTGCAAATCCATATTGTACTGAAATAAAACGCGGC TCTTGAATTCACTTGAAATGAATATATAAATTTGGTATTGCGTAACCCGT GCCTATTTATTATGAACTTACTTAATTCTTGCCTAAACTTAAGGGCAAGA TAATATGAAATAATAACAATTTATACTGTCGATGTTTTGGCTCAGactaa aaaatgattatggaTTGAAACCTTCGCAGGTAAAATTATTGTCAATagga aaatcatttaaaatctaaaaagtcTTACCACTGCTATTTGTCTGCACCGT ACTAAGCCTCTTAATTTGTTGACAACGACAACAGCTTGGCAGAATCACCA ATGAAATACGTAAAAATATCCCGAAGAACAGATTCATACTCCTTATCTTC ATTGATAACTCACCGTCGGCATAGGCTATTCTAACTGgtaaaataaaact ttcttggtaaaatatatatttatataatttaagtAATAAATTTTAACCCC ACTCACGTTAtgaacgagcacaaaatcgaaATCTTATTAAttctatataa aaaaaacgtagaAATCGGAATCAATTGAACGCTTTGTTTGACAATACTTC TATGGTTTGACTGCgaagtctttttttccaggGCAACATTATTCAAGTTG GTCTTTTCTTTTTagttctttttaaattttttcgtccatttcttttattt aaaattctgACGTTTGCGCTAACTTTTATCGTCTTGACAATTTTGAATTG TACCTTATTGTTAGCCATAGCATTCAATAATGTCAAACGATTAAGATTGA GGGGATGAATCGACTAATTTATTCAAGTTTCTCACAATCCTCTCTCTTCT CCTAGAAAATCCTCAACAagataatatttttaacctgTGCACTGATCACC GGTTGCATTTGAAACCCAACTGCGTATACCAGGGCACTGATACAGCGGAG TTTTAAAAAGACATGACAAGCAAAAAAACTCTCTTATTTAAGTGTCTTGA TCATAGTAATGNACAAGCAAAAAACTCTCTTATTTAAGTGTCTTGATCAT AGTAATGATTTAAAATGAAAAGGGGGGGGTTCAcgtttggcggaggagcg gaatcagcccttttttcggacggagtagcggaatttggcgaaaatttaga cggaattacggaaattgggttctctgacggagacggaaaattagacaatt ttagtgcagaaaaacggaatttagcaaaaaaatttgcggaatttcggaat tggtgaaagatgttcaaaatttgcggaattttcgacaaaaatattaaatt tcaaaagaattttcggtgacggaattttggttcaatttaagacggtttga cggaaattggagaaaaaattgacggaattgctgaatcgggtaccccctga aaccccccacCTGAAAATAGGAAGAAGAACTAAAATGCAGGAGCGATAAT CTATGATAATCAACCCCACAACAATTGCCATAACATACATGACAATAACC TCTAGCCAATGGACGGTAGTCTCTTCCGGACAAAATGACTCATAAAATTC ATACTATGAAACATTTCTAGCAAAGCTAGGCTAATTAGAAAAGTGAAGTT TTTTagagaagtataatttttaagCAACTGTCTTTCATTGCTGTTTCGAT TTGcttgatttttatttattcaacATTTGACCTTTTGTCAAGCATCTTCA ATTTGTACGAATTCTTTTTCCAGGAAAGCTCGCAAGAAATTCAAAGGAAG AAATccaaagtaaatatttttttcttttcctaaaTTGGAACGTTTGTATA TTTCTTGAGGACATGGGACTCTATTTAGGTGATAACCTCTAAAGAACAAT TAAGAACAACCATATTTTCCAGAAAGTGTTTATTTTATGCACCTTTTAAG TCAATAtgtgagaacattttaagtacatTTAGGCCTGATATTCACGAGAG AAAAACCTCAGCCAAATGTTTCTGGTTCATAAAAAATCGAGTTATTCCTA CtcagtaattttttttcaagaagataattttcttctttttctaggATATC AAGAAGACTGGTTCAGCATCAACCCTTAGTGCGTCAGGCTCATCACATAG CAAGAAAGCTAGTCTCTCATCTCCCGGCCCTTCGACATCAAACAACGGAG ACAAAAAAGCGAGACCGGTACCAAGTTATATGCAACCTACAAAAAGTTCT AGAGCTCCCAAAAACCCAAATATCAAGGGTAAGAAGAAATAGCTAGAAGG AGGTATGAAATattcaaatcattttttatgGATGGAATGCAAAATGATTA TACGTAGGTGACAGGTGGtggaaaaatcatttttaataaaAGATATCGCT CTGCACTGTTCCGGGTACTGCGACCTCTATATACCCTGGACTTCTGCTAT ATTCGCCACCTAGGATTGGAGTTTTTGGAAAAGTCATACCCTAAATGGTA GCACTAGTCGATGTGGCTCAATTTGTAATCCAATGAAATTTTCCGTCAAT TTTTTTCACCCACATTGAGTCGTGCTACTATTATAGGGTTTAAAAGGCTC TAACATTTTGCCTGGCCAGGATCGAGAAACTGTGTTTCGAAAAGGGGTAA TGGAACGAATTTCCTACTTTCAGAGGGATCCTAGTCTTACGAAACAGTTC CAGGGAACAAAGCCTAACCTGACGCCTAAAAAACCTTAAAGAGAGGATTT ACCAGATTTGTTTAGGGCTTTGATATGCTATGGTTTGCGTTCACGCTTGT ATGCCGATGTTCAACAGTTTTTTTCACGATCCCCTTGATCGAAAGAGTGC GCATGCaccaaaaagtatattttagatatatagaaaaattaattaatata AAAACGAGTGTGTATAGAattgaattattatttttgtttttatttttttg actaTTGAACTTAAATTAAACCATTTCTTGTTAGGtattgtttttccatt ttttctccattttgtatGAGTTTGTATATAGAAGTAtcagtttgagtaaa gaaataGCTTGAATGACCCAAAAAAA

Coding sequence (CDS) from alignment at sc0000005:945087..959262+

>TCONS_00000725 ID=TCONS_00000725|Name=TCONS_00000725|organism=Clytia hemisphaerica|type=CDS|length=17004bp|location=Sequence derived from alignment at sc0000005:945087..959262+ (Clytia hemisphaerica)
ATGCCCATACTAAGATACAAAAACCAAAGCACAAGACAAGTAAAACATAC
AAGATTAGATGATGATGTAGATTTTGAACAACACTTTGATTATGGCATCT
TACTTGGCAAAGGTAGTTTTGGCACCGTCAATGAGGCTATTAGAATCGAT
TCTGGAGAAAAATTTGCAGTCAAAGTTATTAATAAGGAAAAGGCTGGGAG
