Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000697 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000697
Unique NameTCONS_00000697
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3776

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000697 ID=TCONS_00000697|Name=TCONS_00000697|organism=Clytia hemisphaerica|type=transcript|length=3776bp
CGACGCGGGAAATGTAATCTGACAtctgattttttaaatatatactTTGT
ACATGTTTGGCCtaattttacaatatttttagaatattatactcaaaaaa
tggctgaTCAAGTTGACGAAAAAACAATCCAAAATACTGATGAAGTATCT
AAGGAAGAAACCAAAGAAGAGGAGGTGACAACGAAAAAGGAAGATGAGAA
GACAAATGAACAAGAATCGGAAGGAGAATCTACTGATGATGAAGATGACA
AACCAAAACCGCCACCAGTTAAAATCAATAAAGCTATGGCTGTCAATGAA
GAATACAATGAAAAGATGGAACATGATAGAGCATCAAGATTCAGTTTTCT
ATTAAAACAAACTGAAATATTTTCCCATTTCTTAAATGGAGCTGGTAAAA
AGCCACCAAAAAgtcctttaaaaatgaaaaagcagCCTGATCTTCCTTCC
AGTCCACCACCAAAGAAGGGGGCTAAAGACCATCGTCATCGACGTaccga
gaaagaagaagatgaagagcTTTTGGAAGATTCCAAGAGTTCTCAAGCAC
ATGTTGTTCAATTCACCGCTTCACCTTCATATATTAAATTTGGAACAATG
AGGGACTACCAGATTAGAGGATTGAATTGGATGATTTCGCTTTATGAAAA
TGGTATCAATGGAATTCTAGCTGATGAAATGggTCTTGGTAAAACTTTGC
AAACTATTTCATTGATTGGTTACATGAAACATCACAGAAACAACTCTGGT
CCACACATTGTAATTGTTCCCAAATCCACTCTTGCTAATTGGATGGCTGA
GTTTGCAAGATGGTGTCCAACTATAAGGACAGTTTGTTTAATTGGTAACC
AAGATCAGAGGTCAGCAATAATCAGAGATACATTGCTACCGGGAGAATGG
GATGTTCTTGTTACATCATACGAAATGTGTATTCGTGAAAAAACTGTACT
CAAGAAATTCGCTTGGAGATTCTTGTGTATTGATGAAGCTCAcagaatca
aaaatgaaaaatcactgCTTTCAAGCATTGTTCGTGAATTCAAATCATCA
AACAGACTTCTGCTCACTGGTACCCCACTACAAAATAACCTCCATGAATT
ATGGGCTTTGTTAAATTTCTTACTCCCTGATGTGTTCAATTCGTCTGATG
ACTTCGATGCTTGGTTTAATGCTGAGAATTTGTCCGAAGAAGATGCCATT
GTCAAACGGTTGCACGCTGTTTTACGTCCTTTCTTACTACGTCGTTTGAA
AAGTGAAGTCGAGAAATCTCTCCTTCCAAAGAAGATCACCAACGTTTACA
TAGGATTGAGTGCAATGCAAAGACAATGGTACACCAAGTTACTGATGAAG
GATATTGATATTGTCAACGGTGCTGGTAAAACTGACCGGATGAGATTGTT
GAATATCCTTATGCAGCTTCGAAAATGTTGTAATCACCCTTATCTTTTCG
ATGGAGCTGAACCTGGACCACCATATACAACAGACGTTCATTTGGTTGAT
AATTGCGGTAAAATGAGTGTCTTGGATAAACTGTTGGTGAGAATGAAGGA
GCGAGGATCACGTGTTTTGGTGTTTAGTCAGATGACTCGTATGCTTGATA
TCCTGGAAGATTACTCTATGTGGAGAGGTTTCCAATACTGTCGATTGGAC
GGTCAAACACCACATGAAGAACGTACCGCTCAAATTAACGATTTCAACTC
ACCTGGAAGTgacaaatttgtgttttttctgAGTACACGTGCTGGAGGTC
TGGGTATCAATCTTGCAACAGCTGATGTGGTCGTCATGTTTGATAATGAT
TGGAATCCACAAGTCGATCTCCAAGCACAGGATCGAGCACATCGTATCGG
TCAAACCAAACAAGTACAAGTATTCCGTTTCATCACCGAAAACACCATCG
AAGAAAGAATTATTGAACGTGCTGAAATGAAATTACGTCTTGATCGTGTT
GTCATTCAACAAGGTCGATTGGTGGAAGGACAAACGAAACTACAGAAGGA
TGAAGTACTGAACATGATTCGACATGGTGCTGATAAAGTCTTCGCTTCCA
AAGATTCAACTGTCACTGGTGAAGATATTGATCTTATCTTGGAAAGAGGT
GCTAAGAAGACTGAGGAGATtgccaaaaaaatgtcagattTGGGCGAAGG
CCAACTCAAGAATTTCACCATGGATGCACCTGACAGTATTTACAAATTCG
AAGGTCAAGATTTCCGTGAGACGCACGATAAACCCGGCGTATCTCACTGG
ATCGAACCACCAAAGCGTGAACGTAAAGCCAACTACGCTGTTGACACCTA
CTTCAAAGAACTAATGAGAGTAAACGAGCCCAAAGCACCCAAAGCTCCTC
GACCACCCAAACAACCTAACGTCCAAGATTTCCAATTCTTTCCACCAAGA
TTATTCGAACTTTTGGATATCGAGATTTACAGCTACCGAAAGGGGATTGG
ATACAAGGTACCACGTGATTATGACATGGATGACGCCGAATCGAAGAAAT
TCCAAAAAGAAGAACAATCAAAGATCGATAATGCTGAACCACTGAGCGAA
GAAGAACAAACGGAAAAAGAACAATTGTTAGCTCAAGGTTTCACCAATTG
GAATAAACGCGATTTCAATCAATTCATCAAGGCTTGCGAGAAATACGGTC
GTGATGATTtgaattctatttgtaaagaagTGGAAGGGAAATCACAAGCG
GAGGTCCGAGAATATGCTGGTGTGTTTTGGGAACGTTGCAATGAGCTGAC
TGACATTGACAAAATCATGGCACAGATCGAACGTGGCGAAGCCAAAATTC
AACGAAGAATTTCTATTAAAAGAGCCATGGAGGCTAAGATGGCAAGGTAC
AAGTCACCGTTTCACCAGCTCCGCATACAATACGGAACTAACAAAGGAAA
GAATTATACCGAAGAAGAGGACAGGTTTATCGTATGCATGTTACACAAAT
TGGGATTCGATCGGGAGAATGTATACGAAGAATTACGTCAATCTGTCCGA
AGTGCTCCTCAATTTCGATTTGATTGGTTTATCAAATCTCGAACTGCAGT
GGAATTGCAAAGACGCTGCAACACTTTGATCACTCTCATTGAAAGAGAAA
ACCAAGAGCTTGAAGAGCGAGAGAAACGTGAAAAACGCAAAGGAGCCAAA
CCAAATGCTGCTAGAACCCCTGCTCAAGGAAAGAGGAAAAATGAAGTTGT
GGCTGCTAAACCCGCCAAGAAAGCCAAAAACTAATCGGAAGTTGTACGAG
GAGTCTATAATGCCATCCATTTCCATCTTTTATTGAGAACACCGTCACAT
GGATGAAGTTTATTTGTTCAGAGAGACACTTACATCAGGTTTTCATGCGG
TGATGAGTCAACTAGCACAAAATCTTTCGCTGTATTTATTTCCTTTTTAC
GTTACTAGTGTattatttttacaaaagaataaTCGCTACATGTTTTTAAA