TGCTGCTGTAAAACTATTAGAAAGGGAAGTTGCTATTATGAAAAAAGTTG
ATCATCCAAACATTATCTTCCTGGAGGAGGTTCTAGAAACACAGACGaaA
ATGTATCTAGTAATGGAATTATGTTCTCATGGAGGATTGGAAGAAATGCT
CAatgaaaggaaatattttttggaacAAGATGTGTTGGTAATCATGCAGC
AACTTGCAGATGCCATCGCATACATCCATGAAAATGACATCGTACATCGT
GATTTGAAATTGGATAACATATTACTGGCTGAACCCACAGATGAGCTACC
TTTTAATGTTAAGCTGACAGATTTTGGATTGTCATATACACGTGGTGGTT
CGGGTAGTGATTACATGATGAACCAAGTGGTGGGAACACCTATTTATATG
GcgcCAGAAGTGATAACCAACTATGGATACAGTCAACAATGTGATATTTG
GAGTCTTGGTGTCATACTTTTCAAACTGATTACTGGAAATCCACCATTCA
TGTCATTTTCCGAAGAAGATCTTTTCGATTTGATAAAGAAAGGAGAACTC
CAGTTTTCTCATGAAAATTGGAAGAATGTCTCACCCGCTGCTAAAGAATT
GGTGGAGGGATTGATGAAAGTTGACCCTGCTCATCGCTTAACTTCTAAAG
AAATTGTCTCGCATCCTTGGATAAAGGGCGAACAAGAAATGAACGGTACG
AAAACAATTAATGTGTTGGAAATGATGAAGGAATATAATATCGAACAGAA
AAAGctAGCAGAAGAGCAACAGTTAAAAGAGCAGCAACTACTCCAACAAC
TAAACAATGCAAATGAACAAAATGCTGACCCGACCGACAATGAACAAGGT
CCTTTGACAGCCATCGCTGAATTGGAAAGCTCGCAAGAAATTCAAAGGAA
GAAATccaaagATATCAAGAAGACTGGTTCAGCATCAACCCTTAGTGCGT
CAGGCTCATCACATAGCAAGAAAGCTAGTCTCTCATCTCCCGGCCCTTCG
ACATCAAACAACGGAGACAAAAAAGCGAGACCGGTACCAAGTTATATGCA
ACCTACAAAAAGTTCTAGAGCTCCCAAAAACCCAAATATCAAGGGTAAGA
AGAAATAGATGCCCATACTAAGATACAAAAACCAAAGCACAAGACAAGTA
AAACATACAAGATTAGATGATGATGTAGATTTTGAACAACACTTTGATTA
TGGCATCTTACTTGGCAAAGGTAGTTTTGGCACCGTCAATGAGGCTATTA
GAATCGATTCTGGAGAAAAATTTGCAGTCAAAGTTATTAATAAGGAAAAG
GCTGGGAGTGCTGCTGTAAAACTATTAGAAAGGGAAGTTGCTATTATGAA
AAAAGTTGATCATCCAAACATTATCTTCCTGGAGGAGGTTCTAGAAACAC
AGACGaaAATGTATCTAGTAATGGAATTATGTTCTCATGGAGGATTGGAA
GAAATGCTCAatgaaaggaaatattttttggaacAAGATGTGTTGGTAAT
CATGCAGCAACTTGCAGATGCCATCGCATACATCCATGAAAATGACATCG
TACATCGTGATTTGAAATTGGATAACATATTACTGGCTGAACCCACAGAT
GAGCTACCTTTTAATGTTAAGCTGACAGATTTTGGATTGTCATATACACG
TGGTGGTTCGGGTAGTGATTACATGATGAACCAAGTGGTGGGAACACCTA
TTTATATGGcgcCAGAAGTGATAACCAACTATGGATACAGTCAACAATGT
GATATTTGGAGTCTTGGTGTCATACTTTTCAAACTGATTACTGGAAATCC
ACCATTCATGTCATTTTCCGAAGAAGATCTTTTCGATTTGATAAAGAAAG
GAGAACTCCAGTTTTCTCATGAAAATTGGAAGAATGTCTCACCCGCTGCT
AAAGAATTGGTGGAGGGATTGATGAAAGTTGACCCTGCTCATCGCTTAAC
TTCTAAAGAAATTGTCTCGCATCCTTGGATAAAGGGCGAACAAGAAATGA
ACGGTACGAAAACAATTAATGTGTTGGAAATGATGAAGGAATATAATATC
GAACAGAAAAAGctAGCAGAAGAGCAACAGTTAAAAGAGCAGCAACTACT
CCAACAACTAAACAATGCAAATGAACAAAATGCTGACCCGACCGACAATG
AACAAGGTCCTTTGACAGCCATCGCTGAATTGGAAAGCTCGCAAGAAATT
CAAAGGAAGAAATccaaagATATCAAGAAGACTGGTTCAGCATCAACCCT
TAGTGCGTCAGGCTCATCACATAGCAAGAAAGCTAGTCTCTCATCTCCCG
GCCCTTCGACATCAAACAACGGAGACAAAAAAGCGAGACCGGTACCAAGT
TATATGCAACCTACAAAAAGTTCTAGAGCTCCCAAAAACCCAAATATCAA
GGGTAAGAAGAAATAGATGCCCATACTAAGATACAAAAACCAAAGCACAA
GACAAGTAAAACATACAAGATTAGATGATGATGTAGATTTTGAACAACAC
TTTGATTATGGCATCTTACTTGGCAAAGGTAGTTTTGGCACCGTCAATGA
GGCTATTAGAATCGATTCTGGAGAAAAATTTGCAGTCAAAGTTATTAATA
AGGAAAAGGCTGGGAGTGCTGCTGTAAAACTATTAGAAAGGGAAGTTGCT
ATTATGAAAAAAGTTGATCATCCAAACATTATCTTCCTGGAGGAGGTTCT
AGAAACACAGACGaaAATGTATCTAGTAATGGAATTATGTTCTCATGGAG
GATTGGAAGAAATGCTCAatgaaaggaaatattttttggaacAAGATGTG
TTGGTAATCATGCAGCAACTTGCAGATGCCATCGCATACATCCATGAAAA
TGACATCGTACATCGTGATTTGAAATTGGATAACATATTACTGGCTGAAC
CCACAGATGAGCTACCTTTTAATGTTAAGCTGACAGATTTTGGATTGTCA
TATACACGTGGTGGTTCGGGTAGTGATTACATGATGAACCAAGTGGTGGG
AACACCTATTTATATGGcgcCAGAAGTGATAACCAACTATGGATACAGTC
AACAATGTGATATTTGGAGTCTTGGTGTCATACTTTTCAAACTGATTACT
GGAAATCCACCATTCATGTCATTTTCCGAAGAAGATCTTTTCGATTTGAT
AAAGAAAGGAGAACTCCAGTTTTCTCATGAAAATTGGAAGAATGTCTCAC
CCGCTGCTAAAGAATTGGTGGAGGGATTGATGAAAGTTGACCCTGCTCAT
CGCTTAACTTCTAAAGAAATTGTCTCGCATCCTTGGATAAAGGGCGAACA
AGAAATGAACGGTACGAAAACAATTAATGTGTTGGAAATGATGAAGGAAT
ATAATATCGAACAGAAAAAGctAGCAGAAGAGCAACAGTTAAAAGAGCAG
CAACTACTCCAACAACTAAACAATGCAAATGAACAAAATGCTGACCCGAC
CGACAATGAACAAGGTCCTTTGACAGCCATCGCTGAATTGGAAAGCTCGC
AAGAAATTCAAAGGAAGAAATccaaagATATCAAGAAGACTGGTTCAGCA
TCAACCCTTAGTGCGTCAGGCTCATCACATAGCAAGAAAGCTAGTCTCTC
ATCTCCCGGCCCTTCGACATCAAACAACGGAGACAAAAAAGCGAGACCGG
TACCAAGTTATATGCAACCTACAAAAAGTTCTAGAGCTCCCAAAAACCCA
AATATCAAGGGTAAGAAGAAATAGATGCCCATACTAAGATACAAAAACCA
AAGCACAAGACAAGTAAAACATACAAGATTAGATGATGATGTAGATTTTG
AACAACACTTTGATTATGGCATCTTACTTGGCAAAGGTAGTTTTGGCACC
GTCAATGAGGCTATTAGAATCGATTCTGGAGAAAAATTTGCAGTCAAAGT
TATTAATAAGGAAAAGGCTGGGAGTGCTGCTGTAAAACTATTAGAAAGGG
AAGTTGCTATTATGAAAAAAGTTGATCATCCAAACATTATCTTCCTGGAG
GAGGTTCTAGAAACACAGACGaaAATGTATCTAGTAATGGAATTATGTTC
TCATGGAGGATTGGAAGAAATGCTCAatgaaaggaaatattttttggaac
AAGATGTGTTGGTAATCATGCAGCAACTTGCAGATGCCATCGCATACATC
CATGAAAATGACATCGTACATCGTGATTTGAAATTGGATAACATATTACT
GGCTGAACCCACAGATGAGCTACCTTTTAATGTTAAGCTGACAGATTTTG
GATTGTCATATACACGTGGTGGTTCGGGTAGTGATTACATGATGAACCAA
GTGGTGGGAACACCTATTTATATGGcgcCAGAAGTGATAACCAACTATGG
ATACAGTCAACAATGTGATATTTGGAGTCTTGGTGTCATACTTTTCAAAC
TGATTACTGGAAATCCACCATTCATGTCATTTTCCGAAGAAGATCTTTTC
GATTTGATAAAGAAAGGAGAACTCCAGTTTTCTCATGAAAATTGGAAGAA
TGTCTCACCCGCTGCTAAAGAATTGGTGGAGGGATTGATGAAAGTTGACC
CTGCTCATCGCTTAACTTCTAAAGAAATTGTCTCGCATCCTTGGATAAAG
GGCGAACAAGAAATGAACGGTACGAAAACAATTAATGTGTTGGAAATGAT
GAAGGAATATAATATCGAACAGAAAAAGctAGCAGAAGAGCAACAGTTAA
AAGAGCAGCAACTACTCCAACAACTAAACAATGCAAATGAACAAAATGCT
GACCCGACCGACAATGAACAAGGTCCTTTGACAGCCATCGCTGAATTGGA
AAGCTCGCAAGAAATTCAAAGGAAGAAATccaaagATATCAAGAAGACTG
GTTCAGCATCAACCCTTAGTGCGTCAGGCTCATCACATAGCAAGAAAGCT
AGTCTCTCATCTCCCGGCCCTTCGACATCAAACAACGGAGACAAAAAAGC
GAGACCGGTACCAAGTTATATGCAACCTACAAAAAGTTCTAGAGCTCCCA
AAAACCCAAATATCAAGGGTAAGAAGAAATAGATGCCCATACTAAGATAC
AAAAACCAAAGCACAAGACAAGTAAAACATACAAGATTAGATGATGATGT
AGATTTTGAACAACACTTTGATTATGGCATCTTACTTGGCAAAGGTAGTT
TTGGCACCGTCAATGAGGCTATTAGAATCGATTCTGGAGAAAAATTTGCA
GTCAAAGTTATTAATAAGGAAAAGGCTGGGAGTGCTGCTGTAAAACTATT
AGAAAGGGAAGTTGCTATTATGAAAAAAGTTGATCATCCAAACATTATCT
TCCTGGAGGAGGTTCTAGAAACACAGACGaaAATGTATCTAGTAATGGAA
TTATGTTCTCATGGAGGATTGGAAGAAATGCTCAatgaaaggaaatattt
tttggaacAAGATGTGTTGGTAATCATGCAGCAACTTGCAGATGCCATCG
CATACATCCATGAAAATGACATCGTACATCGTGATTTGAAATTGGATAAC
ATATTACTGGCTGAACCCACAGATGAGCTACCTTTTAATGTTAAGCTGAC
AGATTTTGGATTGTCATATACACGTGGTGGTTCGGGTAGTGATTACATGA
TGAACCAAGTGGTGGGAACACCTATTTATATGGcgcCAGAAGTGATAACC
AACTATGGATACAGTCAACAATGTGATATTTGGAGTCTTGGTGTCATACT
TTTCAAACTGATTACTGGAAATCCACCATTCATGTCATTTTCCGAAGAAG
ATCTTTTCGATTTGATAAAGAAAGGAGAACTCCAGTTTTCTCATGAAAAT
TGGAAGAATGTCTCACCCGCTGCTAAAGAATTGGTGGAGGGATTGATGAA
AGTTGACCCTGCTCATCGCTTAACTTCTAAAGAAATTGTCTCGCATCCTT
GGATAAAGGGCGAACAAGAAATGAACGGTACGAAAACAATTAATGTGTTG
GAAATGATGAAGGAATATAATATCGAACAGAAAAAGctAGCAGAAGAGCA
ACAGTTAAAAGAGCAGCAACTACTCCAACAACTAAACAATGCAAATGAAC
AAAATGCTGACCCGACCGACAATGAACAAGGTCCTTTGACAGCCATCGCT
GAATTGGAAAGCTCGCAAGAAATTCAAAGGAAGAAATccaaagATATCAA
GAAGACTGGTTCAGCATCAACCCTTAGTGCGTCAGGCTCATCACATAGCA
AGAAAGCTAGTCTCTCATCTCCCGGCCCTTCGACATCAAACAACGGAGAC
AAAAAAGCGAGACCGGTACCAAGTTATATGCAACCTACAAAAAGTTCTAG
AGCTCCCAAAAACCCAAATATCAAGGGTAAGAAGAAATAGATGCCCATAC
TAAGATACAAAAACCAAAGCACAAGACAAGTAAAACATACAAGATTAGAT
GATGATGTAGATTTTGAACAACACTTTGATTATGGCATCTTACTTGGCAA
AGGTAGTTTTGGCACCGTCAATGAGGCTATTAGAATCGATTCTGGAGAAA
AATTTGCAGTCAAAGTTATTAATAAGGAAAAGGCTGGGAGTGCTGCTGTA
AAACTATTAGAAAGGGAAGTTGCTATTATGAAAAAAGTTGATCATCCAAA
CATTATCTTCCTGGAGGAGGTTCTAGAAACACAGACGaaAATGTATCTAG
TAATGGAATTATGTTCTCATGGAGGATTGGAAGAAATGCTCAatgaaagg
aaatattttttggaacAAGATGTGTTGGTAATCATGCAGCAACTTGCAGA
TGCCATCGCATACATCCATGAAAATGACATCGTACATCGTGATTTGAAAT
TGGATAACATATTACTGGCTGAACCCACAGATGAGCTACCTTTTAATGTT
AAGCTGACAGATTTTGGATTGTCATATACACGTGGTGGTTCGGGTAGTGA