TAGTTAACCTTTTGTTTTTTCAGATTCTCTATCAAacaattgtttcaatt
tttttattatgtaccttaagtggataaattttggcggggattaaatttgg
cgaatttggcgaattgtgccaaaattcggcaattcgccaaattaaatccc
cgccaaatttaacaaaaagagaattatttgaaaaatcacaactttttagt
atatttttgagtaattttcacccatttcagtgtgacaaaatttccaattc
gccaaataaaatccccgccaaattttacgaaattgatctatcgccaaatt
aaatccacgccaaaatttatccactt
Run BLAST on NCBI

protein sequence of TCONS_00000697-protein

>TCONS_00000697-protein ID=TCONS_00000697-protein|Name=TCONS_00000697-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1077bp
RRGKCNLTSDFLNIYFVHVWPNFTIFLEYYTQKMADQVDEKTIQNTDEVS
KEETKEEEVTTKKEDEKTNEQESEGESTDDEDDKPKPPPVKINKAMAVNE
EYNEKMEHDRASRFSFLLKQTEIFSHFLNGAGKKPPKSPLKMKKQPDLPS
SPPPKKGAKDHRHRRTEKEEDEELLEDSKSSQAHVVQFTASPSYIKFGTM
RDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLIGYMKHHRNNSG
PHIVIVPKSTLANWMAEFARWCPTIRTVCLIGNQDQRSAIIRDTLLPGEW
DVLVTSYEMCIREKTVLKKFAWRFLCIDEAHRIKNEKSLLSSIVREFKSS
NRLLLTGTPLQNNLHELWALLNFLLPDVFNSSDDFDAWFNAENLSEEDAI
VKRLHAVLRPFLLRRLKSEVEKSLLPKKITNVYIGLSAMQRQWYTKLLMK
DIDIVNGAGKTDRMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDVHLVD
NCGKMSVLDKLLVRMKERGSRVLVFSQMTRMLDILEDYSMWRGFQYCRLD
GQTPHEERTAQINDFNSPGSDKFVFFLSTRAGGLGINLATADVVVMFDND
WNPQVDLQAQDRAHRIGQTKQVQVFRFITENTIEERIIERAEMKLRLDRV
VIQQGRLVEGQTKLQKDEVLNMIRHGADKVFASKDSTVTGEDIDLILERG
AKKTEEIAKKMSDLGEGQLKNFTMDAPDSIYKFEGQDFRETHDKPGVSHW
IEPPKRERKANYAVDTYFKELMRVNEPKAPKAPRPPKQPNVQDFQFFPPR
LFELLDIEIYSYRKGIGYKVPRDYDMDDAESKKFQKEEQSKIDNAEPLSE
EEQTEKEQLLAQGFTNWNKRDFNQFIKACEKYGRDDLNSICKEVEGKSQA
EVREYAGVFWERCNELTDIDKIMAQIERGEAKIQRRISIKRAMEAKMARY
KSPFHQLRIQYGTNKGKNYTEEEDRFIVCMLHKLGFDRENVYEELRQSVR
SAPQFRFDWFIKSRTAVELQRRCNTLITLIERENQELEEREKREKRKGAK
PNAARTPAQGKRKNEVVAAKPAKKAKN
Run BLAST on NCBI

transcript from alignment at sc0000005:447901..462969+

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000697 ID=TCONS_00000697|Name=TCONS_00000697|organism=Clytia hemisphaerica|type=transcript|length=15069bp|location=Sequence derived from alignment at sc0000005:447901..462969+ (Clytia hemisphaerica)
CGACGCGGGAAATGTAATCTGACAtctgattttttaaatatatactTTGT ACATGTTTGGCCtaattttacaatatttttagaatattatactcaaaaaa tggctgaTCAAGTTGACGAAAAAACAATCCAAAATACTGATGAAGTATCT AAGGAAGAAACCAAAGAAGAGGAGGTGACAACGAAAAAGGAAGATGAGAA GACAAATGAACAAGAATCGGAAGGAGAATCTACTGTAAGCATGGTTAATT AAGTTTGAGGGTTAATGGCAGTGTAGGTGGAACTtccataccgtcaactg ctctaactttggactatctgacaaaacatggatgggacggcaattcggcc actaTTTCactagcaactccagaagatttttcaagttttaattttttttt caaaatctatcctatcttgtagagctttgaaaaagaaagaaaatgagggg tcataggNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNTAGCATACATAGAAAtaaagttccaagggttcaaagttcacgg aaaaatgaaacatttggtttgacgtcaacgaaagttgcatgacttctgga gtcgctaattTCACCGATAGCGACTCCAGAAAGTCAAGCAACttttgttg acgtcaaaccaaatgttttatttgtccgtgaactttgaacccttcgaaat ttttttctatgtatgctaaagcgttccggtttttactaaaagaaagcctG TGATCTTAGTTTTCCAGTAATAACACTGTGGACTCAgtctagacggcaaa ttggtaaagtgCCAAacgtttttgcaacattttctaAATTGTATTCCGAC GGGAGAAGAAAAAGTTGCAACTATTGATGAACTGAAAATGGAGGAAAATG TAGTTTagggctgaaactttgtatgtttatcagaaaaagggaggacgacc ctgccgacgcaccggactgtccggtgtatttgtccggtggcaaaaagtat cctttcacagtccggtgttgcatacagggaattttggacgccggacattt atgaaacaaaaaattaagaaacaccggacgcaccgaactggtcatgtccg gtgttttgattgtccggtgggaaaaaatatccttctctgaCACcagacat ccgacttccttaagtccagTGTAGAAATtatccggtggtaaaaaaaattc tcattttacaccagactttcgtgtgtccggtgttcgttaagtccggtgcg gcGGCAGGGTCCTAAAAAGGGTgatgaattcaaaaatcacattggctaat ttttagttctttcattttcatgtagtttttttcacttttttgcttcttta gcatgggaatgtccacAAAAAAAGCTtatatttctgccgaaatggatttt cttttcatttggggtttctcctttcagaaaaacttattctttacatataa ctttttgttcctctatttccagaggccccttgaaaatgggtcctactacc ttttttgactcatttcaacctttttcaagctacttttcttcaaaaacaaa aataaaacaatatcgTCAACTGCTCCGACAGTTactcacactagcgtccc gccaaaatgcatatcaaagattaatgctacaaaagcgctatatcgtttac ctgactctcaagcaagaaaatgcGCCGCAAACTTCTAAatggattcatga aaaaataacccggcgctttttaatgaaattaacattctcaaaaactatga gaaattgcctaaaatttgagccatagattaANNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNctgccg gataggctatttcccggaaattttgccagacctcaaacactgacccattt acatgtgcggaattgtttttacttaagcgtataaacaaggcctttaaaaa tcgaagcgctgtctcgggaattgaatgacaaatttgggttggttgatttt ggctgctgcacgttttattttgtttcaaactttcaagttttaattaattg tcttgcaaacttgattcagggaactctcatccttgttgttgcaaatacat cctgtagatgactgatgttgttttttctaaaagcttgatttcctagtgtg actaactgtccgacttgggactatctgacgcAACATGGGgcggccattcc accaccatttcaccgaacctccaaagtcatttgatttgagtttaataaAC CGCGTactaaaaaatacacgatttctctttcgtcACTCGCGCGGAAAGTT ACatactcgttatttgttaatcccatcgggcgattctctaattctccaat cagcgtccagtcattttgaatgaaagcaaaaaagttaaaaagggtgcgct accgtaacttggtctaatgttgacacctctcctctaattccgacaccctt tttatcagctgaaatttatagaaaggttgaaactgtttttcttttcttag tggtcagagaggaataatcctttttcaatcagtgattcaagctttcatat tactcctttctctaaagaagggtgtcggaattagacgNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNag ggggggtttggaaattttggtcaattttctaatCAAATACAAATTGTCAC AGTTTgtgttttaaagtaaaaaaaatatgtactatcaaaacaaaacacac ttgttgataattttgctggtaggtgggaaagcgagtttccttcgaaacgg attttctgtaaaaaaaaatcccccccggataagatttcattacaaaaggg ggggatgggtatataggaggggatgggtatataggaggggatgaaataaa cctaggggggttcatacccctctgcaaactatgtattagaccaacttaca gtatcagtgaaagttatcgtgacatgttatgacagaaagtatgattcata aacttggtggagttatcaaaacaaatttgttgtcaaagggATTTTAAACA GTAAGTGGAAATACAGGCCaaatatcaacagtcccatgtttcaaccaatc atgaggcccccccagcggtttgcgtgatggcgtgagtgggacttttttct tgcgtgatggcgtgattagagatttttttggcgtgatggcgtgatcaaaa TTTTCGCGTGATGCGTAATAGGGCAAAAGTTTGAGGCGTGATgtgtgatt tgggctatttttcgctattttttgggTGAAGacaaattttagcaattttc gtgatgcgtgatggagaaaaaatttttgcgtgatggcgtgattaggggta acgctggggggcctcaattatcccaagttagagctgttGACGGTATTACT TGGCTAGAAAAAGTTATACATGTTTTCTTTTCTCTCTACAGAATCAACAA GCCTCAACATTGGGCAGTTAAAGTCCGTTACAGGGGGGTGGGCAACGGCA GAGTTCCgaggcaaaatatttttttttaattcctgGATTTTGAATACAAA ATCAATATTTTGGTGGGAAAATCTGGAATTTCTGATACTTTTCTGATACT AAGATTTTGACAAATTATGTGGAATTTTCAAGGGTTCAAATAAAACTAct ccaaaatatttcaaataaagattgtttttaagttatgtgttcacctttct tgacacattctctttaattgatcatatctttagaacaacaaatttttata tatcaaaagtatatattttctgaaagccaataacattctctttctaatgg taaaagtttcatttgaatttaaaaaactggacAGGATATAATTagaatct taagaattttaaccttacctacttcaaagaagttaaagtcacccatagct cttgaattttgaaaaaattatttcgatactatgttcccaatagattgaac taaaaaagtgtcttgggattttttttgggattgactttaactcttcaaat cctaaattctgtaaaaatatcgataaaaaagtaaatttaaatgtgatttt tttcagttatctgtaaattgaggaaaaacaatcCGGTtcagaaataaaat cctaagacactttttaagtttgatcttttgggaatctcataaaaaaagaa tgaagtcgatatctaaatgctatgaGTGACTTTAACTttgttaaaagtag tatggtgtggtaaaatttcgtttttttctacatcaatttgaaatttttga caagatgattgctgtttatttgagtaatcagtgaaatgtgtcaaaaatat tactattcaatagaggtgagaataaacatcatctgaattctctcttttgt ctttgttgtttccgaaagagacaattatttgagtaaataatccatcataa gacgaactttgttttgaaatttaaatggttataactctggatcaaaaaaa gattttaagatcgcgattttaccaaaatgaatccagtaacttttcttcca ctttgactgaaaaaaaattttttgacaaaaaatcggaaaaaaggtgtaca cataccttaaaatCAAGTTAGGATTTTTAGGCTGTCATAAGATGCATGAA AACACCTATTTAGGACATCTAGAGGGCAAATATTCCTCCtcacccaacca tggtgggcgacattttaAATACCACTGCATTGAAACTCAATTTTTTCTGA CCAAAACCCTGGTAaggaaaagtgcttggaaaatACCCTGCATTAACTTC TGGGGTATTTCTATAATCAACTGAAAAGATGCTAGCAAACTCTTTATTAA GAATTCCAGCATTATCTTTATCATTAGTGTATGGACTGGTATGGATAACA CCTTCATTAAGGGACTGACTCCGATGACATCTGACTTTTTAGATTTAATA AAGGCATATGACTTTTTTGAACAACCATCATTATCAAGtgtgttttcttt gatgtagtTGTTATATGCCTCGTTGCATTTGGTTCTAGCTTAATTTTTAG CAGATTTCTATTTCTTTCGTTCTTTTTCAAGCTTTGTCCTCTTGTACACA ATGGCAActgctatttttctttttggctgcTCTTTTGCAGTTTATATTAA ACCAGGGCTGGTTATATATGTATGGAATTCGATTCCCTGTAAACTTAATA GAGGAGTTTCTGtcttaggggtcactcacatattgattcttcccacgact aacctggactaacgtcaaattgacgctaatttgaaactgaaaatacaggc cagatatcaacagtcccatgtttccaCCAATCGTCCCACCAAGtcagagc agttgacggtatattttctccttcactttcatcgttgtttctTTCATCTT TAATTTTGCTACTGCTtgctcagtttacattttaaaatttaatggagata atttctgaactttttttttctgttgccagaattaattatctccgtaatca taatcaacagaatagcggcatttcaaaaagagaaaaaagaccGACCGTCT GCAAAATTCAAGGGCCGCGCGGACCATCTAAACAAAAAGAAGACATAAAC AttgggccgtttgttttggttaaaattgttctataaaATAGCAAAGCGAA CGGAATACTTAGGTAtataaaaagaggaaaagaaatatggaaagtaacat