TTACATGATGAACCAAGTGGTGGGAACACCTATTTATATGGcgcCAGAAG
TGATAACCAACTATGGATACAGTCAACAATGTGATATTTGGAGTCTTGGT
GTCATACTTTTCAAACTGATTACTGGAAATCCACCATTCATGTCATTTTC
CGAAGAAGATCTTTTCGATTTGATAAAGAAAGGAGAACTCCAGTTTTCTC
ATGAAAATTGGAAGAATGTCTCACCCGCTGCTAAAGAATTGGTGGAGGGA
TTGATGAAAGTTGACCCTGCTCATCGCTTAACTTCTAAAGAAATTGTCTC
GCATCCTTGGATAAAGGGCGAACAAGAAATGAACGGTACGAAAACAATTA
ATGTGTTGGAAATGATGAAGGAATATAATATCGAACAGAAAAAGctAGCA
GAAGAGCAACAGTTAAAAGAGCAGCAACTACTCCAACAACTAAACAATGC
AAATGAACAAAATGCTGACCCGACCGACAATGAACAAGGTCCTTTGACAG
CCATCGCTGAATTGGAAAGCTCGCAAGAAATTCAAAGGAAGAAATccaaa
gATATCAAGAAGACTGGTTCAGCATCAACCCTTAGTGCGTCAGGCTCATC
ACATAGCAAGAAAGCTAGTCTCTCATCTCCCGGCCCTTCGACATCAAACA
ACGGAGACAAAAAAGCGAGACCGGTACCAAGTTATATGCAACCTACAAAA
AGTTCTAGAGCTCCCAAAAACCCAAATATCAAGGGTAAGAAGAAATAGAT
GCCCATACTAAGATACAAAAACCAAAGCACAAGACAAGTAAAACATACAA
GATTAGATGATGATGTAGATTTTGAACAACACTTTGATTATGGCATCTTA
CTTGGCAAAGGTAGTTTTGGCACCGTCAATGAGGCTATTAGAATCGATTC
TGGAGAAAAATTTGCAGTCAAAGTTATTAATAAGGAAAAGGCTGGGAGTG
CTGCTGTAAAACTATTAGAAAGGGAAGTTGCTATTATGAAAAAAGTTGAT
CATCCAAACATTATCTTCCTGGAGGAGGTTCTAGAAACACAGACGaaAAT
GTATCTAGTAATGGAATTATGTTCTCATGGAGGATTGGAAGAAATGCTCA
atgaaaggaaatattttttggaacAAGATGTGTTGGTAATCATGCAGCAA
CTTGCAGATGCCATCGCATACATCCATGAAAATGACATCGTACATCGTGA
TTTGAAATTGGATAACATATTACTGGCTGAACCCACAGATGAGCTACCTT
TTAATGTTAAGCTGACAGATTTTGGATTGTCATATACACGTGGTGGTTCG
GGTAGTGATTACATGATGAACCAAGTGGTGGGAACACCTATTTATATGGc
gcCAGAAGTGATAACCAACTATGGATACAGTCAACAATGTGATATTTGGA
GTCTTGGTGTCATACTTTTCAAACTGATTACTGGAAATCCACCATTCATG
TCATTTTCCGAAGAAGATCTTTTCGATTTGATAAAGAAAGGAGAACTCCA
GTTTTCTCATGAAAATTGGAAGAATGTCTCACCCGCTGCTAAAGAATTGG
TGGAGGGATTGATGAAAGTTGACCCTGCTCATCGCTTAACTTCTAAAGAA
ATTGTCTCGCATCCTTGGATAAAGGGCGAACAAGAAATGAACGGTACGAA
AACAATTAATGTGTTGGAAATGATGAAGGAATATAATATCGAACAGAAAA
AGctAGCAGAAGAGCAACAGTTAAAAGAGCAGCAACTACTCCAACAACTA
AACAATGCAAATGAACAAAATGCTGACCCGACCGACAATGAACAAGGTCC
TTTGACAGCCATCGCTGAATTGGAAAGCTCGCAAGAAATTCAAAGGAAGA
AATccaaagATATCAAGAAGACTGGTTCAGCATCAACCCTTAGTGCGTCA
GGCTCATCACATAGCAAGAAAGCTAGTCTCTCATCTCCCGGCCCTTCGAC
ATCAAACAACGGAGACAAAAAAGCGAGACCGGTACCAAGTTATATGCAAC
CTACAAAAAGTTCTAGAGCTCCCAAAAACCCAAATATCAAGGGTAAGAAG
AAATAGATGCCCATACTAAGATACAAAAACCAAAGCACAAGACAAGTAAA
ACATACAAGATTAGATGATGATGTAGATTTTGAACAACACTTTGATTATG
GCATCTTACTTGGCAAAGGTAGTTTTGGCACCGTCAATGAGGCTATTAGA
ATCGATTCTGGAGAAAAATTTGCAGTCAAAGTTATTAATAAGGAAAAGGC
TGGGAGTGCTGCTGTAAAACTATTAGAAAGGGAAGTTGCTATTATGAAAA
AAGTTGATCATCCAAACATTATCTTCCTGGAGGAGGTTCTAGAAACACAG
ACGaaAATGTATCTAGTAATGGAATTATGTTCTCATGGAGGATTGGAAGA
AATGCTCAatgaaaggaaatattttttggaacAAGATGTGTTGGTAATCA
TGCAGCAACTTGCAGATGCCATCGCATACATCCATGAAAATGACATCGTA
CATCGTGATTTGAAATTGGATAACATATTACTGGCTGAACCCACAGATGA
GCTACCTTTTAATGTTAAGCTGACAGATTTTGGATTGTCATATACACGTG
GTGGTTCGGGTAGTGATTACATGATGAACCAAGTGGTGGGAACACCTATT
TATATGGcgcCAGAAGTGATAACCAACTATGGATACAGTCAACAATGTGA
TATTTGGAGTCTTGGTGTCATACTTTTCAAACTGATTACTGGAAATCCAC
CATTCATGTCATTTTCCGAAGAAGATCTTTTCGATTTGATAAAGAAAGGA
GAACTCCAGTTTTCTCATGAAAATTGGAAGAATGTCTCACCCGCTGCTAA
AGAATTGGTGGAGGGATTGATGAAAGTTGACCCTGCTCATCGCTTAACTT
CTAAAGAAATTGTCTCGCATCCTTGGATAAAGGGCGAACAAGAAATGAAC
GGTACGAAAACAATTAATGTGTTGGAAATGATGAAGGAATATAATATCGA
ACAGAAAAAGctAGCAGAAGAGCAACAGTTAAAAGAGCAGCAACTACTCC
AACAACTAAACAATGCAAATGAACAAAATGCTGACCCGACCGACAATGAA
CAAGGTCCTTTGACAGCCATCGCTGAATTGGAAAGCTCGCAAGAAATTCA
AAGGAAGAAATccaaagATATCAAGAAGACTGGTTCAGCATCAACCCTTA
GTGCGTCAGGCTCATCACATAGCAAGAAAGCTAGTCTCTCATCTCCCGGC
CCTTCGACATCAAACAACGGAGACAAAAAAGCGAGACCGGTACCAAGTTA
TATGCAACCTACAAAAAGTTCTAGAGCTCCCAAAAACCCAAATATCAAGG
GTAAGAAGAAATAGATGCCCATACTAAGATACAAAAACCAAAGCACAAGA
CAAGTAAAACATACAAGATTAGATGATGATGTAGATTTTGAACAACACTT
TGATTATGGCATCTTACTTGGCAAAGGTAGTTTTGGCACCGTCAATGAGG
CTATTAGAATCGATTCTGGAGAAAAATTTGCAGTCAAAGTTATTAATAAG
GAAAAGGCTGGGAGTGCTGCTGTAAAACTATTAGAAAGGGAAGTTGCTAT
TATGAAAAAAGTTGATCATCCAAACATTATCTTCCTGGAGGAGGTTCTAG
AAACACAGACGaaAATGTATCTAGTAATGGAATTATGTTCTCATGGAGGA
TTGGAAGAAATGCTCAatgaaaggaaatattttttggaacAAGATGTGTT
GGTAATCATGCAGCAACTTGCAGATGCCATCGCATACATCCATGAAAATG
ACATCGTACATCGTGATTTGAAATTGGATAACATATTACTGGCTGAACCC
ACAGATGAGCTACCTTTTAATGTTAAGCTGACAGATTTTGGATTGTCATA
TACACGTGGTGGTTCGGGTAGTGATTACATGATGAACCAAGTGGTGGGAA
CACCTATTTATATGGcgcCAGAAGTGATAACCAACTATGGATACAGTCAA
CAATGTGATATTTGGAGTCTTGGTGTCATACTTTTCAAACTGATTACTGG
AAATCCACCATTCATGTCATTTTCCGAAGAAGATCTTTTCGATTTGATAA
AGAAAGGAGAACTCCAGTTTTCTCATGAAAATTGGAAGAATGTCTCACCC
GCTGCTAAAGAATTGGTGGAGGGATTGATGAAAGTTGACCCTGCTCATCG
CTTAACTTCTAAAGAAATTGTCTCGCATCCTTGGATAAAGGGCGAACAAG
AAATGAACGGTACGAAAACAATTAATGTGTTGGAAATGATGAAGGAATAT
AATATCGAACAGAAAAAGctAGCAGAAGAGCAACAGTTAAAAGAGCAGCA
ACTACTCCAACAACTAAACAATGCAAATGAACAAAATGCTGACCCGACCG
ACAATGAACAAGGTCCTTTGACAGCCATCGCTGAATTGGAAAGCTCGCAA
GAAATTCAAAGGAAGAAATccaaagATATCAAGAAGACTGGTTCAGCATC
AACCCTTAGTGCGTCAGGCTCATCACATAGCAAGAAAGCTAGTCTCTCAT
CTCCCGGCCCTTCGACATCAAACAACGGAGACAAAAAAGCGAGACCGGTA
CCAAGTTATATGCAACCTACAAAAAGTTCTAGAGCTCCCAAAAACCCAAA
TATCAAGGGTAAGAAGAAATAGATGCCCATACTAAGATACAAAAACCAAA
GCACAAGACAAGTAAAACATACAAGATTAGATGATGATGTAGATTTTGAA
CAACACTTTGATTATGGCATCTTACTTGGCAAAGGTAGTTTTGGCACCGT
CAATGAGGCTATTAGAATCGATTCTGGAGAAAAATTTGCAGTCAAAGTTA
TTAATAAGGAAAAGGCTGGGAGTGCTGCTGTAAAACTATTAGAAAGGGAA
GTTGCTATTATGAAAAAAGTTGATCATCCAAACATTATCTTCCTGGAGGA
GGTTCTAGAAACACAGACGaaAATGTATCTAGTAATGGAATTATGTTCTC
ATGGAGGATTGGAAGAAATGCTCAatgaaaggaaatattttttggaacAA
GATGTGTTGGTAATCATGCAGCAACTTGCAGATGCCATCGCATACATCCA
TGAAAATGACATCGTACATCGTGATTTGAAATTGGATAACATATTACTGG
CTGAACCCACAGATGAGCTACCTTTTAATGTTAAGCTGACAGATTTTGGA
TTGTCATATACACGTGGTGGTTCGGGTAGTGATTACATGATGAACCAAGT
GGTGGGAACACCTATTTATATGGcgcCAGAAGTGATAACCAACTATGGAT
ACAGTCAACAATGTGATATTTGGAGTCTTGGTGTCATACTTTTCAAACTG
ATTACTGGAAATCCACCATTCATGTCATTTTCCGAAGAAGATCTTTTCGA
TTTGATAAAGAAAGGAGAACTCCAGTTTTCTCATGAAAATTGGAAGAATG
TCTCACCCGCTGCTAAAGAATTGGTGGAGGGATTGATGAAAGTTGACCCT
GCTCATCGCTTAACTTCTAAAGAAATTGTCTCGCATCCTTGGATAAAGGG
CGAACAAGAAATGAACGGTACGAAAACAATTAATGTGTTGGAAATGATGA
AGGAATATAATATCGAACAGAAAAAGctAGCAGAAGAGCAACAGTTAAAA
GAGCAGCAACTACTCCAACAACTAAACAATGCAAATGAACAAAATGCTGA
CCCGACCGACAATGAACAAGGTCCTTTGACAGCCATCGCTGAATTGGAAA
GCTCGCAAGAAATTCAAAGGAAGAAATccaaagATATCAAGAAGACTGGT
TCAGCATCAACCCTTAGTGCGTCAGGCTCATCACATAGCAAGAAAGCTAG
TCTCTCATCTCCCGGCCCTTCGACATCAAACAACGGAGACAAAAAAGCGA
GACCGGTACCAAGTTATATGCAACCTACAAAAAGTTCTAGAGCTCCCAAA
AACCCAAATATCAAGGGTAAGAAGAAATAGATGCCCATACTAAGATACAA
AAACCAAAGCACAAGACAAGTAAAACATACAAGATTAGATGATGATGTAG
ATTTTGAACAACACTTTGATTATGGCATCTTACTTGGCAAAGGTAGTTTT
GGCACCGTCAATGAGGCTATTAGAATCGATTCTGGAGAAAAATTTGCAGT
CAAAGTTATTAATAAGGAAAAGGCTGGGAGTGCTGCTGTAAAACTATTAG
AAAGGGAAGTTGCTATTATGAAAAAAGTTGATCATCCAAACATTATCTTC
CTGGAGGAGGTTCTAGAAACACAGACGaaAATGTATCTAGTAATGGAATT
ATGTTCTCATGGAGGATTGGAAGAAATGCTCAatgaaaggaaatattttt
tggaacAAGATGTGTTGGTAATCATGCAGCAACTTGCAGATGCCATCGCA
TACATCCATGAAAATGACATCGTACATCGTGATTTGAAATTGGATAACAT
ATTACTGGCTGAACCCACAGATGAGCTACCTTTTAATGTTAAGCTGACAG
ATTTTGGATTGTCATATACACGTGGTGGTTCGGGTAGTGATTACATGATG
AACCAAGTGGTGGGAACACCTATTTATATGGcgcCAGAAGTGATAACCAA
CTATGGATACAGTCAACAATGTGATATTTGGAGTCTTGGTGTCATACTTT
TCAAACTGATTACTGGAAATCCACCATTCATGTCATTTTCCGAAGAAGAT
CTTTTCGATTTGATAAAGAAAGGAGAACTCCAGTTTTCTCATGAAAATTG
GAAGAATGTCTCACCCGCTGCTAAAGAATTGGTGGAGGGATTGATGAAAG
TTGACCCTGCTCATCGCTTAACTTCTAAAGAAATTGTCTCGCATCCTTGG
ATAAAGGGCGAACAAGAAATGAACGGTACGAAAACAATTAATGTGTTGGA