ttttcaagaaataaacggctcaaaaatcgatatttctggtgaaatttctt aacTCTAACCCCCAACCCcttcgcgtcaatttgacgttagtcgtgagaat cgatatgtgagtggcccTTTAGCTGAAAGGTTGGAAGGTCTGCTCCGTTc aaattttgcacctttgtGGGTAGATTGGTTTAATACTTGTCTGTCAATAC TTTTTTCATAGCCCTAGTCATAGTCCAGGCTTTTGACCCATAAAGAAAGA TTCAATTAAGGTTTTGAAAGTCTGCACCTCACCTATGCAACTCACTAGCT AAAGTCTTATTAATTGTACAGGATGATGAAGATGACAAACCAAAACCGCC ACCAGTTAAAATCAATAAAGCTATGGCTGTCAATGAAGAATACAATGAAA AGATGGAACATGATAGAGCATCAAGATTCAGTTTTCTATTAAAACAAACT GAAATATTTTCCCATTTCTTAAATGGAGCTGGTAAAAAGCCACCAAAAAg tcctttaaaaatgaaaaagcagCCTGATCTTCCTTCCAGTCCACCACCAA AGAAGGGGGCTAAAGAGtaagtgaatttttctttcactATTTATTCATCC CTTTATCTTTTAGAGTGTCCATACTATACACTTTATCAATACCCACGTCC GttattcagaaatttcaaatagtCATTCCATCATGTTTTTTATTCGTTCT CTTTCAGCCATCGTCATCGACGTaccgagaaagaagaagatgaagagcTT TTGGAAGATTCCAAGAGTTCTCAAGCACATGTTGTTCAATTCACCGCTTC ACCTTCATGTAAGGTTTAATTCACACAGCTccaaataacgatttcaagcg TTACACAAAATGTCTGATCAGAGTTGCTCTTGAAACTCAATTTTTGCTCG GACAAGAAGTAGTTTTTTCGTTATCTTAGATCAGAGATTGTCCGATGAAC GACCCTTATTTCAAGGCCTGATCCAATTTTCCTCTGAAAATTCCAATATA TAATAAACGAGCTACACATGATATCAATCGTTATTTTATTCATTGTTTAA ACAAACACTTACACATTGTTCATATTACCAGTGCAAATCTGATCATTCTT CCCTccatgaatttcaaaaaaattttcttctactacaaatttttaatttg ggAAATATTAACTGTGTTTTTCAGATATTAAATTTGGAACAATGAGGGAC TACCAGATTAGAGGATTGAATTGGATGATTTCGCTTTATGAAAATGGTAT CAATGGAATTCTAGCTGATGAAATGGTACTTCGTTGATActttctttatt tgcttgtgcATTATCCATTTTTGGTGTGTCCATTTTATGTTATTTGACAT TGAATtcacatttgaaaatttttttagggTCTTGGTAAAACTTTGCAAAC TATTTCATTGATTGGTTACATGAAACATCACAGAAACAACTCTGGTCCAC ACATTGTAATTGTTCCCAAATCCACTCTTGCTAATTGGATGGCTGAGTTT GCAAGATGGTGTCCAACTATAAGGACAGTTTGTTTAATTGGTAACCAAGA TCAGAGGGTAATCAAAATATTTACGTTTTGTTTTGGCAaggtttttcaag tttttcaactTTACTTTGCGAAATTGTTGTTTTTCCCAGAACCTCTGAGA GACTTCATTAAACTTAGTAACacatataaaaaatattagtCATAACATTG TGAGGGAATTAAAACATGTGtgatattgttttattttaatttgataTAAT TACTACTCTTATTATTTCGCATTTTAGTCAGCAATAATCAGAGATACATT GCTACCGGGAGAATGGGATGTTCTTGTTACATCATACGAAATGTGTATTC GTGAAAAAACTGTACTCAAGAAATTCGCTTGGAGATTCTTGTGTATTGAT GAAGCTCAcagaatcaaaaatgaaaaatcactgGTAAAGTTTATAATGAT TTTTTGCTCCTCTTATAACTGCCTTCATTATGAAGCTTTAAAAGATTATC AAGGATATTCGAAAAAATTATCGCATTTCTACTTTACTAAGTTTTGTAAA GCAAAACTGGTCCacctttttttacttttttgttgtcaacaaatttaatg aaaaattatcCCTTATAGCTTTCAAGCATTGTTCGTGAATTCAAATCATC AAACAGACTTCTGCTCACTGGTACCCCACTACAAAATAACCTCCATGAAT TATGGGCTTTGTTAAATTTCTTACTCCCTGATGTGTTCAATTCGTCTGAT GACTTCGATGCTTGGTTTAATGCTGAGAATTTGTCCGAAGAAGATGCCAT TGTCAAACGGTTGCACGCTGTaggtttattatttttatttatcggtgatc caaaaaatatcatataTTGTAATCGCAACTGTTTGATAACTATTACGTAT CAGTTGATATTTTGTACAAAACTAATTGTAGTATCACATTTTTCAACTTA GCTTTTCCGAAGTTTCCAGATTTTGGAAACATGTAATTATTGATTAAAAT CATCCGTAGTTTTAAGAGGAAAATACCCAGGATTCAAAGTCAGCGGTGAC ATTGAAGTTTCagagtttttttttacaattccGTCAATAGGTTTTACGTC CTTTCTTACTACGTCGTTTGAAAAGTGAAGTCGAGAAATCTCTCCTTCCA AAGAAGATCACCAACGTTTACATAGGATTGAGTGCAATGCAAAGACAATG GTACACCAAGTTACTGATGAAGGATATTGATATTGTCAACGGTGCTGGTA AAACTGACCGGATGAGATTGTTGAATATCCTTATGCAGCTTCGAAAATGT TGTAATCACCCTTATCTTTTCGATGGAGCTGAACCTGGTATGTTTATGCC GCCCTTTGATGTTCATCCATATAGAAGAAgcatgaaaaaagttttgaaaa tgcCCTCGTAACCAATATTAATTATGTCATTAGAAATATTATTAAAATGA ACAAAGAGACCCTACTTCAATACAGTGTCCTTAGTTTAACAGTTCGTTGG TAAATTGAGATCATTCCGCTATTCTCGTGTCAAGTCTCGTGTTAACACTC TTTATGAGgtagttttctttttaaaatttaaaaagtattgatgaaaataa aatctagaTTAACTTTTAATCGTTAGAAAAAGATCAAAACCCAAACAACC CTGCCTGATTCTGACCCtgttttttcactttcttcttaGGACCACCATAT ACAACAGACGTTCATTTGGTTGATAATTGCGGTAAAATGAGTGTCTTGGA TAAACTGTTGGTGAGAATGAAGGAGCGAGGATCACGTGTTTTGGTGTTTA GTCAGATGACTCGTATGCTTGATATCCTGGAAGATTACTCTATGTGGAGA GGTTTGTCCGTTTCTTTTGCTCAGGTTTCGGCGCTCCGTTTGGTTTCACA ATGCAATTACTGGCCATTctgtttgattttcaaattgattttattgaaat taagccaaacttttgaaaaaaatgtaaaataatcGAGAGTTTGAAATCTG CTTATCCACATGCAGTCAAACTCGAATTTCTATATTATATCGAGTCCTCG AAAAGCCTAACTCGAACGATCAATATCGACTCCCTCTGTAGTTTTACAAA TTTGACTGTACTCATTAAACCTCGCACTTCCAGGTTTCCAATACTGTCGA TTGGACGGTCAAACACCACATGAAGAACGTACCGCTCAAATTAACGATTT CAACTCACCTGGAAGTgacaaatttgtgttttttctgAGTACACGTGCTG GAGGTCTGGGTATCAATCTTGCAACAGCTGATGTGGTCGTCATGTTTGAT