AATGATGAAGGAATATAATATCGAACAGAAAAAGctAGCAGAAGAGCAAC
AGTTAAAAGAGCAGCAACTACTCCAACAACTAAACAATGCAAATGAACAA
AATGCTGACCCGACCGACAATGAACAAGGTCCTTTGACAGCCATCGCTGA
ATTGGAAAGCTCGCAAGAAATTCAAAGGAAGAAATccaaagATATCAAGA
AGACTGGTTCAGCATCAACCCTTAGTGCGTCAGGCTCATCACATAGCAAG
AAAGCTAGTCTCTCATCTCCCGGCCCTTCGACATCAAACAACGGAGACAA
AAAAGCGAGACCGGTACCAAGTTATATGCAACCTACAAAAAGTTCTAGAG
CTCCCAAAAACCCAAATATCAAGGGTAAGAAGAAATAGATGCCCATACTA
AGATACAAAAACCAAAGCACAAGACAAGTAAAACATACAAGATTAGATGA
TGATGTAGATTTTGAACAACACTTTGATTATGGCATCTTACTTGGCAAAG
GTAGTTTTGGCACCGTCAATGAGGCTATTAGAATCGATTCTGGAGAAAAA
TTTGCAGTCAAAGTTATTAATAAGGAAAAGGCTGGGAGTGCTGCTGTAAA
ACTATTAGAAAGGGAAGTTGCTATTATGAAAAAAGTTGATCATCCAAACA
TTATCTTCCTGGAGGAGGTTCTAGAAACACAGACGaaAATGTATCTAGTA
ATGGAATTATGTTCTCATGGAGGATTGGAAGAAATGCTCAatgaaaggaa
atattttttggaacAAGATGTGTTGGTAATCATGCAGCAACTTGCAGATG
CCATCGCATACATCCATGAAAATGACATCGTACATCGTGATTTGAAATTG
GATAACATATTACTGGCTGAACCCACAGATGAGCTACCTTTTAATGTTAA
GCTGACAGATTTTGGATTGTCATATACACGTGGTGGTTCGGGTAGTGATT
ACATGATGAACCAAGTGGTGGGAACACCTATTTATATGGcgcCAGAAGTG
ATAACCAACTATGGATACAGTCAACAATGTGATATTTGGAGTCTTGGTGT
CATACTTTTCAAACTGATTACTGGAAATCCACCATTCATGTCATTTTCCG
AAGAAGATCTTTTCGATTTGATAAAGAAAGGAGAACTCCAGTTTTCTCAT
GAAAATTGGAAGAATGTCTCACCCGCTGCTAAAGAATTGGTGGAGGGATT
GATGAAAGTTGACCCTGCTCATCGCTTAACTTCTAAAGAAATTGTCTCGC
ATCCTTGGATAAAGGGCGAACAAGAAATGAACGGTACGAAAACAATTAAT
GTGTTGGAAATGATGAAGGAATATAATATCGAACAGAAAAAGctAGCAGA
AGAGCAACAGTTAAAAGAGCAGCAACTACTCCAACAACTAAACAATGCAA
ATGAACAAAATGCTGACCCGACCGACAATGAACAAGGTCCTTTGACAGCC
ATCGCTGAATTGGAAAGCTCGCAAGAAATTCAAAGGAAGAAATccaaagA
TATCAAGAAGACTGGTTCAGCATCAACCCTTAGTGCGTCAGGCTCATCAC
ATAGCAAGAAAGCTAGTCTCTCATCTCCCGGCCCTTCGACATCAAACAAC
GGAGACAAAAAAGCGAGACCGGTACCAAGTTATATGCAACCTACAAAAAG
TTCTAGAGCTCCCAAAAACCCAAATATCAAGGGTAAGAAGAAATAGATGC
CCATACTAAGATACAAAAACCAAAGCACAAGACAAGTAAAACATACAAGA
TTAGATGATGATGTAGATTTTGAACAACACTTTGATTATGGCATCTTACT
TGGCAAAGGTAGTTTTGGCACCGTCAATGAGGCTATTAGAATCGATTCTG
GAGAAAAATTTGCAGTCAAAGTTATTAATAAGGAAAAGGCTGGGAGTGCT
GCTGTAAAACTATTAGAAAGGGAAGTTGCTATTATGAAAAAAGTTGATCA
TCCAAACATTATCTTCCTGGAGGAGGTTCTAGAAACACAGACGaaAATGT
ATCTAGTAATGGAATTATGTTCTCATGGAGGATTGGAAGAAATGCTCAat
gaaaggaaatattttttggaacAAGATGTGTTGGTAATCATGCAGCAACT
TGCAGATGCCATCGCATACATCCATGAAAATGACATCGTACATCGTGATT
TGAAATTGGATAACATATTACTGGCTGAACCCACAGATGAGCTACCTTTT
AATGTTAAGCTGACAGATTTTGGATTGTCATATACACGTGGTGGTTCGGG
TAGTGATTACATGATGAACCAAGTGGTGGGAACACCTATTTATATGGcgc
CAGAAGTGATAACCAACTATGGATACAGTCAACAATGTGATATTTGGAGT
CTTGGTGTCATACTTTTCAAACTGATTACTGGAAATCCACCATTCATGTC
ATTTTCCGAAGAAGATCTTTTCGATTTGATAAAGAAAGGAGAACTCCAGT
TTTCTCATGAAAATTGGAAGAATGTCTCACCCGCTGCTAAAGAATTGGTG
GAGGGATTGATGAAAGTTGACCCTGCTCATCGCTTAACTTCTAAAGAAAT
TGTCTCGCATCCTTGGATAAAGGGCGAACAAGAAATGAACGGTACGAAAA
CAATTAATGTGTTGGAAATGATGAAGGAATATAATATCGAACAGAAAAAG
ctAGCAGAAGAGCAACAGTTAAAAGAGCAGCAACTACTCCAACAACTAAA
CAATGCAAATGAACAAAATGCTGACCCGACCGACAATGAACAAGGTCCTT
TGACAGCCATCGCTGAATTGGAAAGCTCGCAAGAAATTCAAAGGAAGAAA
TccaaagATATCAAGAAGACTGGTTCAGCATCAACCCTTAGTGCGTCAGG
CTCATCACATAGCAAGAAAGCTAGTCTCTCATCTCCCGGCCCTTCGACAT
CAAACAACGGAGACAAAAAAGCGAGACCGGTACCAAGTTATATGCAACCT
ACAAAAAGTTCTAGAGCTCCCAAAAACCCAAATATCAAGGGTAAGAAGAA
ATAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000457XLOC_000457Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000725-exon-sc0000005-1491911889:945087..945402TCONS_00000725-exon-sc0000005-1491911889:945087..945402Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:945087..945402TCONS_00000725-exon-sc0000005-1510915933:945087..945402Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:945087..945402TCONS_00000725-exon-sc0000005-1575043694:945087..945402Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1491911889:945700..945804TCONS_00000725-exon-sc0000005-1491911889:945700..945804Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:945700..945804TCONS_00000725-exon-sc0000005-1510915933:945700..945804Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:945700..945804TCONS_00000725-exon-sc0000005-1575043694:945700..945804Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1491911889:946337..946417TCONS_00000725-exon-sc0000005-1491911889:946337..946417Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:946337..946417TCONS_00000725-exon-sc0000005-1510915933:946337..946417Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:946337..946417TCONS_00000725-exon-sc0000005-1575043694:946337..946417Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1491911889:946556..946613TCONS_00000725-exon-sc0000005-1491911889:946556..946613Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:946556..946613TCONS_00000725-exon-sc0000005-1510915933:946556..946613Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:946556..946613TCONS_00000725-exon-sc0000005-1575043694:946556..946613Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1491911889:947069..947145TCONS_00000725-exon-sc0000005-1491911889:947069..947145Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:947069..947145TCONS_00000725-exon-sc0000005-1510915933:947069..947145Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:947069..947145TCONS_00000725-exon-sc0000005-1575043694:947069..947145Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1491911889:947636..947723TCONS_00000725-exon-sc0000005-1491911889:947636..947723Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:947636..947723TCONS_00000725-exon-sc0000005-1510915933:947636..947723Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:947636..947723TCONS_00000725-exon-sc0000005-1575043694:947636..947723Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1491911889:948095..948170TCONS_00000725-exon-sc0000005-1491911889:948095..948170Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:948095..948170TCONS_00000725-exon-sc0000005-1510915933:948095..948170Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:948095..948170TCONS_00000725-exon-sc0000005-1575043694:948095..948170Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1491911889:948394..948506TCONS_00000725-exon-sc0000005-1491911889:948394..948506Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:948394..948506TCONS_00000725-exon-sc0000005-1510915933:948394..948506Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:948394..948506TCONS_00000725-exon-sc0000005-1575043694:948394..948506Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1491911889:948935..949020TCONS_00000725-exon-sc0000005-1491911889:948935..949020Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:948935..949020TCONS_00000725-exon-sc0000005-1510915933:948935..949020Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:948935..949020TCONS_00000725-exon-sc0000005-1575043694:948935..949020Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1491911889:950331..950408TCONS_00000725-exon-sc0000005-1491911889:950331..950408Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:950331..950408TCONS_00000725-exon-sc0000005-1510915933:950331..950408Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:950331..950408TCONS_00000725-exon-sc0000005-1575043694:950331..950408Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1491911889:950670..950789TCONS_00000725