AATGATTGGAATCCACAAGTCGATCTCCAAGCACAGGTATGTTATTTATT CAAGACCCTTCAGTTCAGCCAGGACCTCTTTCAGCTCTTCAAAAAAGCTA AATTGACCGCCTATTAATTCAACTAGCTAAGTCCAGTTTGGTTTGCACGC TTCAACTATCTATCCATTTATGCTCAGGCAAGTAATTTTAaggagaaaag aaagaaaatttctttagaAATGCTATATGTTGAGTAAACTGTTCAAAACT TATAGTGTAAAATGCTTTCACGTAAGAGCAGTGTCGTATCTTTCTTCAAA AGAATATCATATTTGAAATCATTGAATATGTACTAGTAATgacatggttt agagggtgatttgggattaataaccccgaggttcattgaaaacatttcaa aatagcccgaacgTAGTGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN Ncccgagaataccatgttattccgcgttaattatatggtcaaaaaaagaa ttgaagaacactcaatcgctattcttttcgaaacttataaaaacattcga agctataaaaaaacattcgactgacactcttattttgattggcttaaaaa tttcgtacgatattttgttaagCAATCAAAATATCGTAAGATACTTGTCT TTCAACCAATAGAAATTTTTGtttacatcagggcgattacaaaaaagcgg ggctattacggatttatcgccccgctcgtcctttacaaatctaagctaaa tgtaatcaaccatataattagacctaaaatcaaaatgttaGTGATATTTC ACAAATTTACTTTCAGTTCACAACTGACAGAAGAAATCTTGTCTTCATGT TTTAGGATCGAGCACATCGTATCGGTCAAACCAAACAAGTACAAGTATTC CGTTTCATCACCGAAAACACCATCGAAGAAAGAATTATTGAACGTGCTGA AATGAAATTACGTCTTGATCGTGTTGTCATTCAACAAGGTCGATTGGTGG AAGGACAAACGAAACTACAGAAGGATGAAGTACTGAACATGATTCGACAT GGTGCTGATAAAGTCTTCGCTTCCAAAGATTCAACTGTCACTGGTGAAGA TATTGATCTTATCTTGGAAAGAGGTGCTAAGAAGGTACACCAGAGCATTA GtattaaattttgatgaaaagctgAGTTTGGCACCAATGAAAACAGTCTT GTTTTTTTGGCGAGGAAAGGACATAATCttccaaattttaattttcttaa actATCTGAATTTCGAGTTCTTTCTAGTGATCATTTGTGAAATGTAGTGT TAAGTTCGACCATCAGAACACTCTCCAATGATTTTCTGTATAGTTTTTTT TGAGACTGCTCTGAATTCTTTTAAAGTCTTTACGATGCAATCTTTAAGTA TAAAGAATATCCTTTCACTTTTTCATTCTGATAGACTGAGGAGATtgcca aaaaaatgtcagattTGGGCGAAGGCCAACTCAAGAATTTCACCATGGAT GCACCTGACAGTATTTACAAATTCGAAGGTCAAGATTTCCGTGAGACGCA CGATAAACCCGGCGTATCTCACTGGATCGAACCACCAAAGCGTGAACGTA AAGCCAACTACGCTGTTGACACCTACTTCAAAGAACTAATGAGAGTAAAC GAGCCCAAAGCACCCAAAGCTCCTCGACCACCCAAACAACCTAACGTCCA AGATTTCCAATTCTTTCCACCAAGATTATTCGAACTTTTGGATATCGAGA TTTACAGCTACCGAAAGGGGATTGGATACAAGGTAATCTGcatttttgtt acttttctggTTTTTAAGCATTcatcgaaaaaaataatttgatgctAAAG GTTTTTGTGTCtagaattagagagagtcaactgtagctACTGTTAGGGTT ATATGAATATAGACTGAACGTAATCGTTGTCTCGCAGGTACCACGTGATT ATGACATGGATGACGCCGAATCGAAGAAATTCCAAAAAGAAGAACAATCA AAGATCGATAATGCTGAACCACTGAGCGAAGAAGAACAAACGGAAAAAGA ACAATTGTTAGCTCAAGGTTTCACCAATTGGAATAAACGCGATTTCAATC AATTCATCAAGGCTTGCGAGAAATACGGTCGTGATGATTtgaattctatt tgtaaagaagTGGAAGGGAAATCACAAGCGGAGGTATATTTCAACGGTCA ATACAGTCTTCCAATTTGTATATATGAGTTGTCCTTTGTTTCTGAgtcaa tttttacaaaattacgCCAAAATTACGCCAATTCGAGTTTCATTATCTCG CTGCCGACTATGAGTATACTCGTAGTTGAGAGGGTCAAAATACCGGAAGT ACTTAAAGGGTCATATCATGTCATATATCTTTTGATACTGAAGCTTTTga aatttgcttttttattgCGATTCTGCATCGATTGGCGTACAACTTGAAGG CATTTGAAGCAAAACTAAGGCGACAGGAGcctctgaaagtcaaactttcg atgAAATTCCGAGaggtcaaattttttgaaaagggcTTGGCAGTAAACGT GAATTGATTTGCATCAACCATCAGTTCTTAGCTAACAATTCCTAATGCCT AGAactggaagaaaaaaaactaattgtAAAGCTTCTTTGCTATAATTTCT AGGTCCGAGAATATGCTGGTGTGTTTTGGGAACGTTGCAATGAGCTGACT GACATTGACAAAATCATGGCACAGATCGAACGTGGCGAAGCCAAAATTCA ACGAAGAATTTCTATTAAAAGAGCCATGGAGGCTAAGGTATTAACCCCTT CAATAAACTGCGTTGTCTGTGCAGGTCTGTGACGTTTGTTTTAGTTTGTT TGGAGTGACCTTAGGAAAAGTTCGAGTTAATGTTGGTTTGAGATTATGAG TACACATTTTTTGTATGAGAATTTTTAACGCTTAGGTACATTCAGGCTCA AATCTTGAAAATACTTTGAGAATTGGGTAAGTATCATTCGAACCTCAGTT tacgaaatatgaaaatatcatTTAAATAGAAAGATACACCGCCAAAGCTT TGTAAGACTCGCGAAGGATACCTCGTGTTCATAAAAACCTATATTAGATT GATATCATTGGTGTTATTAAAATTGGTAGGGTTAAGGAAACCAAGCTTGT GAATAAACCTTACAAATTAATTTTGTAGATGGCAAGGTACAAGTCACCGT TTCACCAGCTCCGCATACAATACGGAACTAACAAAGGAAAGAATTATACC GAAGAAGAGGACAGGTTTATCGTAAGTCATCCTCATAATCCCTCCTGATT AGTAtatctttatatttttctctctaTTCCTTCAACAGAATCTCATATCA TAGGTCATTATCTTCGAGGGATGAAGATATCTTCGATATATTTTGTTATA GGTATGCATGTTACACAAATTGGGATTCGATCGGGAGAATGTATACGAAG AATTACGTCAATCTGTCCGAAGTGCTCCTCAATTTCGATTTGATTGGTTT ATCAAATCTCGAACTGCAGTGGTGAGTTTATTTCTTATTTGTTGGGGACT TTCAAATAATGTCCGCCTTCTCTTTAAGCAGAAAGAGTCCCAATAGAAGA TTGTTTCATAAACTGTAGAATACCGttcttttcaaaatgaaataaaattt tgcacTGGTTGGAAATGATAGTTTACTCTCAAACGAGACCAATAAAATGT TTTGGACTACACTTTTGCTAATTACAGTTGTTGAGTTCCTGTTAGTGTTA AGACTTTACAGTTGTATTTCTCTATTTATGACAGGAATTGCAAAGACGCT GCAACACTTTGATCACTCTCATTGAAAGAGAAAACCAAGAGCTTGAAGAG CGAGAGAAACGTGAAAAACGCAAAGGAGCCAAACCAAATGCTGCTAGAGT GAGTTTATTTCTAGTTTTTGTTATTGAAGCTCATTCTTTGCAATGCTGAC TAAAAGGGCTTGTCATGAAATCTCGAGAATTTCCTTATCATGGGTTATCA TGATTTGTTCTTGCAAACATCATTTTCAGGTTCGAGCAGAAAGGTCGAGT GTCTCTGATAGTTTTGAACAGTTGATTTCCCTAAGGGTTGAGGTTTCTGA TTATTTCAATTGATTTAATATGGTAATGGTTTTCATTCTGATTCATTTTA TATTTCAGACCCCTGCTCAAGGAAAGAGGAAAAATGAAGTTGTGGCTGCT AAACCCGCCAAGAAAGCCAAAAACTAATCGGAAGTTGTACGAGGAGTCTA TAATGCCATCCATTTCCATCTTTTATTGAGAACACCGTCACATGGATGAA GTTTATTTGTTCAGAGAGACACTTACATCAGGTTTTCATGCGGTGATGAG TCAACTAGCACAAAATCTTTCGCTGTATTTATTTCCTTTTTACGTTACTA GTGTattatttttacaaaagaataaTCGCTACATGTTTTTAAATAGTTAA CCTTTTGTTTTTTCAGATTCTCTATCAAacaattgtttcaatttttttat tatgtaccttaagtggataaattttggcggggattaaatttggcgaattt ggcgaattgtgccaaaattcggcaattcgccaaattaaatccccgccaaa tttaacaaaaagagaattatttgaaaaatcacaactttttagtatatttt tgagtaattttcacccatttcagtgtgacaaaatttccaattcgccaaat aaaatccccgccaaattttacgaaattgatctatcgccaaattaaatcca cgccaaaatttatccactt

Coding sequence (CDS) from alignment at sc0000005:447901..462969+

>TCONS_00000697 ID=TCONS_00000697|Name=TCONS_00000697|organism=Clytia hemisphaerica|type=CDS|length=58212bp|location=Sequence derived from alignment at sc0000005:447901..462969+ (Clytia hemisphaerica)
CGACGCGGGAAATGTAATCTGACAtctgattttttaaatatatactTTGT
ACATGTTTGGCCtaattttacaatatttttagaatattatactcaaaaaa
tggctgaTCAAGTTGACGAAAAAACAATCCAAAATACTGATGAAGTATCT
AAGGAAGAAACCAAAGAAGAGGAGGTGACAACGAAAAAGGAAGATGAGAA
GACAAATGAACAAGAATCGGAAGGAGAATCTACTGATGATGAAGATGACA
AACCAAAACCGCCACCAGTTAAAATCAATAAAGCTATGGCTGTCAATGAA
GAATACAATGAAAAGATGGAACATGATAGAGCATCAAGATTCAGTTTTCT
ATTAAAACAAACTGAAATATTTTCCCATTTCTTAAATGGAGCTGGTAAAA
AGCCACCAAAAAgtcctttaaaaatgaaaaagcagCCTGATCTTCCTTCC
AGTCCACCACCAAAGAAGGGGGCTAAAGACCATCGTCATCGACGTaccga
gaaagaagaagatgaagagcTTTTGGAAGATTCCAAGAGTTCTCAAGCAC
ATGTTGTTCAATTCACCGCTTCACCTTCATATATTAAATTTGGAACAATG
AGGGACTACCAGATTAGAGGATTGAATTGGATGATTTCGCTTTATGAAAA
TGGTATCAATGGAATTCTAGCTGATGAAATGggTCTTGGTAAAACTTTGC
AAACTATTTCATTGATTGGTTACATGAAACATCACAGAAACAACTCTGGT
CCACACATTGTAATTGTTCCCAAATCCACTCTTGCTAATTGGATGGCTGA
GTTTGCAAGATGGTGTCCAACTATAAGGACAGTTTGTTTAATTGGTAACC
AAGATCAGAGGTCAGCAATAATCAGAGATACATTGCTACCGGGAGAATGG
GATGTTCTTGTTACATCATACGAAATGTGTATTCGTGAAAAAACTGTACT
CAAGAAATTCGCTTGGAGATTCTTGTGTATTGATGAAGCTCAcagaatca
aaaatgaaaaatcactgCTTTCAAGCATTGTTCGTGAATTCAAATCATCA
AACAGACTTCTGCTCACTGGTACCCCACTACAAAATAACCTCCATGAATT
ATGGGCTTTGTTAAATTTCTTACTCCCTGATGTGTTCAATTCGTCTGATG
ACTTCGATGCTTGGTTTAATGCTGAGAATTTGTCCGAAGAAGATGCCATT
GTCAAACGGTTGCACGCTGTTTTACGTCCTTTCTTACTACGTCGTTTGAA
AAGTGAAGTCGAGAAATCTCTCCTTCCAAAGAAGATCACCAACGTTTACA
TAGGATTGAGTGCAATGCAAAGACAATGGTACACCAAGTTACTGATGAAG
GATATTGATATTGTCAACGGTGCTGGTAAAACTGACCGGATGAGATTGTT
GAATATCCTTATGCAGCTTCGAAAATGTTGTAATCACCCTTATCTTTTCG
ATGGAGCTGAACCTGGACCACCATATACAACAGACGTTCATTTGGTTGAT
AATTGCGGTAAAATGAGTGTCTTGGATAAACTGTTGGTGAGAATGAAGGA
GCGAGGATCACGTGTTTTGGTGTTTAGTCAGATGACTCGTATGCTTGATA
TCCTGGAAGATTACTCTATGTGGAGAGGTTTCCAATACTGTCGATTGGAC
GGTCAAACACCACATGAAGAACGTACCGCTCAAATTAACGATTTCAACTC
ACCTGGAAGTgacaaatttgtgttttttctgAGTACACGTGCTGGAGGTC
TGGGTATCAATCTTGCAACAGCTGATGTGGTCGTCATGTTTGATAATGAT
TGGAATCCACAAGTCGATCTCCAAGCACAGGATCGAGCACATCGTATCGG
TCAAACCAAACAAGTACAAGTATTCCGTTTCATCACCGAAAACACCATCG
AAGAAAGAATTATTGAACGTGCTGAAATGAAATTACGTCTTGATCGTGTT
GTCATTCAACAAGGTCGATTGGTGGAAGGACAAACGAAACTACAGAAGGA
TGAAGTACTGAACATGATTCGACATGGTGCTGATAAAGTCTTCGCTTCCA
AAGATTCAACTGTCACTGGTGAAGATATTGATCTTATCTTGGAAAGAGGT
GCTAAGAAGACTGAGGAGATtgccaaaaaaatgtcagattTGGGCGAAGG
CCAACTCAAGAATTTCACCATGGATGCACCTGACAGTATTTACAAATTCG
AAGGTCAAGATTTCCGTGAGACGCACGATAAACCCGGCGTATCTCACTGG
ATCGAACCACCAAAGCGTGAACGTAAAGCCAACTACGCTGTTGACACCTA
CTTCAAAGAACTAATGAGAGTAAACGAGCCCAAAGCACCCAAAGCTCCTC
GACCACCCAAACAACCTAACGTCCAAGATTTCCAATTCTTTCCACCAAGA
TTATTCGAACTTTTGGATATCGAGATTTACAGCTACCGAAAGGGGATTGG
ATACAAGGTACCACGTGATTATGACATGGATGACGCCGAATCGAAGAAAT
TCCAAAAAGAAGAACAATCAAAGATCGATAATGCTGAACCACTGAGCGAA