-exon-sc0000005-1491911889:950670..950789Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:950670..950789TCONS_00000725-exon-sc0000005-1510915933:950670..950789Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:950670..950789TCONS_00000725-exon-sc0000005-1575043694:950670..950789Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1491911889:957960..957995TCONS_00000725-exon-sc0000005-1491911889:957960..957995Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:957960..957995TCONS_00000725-exon-sc0000005-1510915933:957960..957995Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:957960..957995TCONS_00000725-exon-sc0000005-1575043694:957960..957995Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1491911889:958281..958488TCONS_00000725-exon-sc0000005-1491911889:958281..958488Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:958281..958488TCONS_00000725-exon-sc0000005-1510915933:958281..958488Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:958281..958488TCONS_00000725-exon-sc0000005-1575043694:958281..958488Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1491911889:958942..959262TCONS_00000725-exon-sc0000005-1491911889:958942..959262Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1510915933:958942..959262TCONS_00000725-exon-sc0000005-1510915933:958942..959262Clytia hemisphaericaexon
TCONS_00000725-exon-sc0000005-1575043694:958942..959262TCONS_00000725-exon-sc0000005-1575043694:958942..959262Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000725-proteinTCONS_00000725-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000005supercontigsc0000005:945087..959262 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
89.07 88.234 166.423 172.572 12.4667 7.17359 14.7438 14.9714 30.5921 29.832 21.0066 29.5177 8.31252 5.05506 8.56712 11.1764 15.2002 14.5647 8.18259 10.8906 13.7339 15.0297 40.4935 35.1945 13.8751 9.75904 35.6477 37.4397 21.2906 21.9679
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
molecular_function GO:0005524 ATP binding
molecular_function GO:0004672 protein kinase activity
Blast
BLAST of TCONS_00000725 vs. Swiss-Prot (Human)
Match: STK33 (Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 6.252e-105
Identity = 158/304 (51.97%), Postives = 222/304 (73.03%), Query Frame = 2
Query:  161 QVKHTRLDDDVDFEQHFDYGILLGKGSFGTVNEAIRIDSGEKFAVKVINKEKAGSAAVKLLEREVAIMKKVDHPNIIFLEEVLETQTKMYLVMELCSHGGLEEMLNERKYFLEQDVLVIMQQLADAIAYIHENDIVHRDLKLDNIL----LAEPTDELPFNVKLTDFGLSYTRGGSGSDYMMNQVVGTPIYMAPEVITNYGYSQQCDIWSLGVILFKLITGNPPFMSFSEEDLFDLIKKGELQFSHENWKNVSPAAKELVEGLMKVDPAHRLTSKEIVSHPWIKGEQEMNGTKTINVLEMMKEY 1060
            +V H R+++    E+ + +G +LGKGSFG V EA   ++  K+A+K +NKEKAGS+AVKLLEREV I+K V H +II LE+V ET  KMYLVMELC  G L+E+L+ + +F E +   I+Q LA AIAY+H NDIVHRDLKL+NI+    L +  +E+  N+K+TDFGL+  +  S S+ M+    GTPIYMAPEVI+ + YSQQCDIWS+GV+++ L+ G PPF++ SEE LF+LI+KGEL F +  W ++S  AK +++ LMKVDPAHR+T+KE++ + W+ G + ++  +  NVLEMMKE+
Sbjct:  100 KVPHIRIENGAAIEEIYTFGRILGKGSFGIVIEATDKETETKWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQVFETPKKMYLVMELCEDGELKEILDRKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLKLENIMVKSSLIDDNNEINLNIKVTDFGLA-VKKQSRSEAMLQATCGTPIYMAPEVISAHDYSQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFENAVWNSISDCAKSVLKQLMKVDPAHRITAKELLDNQWLTGNK-LSSVRPTNVLEMMKEW 401          
The following BLAST results are available for this feature:
BLAST of TCONS_00000725 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
STK336.252e-10551.97Serine/threonine-protein kinase 33 OS=Homo sapiens... [more]
back to top