GAAGAACAAACGGAAAAAGAACAATTGTTAGCTCAAGGTTTCACCAATTG
GAATAAACGCGATTTCAATCAATTCATCAAGGCTTGCGAGAAATACGGTC
GTGATGATTtgaattctatttgtaaagaagTGGAAGGGAAATCACAAGCG
GAGGTCCGAGAATATGCTGGTGTGTTTTGGGAACGTTGCAATGAGCTGAC
TGACATTGACAAAATCATGGCACAGATCGAACGTGGCGAAGCCAAAATTC
AACGAAGAATTTCTATTAAAAGAGCCATGGAGGCTAAGATGGCAAGGTAC
AAGTCACCGTTTCACCAGCTCCGCATACAATACGGAACTAACAAAGGAAA
GAATTATACCGAAGAAGAGGACAGGTTTATCGTATGCATGTTACACAAAT
TGGGATTCGATCGGGAGAATGTATACGAAGAATTACGTCAATCTGTCCGA
AGTGCTCCTCAATTTCGATTTGATTGGTTTATCAAATCTCGAACTGCAGT
GGAATTGCAAAGACGCTGCAACACTTTGATCACTCTCATTGAAAGAGAAA
ACCAAGAGCTTGAAGAGCGAGAGAAACGTGAAAAACGCAAAGGAGCCAAA
CCAAATGCTGCTAGAACCCCTGCTCAAGGAAAGAGGAAAAATGAAGTTGT
GGCTGCTAAACCCGCCAAGAAAGCCAAAAACTAACGACGCGGGAAATGTA
ATCTGACAtctgattttttaaatatatactTTGTACATGTTTGGCCtaat
tttacaatatttttagaatattatactcaaaaaatggctgaTCAAGTTGA
CGAAAAAACAATCCAAAATACTGATGAAGTATCTAAGGAAGAAACCAAAG
AAGAGGAGGTGACAACGAAAAAGGAAGATGAGAAGACAAATGAACAAGAA
TCGGAAGGAGAATCTACTGATGATGAAGATGACAAACCAAAACCGCCACC
AGTTAAAATCAATAAAGCTATGGCTGTCAATGAAGAATACAATGAAAAGA
TGGAACATGATAGAGCATCAAGATTCAGTTTTCTATTAAAACAAACTGAA
ATATTTTCCCATTTCTTAAATGGAGCTGGTAAAAAGCCACCAAAAAgtcc
tttaaaaatgaaaaagcagCCTGATCTTCCTTCCAGTCCACCACCAAAGA
AGGGGGCTAAAGACCATCGTCATCGACGTaccgagaaagaagaagatgaa
gagcTTTTGGAAGATTCCAAGAGTTCTCAAGCACATGTTGTTCAATTCAC
CGCTTCACCTTCATATATTAAATTTGGAACAATGAGGGACTACCAGATTA
GAGGATTGAATTGGATGATTTCGCTTTATGAAAATGGTATCAATGGAATT
CTAGCTGATGAAATGggTCTTGGTAAAACTTTGCAAACTATTTCATTGAT
TGGTTACATGAAACATCACAGAAACAACTCTGGTCCACACATTGTAATTG
TTCCCAAATCCACTCTTGCTAATTGGATGGCTGAGTTTGCAAGATGGTGT
CCAACTATAAGGACAGTTTGTTTAATTGGTAACCAAGATCAGAGGTCAGC
AATAATCAGAGATACATTGCTACCGGGAGAATGGGATGTTCTTGTTACAT
CATACGAAATGTGTATTCGTGAAAAAACTGTACTCAAGAAATTCGCTTGG
AGATTCTTGTGTATTGATGAAGCTCAcagaatcaaaaatgaaaaatcact
gCTTTCAAGCATTGTTCGTGAATTCAAATCATCAAACAGACTTCTGCTCA
CTGGTACCCCACTACAAAATAACCTCCATGAATTATGGGCTTTGTTAAAT
TTCTTACTCCCTGATGTGTTCAATTCGTCTGATGACTTCGATGCTTGGTT
TAATGCTGAGAATTTGTCCGAAGAAGATGCCATTGTCAAACGGTTGCACG
CTGTTTTACGTCCTTTCTTACTACGTCGTTTGAAAAGTGAAGTCGAGAAA
TCTCTCCTTCCAAAGAAGATCACCAACGTTTACATAGGATTGAGTGCAAT
GCAAAGACAATGGTACACCAAGTTACTGATGAAGGATATTGATATTGTCA
ACGGTGCTGGTAAAACTGACCGGATGAGATTGTTGAATATCCTTATGCAG
CTTCGAAAATGTTGTAATCACCCTTATCTTTTCGATGGAGCTGAACCTGG
ACCACCATATACAACAGACGTTCATTTGGTTGATAATTGCGGTAAAATGA
GTGTCTTGGATAAACTGTTGGTGAGAATGAAGGAGCGAGGATCACGTGTT
TTGGTGTTTAGTCAGATGACTCGTATGCTTGATATCCTGGAAGATTACTC
TATGTGGAGAGGTTTCCAATACTGTCGATTGGACGGTCAAACACCACATG
AAGAACGTACCGCTCAAATTAACGATTTCAACTCACCTGGAAGTgacaaa
tttgtgttttttctgAGTACACGTGCTGGAGGTCTGGGTATCAATCTTGC
AACAGCTGATGTGGTCGTCATGTTTGATAATGATTGGAATCCACAAGTCG
ATCTCCAAGCACAGGATCGAGCACATCGTATCGGTCAAACCAAACAAGTA
CAAGTATTCCGTTTCATCACCGAAAACACCATCGAAGAAAGAATTATTGA
ACGTGCTGAAATGAAATTACGTCTTGATCGTGTTGTCATTCAACAAGGTC
GATTGGTGGAAGGACAAACGAAACTACAGAAGGATGAAGTACTGAACATG
ATTCGACATGGTGCTGATAAAGTCTTCGCTTCCAAAGATTCAACTGTCAC
TGGTGAAGATATTGATCTTATCTTGGAAAGAGGTGCTAAGAAGACTGAGG
AGATtgccaaaaaaatgtcagattTGGGCGAAGGCCAACTCAAGAATTTC
ACCATGGATGCACCTGACAGTATTTACAAATTCGAAGGTCAAGATTTCCG
TGAGACGCACGATAAACCCGGCGTATCTCACTGGATCGAACCACCAAAGC
GTGAACGTAAAGCCAACTACGCTGTTGACACCTACTTCAAAGAACTAATG
AGAGTAAACGAGCCCAAAGCACCCAAAGCTCCTCGACCACCCAAACAACC
TAACGTCCAAGATTTCCAATTCTTTCCACCAAGATTATTCGAACTTTTGG
ATATCGAGATTTACAGCTACCGAAAGGGGATTGGATACAAGGTACCACGT
GATTATGACATGGATGACGCCGAATCGAAGAAATTCCAAAAAGAAGAACA
ATCAAAGATCGATAATGCTGAACCACTGAGCGAAGAAGAACAAACGGAAA
AAGAACAATTGTTAGCTCAAGGTTTCACCAATTGGAATAAACGCGATTTC
AATCAATTCATCAAGGCTTGCGAGAAATACGGTCGTGATGATTtgaattc
tatttgtaaagaagTGGAAGGGAAATCACAAGCGGAGGTCCGAGAATATG
CTGGTGTGTTTTGGGAACGTTGCAATGAGCTGACTGACATTGACAAAATC
ATGGCACAGATCGAACGTGGCGAAGCCAAAATTCAACGAAGAATTTCTAT
TAAAAGAGCCATGGAGGCTAAGATGGCAAGGTACAAGTCACCGTTTCACC
AGCTCCGCATACAATACGGAACTAACAAAGGAAAGAATTATACCGAAGAA
GAGGACAGGTTTATCGTATGCATGTTACACAAATTGGGATTCGATCGGGA
GAATGTATACGAAGAATTACGTCAATCTGTCCGAAGTGCTCCTCAATTTC
GATTTGATTGGTTTATCAAATCTCGAACTGCAGTGGAATTGCAAAGACGC
TGCAACACTTTGATCACTCTCATTGAAAGAGAAAACCAAGAGCTTGAAGA
GCGAGAGAAACGTGAAAAACGCAAAGGAGCCAAACCAAATGCTGCTAGAA
CCCCTGCTCAAGGAAAGAGGAAAAATGAAGTTGTGGCTGCTAAACCCGCC
AAGAAAGCCAAAAACTAACGACGCGGGAAATGTAATCTGACAtctgattt
tttaaatatatactTTGTACATGTTTGGCCtaattttacaatatttttag
aatattatactcaaaaaatggctgaTCAAGTTGACGAAAAAACAATCCAA
AATACTGATGAAGTATCTAAGGAAGAAACCAAAGAAGAGGAGGTGACAAC
GAAAAAGGAAGATGAGAAGACAAATGAACAAGAATCGGAAGGAGAATCTA
CTGATGATGAAGATGACAAACCAAAACCGCCACCAGTTAAAATCAATAAA
GCTATGGCTGTCAATGAAGAATACAATGAAAAGATGGAACATGATAGAGC
ATCAAGATTCAGTTTTCTATTAAAACAAACTGAAATATTTTCCCATTTCT
TAAATGGAGCTGGTAAAAAGCCACCAAAAAgtcctttaaaaatgaaaaag
cagCCTGATCTTCCTTCCAGTCCACCACCAAAGAAGGGGGCTAAAGACCA
TCGTCATCGACGTaccgagaaagaagaagatgaagagcTTTTGGAAGATT
CCAAGAGTTCTCAAGCACATGTTGTTCAATTCACCGCTTCACCTTCATAT
ATTAAATTTGGAACAATGAGGGACTACCAGATTAGAGGATTGAATTGGAT
GATTTCGCTTTATGAAAATGGTATCAATGGAATTCTAGCTGATGAAATGg
gTCTTGGTAAAACTTTGCAAACTATTTCATTGATTGGTTACATGAAACAT
CACAGAAACAACTCTGGTCCACACATTGTAATTGTTCCCAAATCCACTCT
TGCTAATTGGATGGCTGAGTTTGCAAGATGGTGTCCAACTATAAGGACAG
TTTGTTTAATTGGTAACCAAGATCAGAGGTCAGCAATAATCAGAGATACA
TTGCTACCGGGAGAATGGGATGTTCTTGTTACATCATACGAAATGTGTAT
TCGTGAAAAAACTGTACTCAAGAAATTCGCTTGGAGATTCTTGTGTATTG
ATGAAGCTCAcagaatcaaaaatgaaaaatcactgCTTTCAAGCATTGTT
CGTGAATTCAAATCATCAAACAGACTTCTGCTCACTGGTACCCCACTACA
AAATAACCTCCATGAATTATGGGCTTTGTTAAATTTCTTACTCCCTGATG
TGTTCAATTCGTCTGATGACTTCGATGCTTGGTTTAATGCTGAGAATTTG
TCCGAAGAAGATGCCATTGTCAAACGGTTGCACGCTGTTTTACGTCCTTT
CTTACTACGTCGTTTGAAAAGTGAAGTCGAGAAATCTCTCCTTCCAAAGA
AGATCACCAACGTTTACATAGGATTGAGTGCAATGCAAAGACAATGGTAC
ACCAAGTTACTGATGAAGGATATTGATATTGTCAACGGTGCTGGTAAAAC
TGACCGGATGAGATTGTTGAATATCCTTATGCAGCTTCGAAAATGTTGTA
ATCACCCTTATCTTTTCGATGGAGCTGAACCTGGACCACCATATACAACA
GACGTTCATTTGGTTGATAATTGCGGTAAAATGAGTGTCTTGGATAAACT
GTTGGTGAGAATGAAGGAGCGAGGATCACGTGTTTTGGTGTTTAGTCAGA
TGACTCGTATGCTTGATATCCTGGAAGATTACTCTATGTGGAGAGGTTTC
CAATACTGTCGATTGGACGGTCAAACACCACATGAAGAACGTACCGCTCA
AATTAACGATTTCAACTCACCTGGAAGTgacaaatttgtgttttttctgA
GTACACGTGCTGGAGGTCTGGGTATCAATCTTGCAACAGCTGATGTGGTC
GTCATGTTTGATAATGATTGGAATCCACAAGTCGATCTCCAAGCACAGGA
TCGAGCACATCGTATCGGTCAAACCAAACAAGTACAAGTATTCCGTTTCA
TCACCGAAAACACCATCGAAGAAAGAATTATTGAACGTGCTGAAATGAAA
TTACGTCTTGATCGTGTTGTCATTCAACAAGGTCGATTGGTGGAAGGACA
AACGAAACTACAGAAGGATGAAGTACTGAACATGATTCGACATGGTGCTG
ATAAAGTCTTCGCTTCCAAAGATTCAACTGTCACTGGTGAAGATATTGAT
CTTATCTTGGAAAGAGGTGCTAAGAAGACTGAGGAGATtgccaaaaaaat
gtcagattTGGGCGAAGGCCAACTCAAGAATTTCACCATGGATGCACCTG
ACAGTATTTACAAATTCGAAGGTCAAGATTTCCGTGAGACGCACGATAAA
CCCGGCGTATCTCACTGGATCGAACCACCAAAGCGTGAACGTAAAGCCAA
CTACGCTGTTGACACCTACTTCAAAGAACTAATGAGAGTAAACGAGCCCA
AAGCACCCAAAGCTCCTCGACCACCCAAACAACCTAACGTCCAAGATTTC
CAATTCTTTCCACCAAGATTATTCGAACTTTTGGATATCGAGATTTACAG
CTACCGAAAGGGGATTGGATACAAGGTACCACGTGATTATGACATGGATG
ACGCCGAATCGAAGAAATTCCAAAAAGAAGAACAATCAAAGATCGATAAT
GCTGAACCACTGAGCGAAGAAGAACAAACGGAAAAAGAACAATTGTTAGC
TCAAGGTTTCACCAATTGGAATAAACGCGATTTCAATCAATTCATCAAGG
CTTGCGAGAAATACGGTCGTGATGATTtgaattctatttgtaaagaagTG
GAAGGGAAATCACAAGCGGAGGTCCGAGAATATGCTGGTGTGTTTTGGGA
ACGTTGCAATGAGCTGACTGACATTGACAAAATCATGGCACAGATCGAAC
GTGGCGAAGCCAAAATTCAACGAAGAATTTCTATTAAAAGAGCCATGGAG
GCTAAGATGGCAAGGTACAAGTCACCGTTTCACCAGCTCCGCATACAATA
CGGAACTAACAAAGGAAAGAATTATACCGAAGAAGAGGACAGGTTTATCG
TATGCATGTTACACAAATTGGGATTCGATCGGGAGAATGTATACGAAGAA
TTACGTCAATCTGTCCGAAGTGCTCCTCAATTTCGATTTGATTGGTTTAT
CAAATCTCGAACTGCAGTGGAATTGCAAAGACGCTGCAACACTTTGATCA
CTCTCATTGAAAGAGAAAACCAAGAGCTTGAAGAGCGAGAGAAACGTGAA
AAACGCAAAGGAGCCAAACCAAATGCTGCTAGAACCCCTGCTCAAGGAAA
GAGGAAAAATGAAGTTGTGGCTGCTAAACCCGCCAAGAAAGCCAAAAACT
AACGACGCGGGAAATGTAATCTGACAtctgattttttaaatatatactTT
GTACATGTTTGGCCtaattttacaatatttttagaatattatactcaaaa
aatggctgaTCAAGTTGACGAAAAAACAATCCAAAATACTGATGAAGTAT
CTAAGGAAGAAACCAAAGAAGAGGAGGTGACAACGAAAAAGGAAGATGAG
AAGACAAATGAACAAGAATCGGAAGGAGAATCTACTGATGATGAAGATGA
CAAACCAAAACCGCCACCAGTTAAAATCAATAAAGCTATGGCTGTCAATG
AAGAATACAATGAAAAGATGGAACATGATAGAGCATCAAGATTCAGTTTT
CTATTAAAACAAACTGAAATATTTTCCCATTTCTTAAATGGAGCTGGTAA
AAAGCCACCAAAAAgtcctttaaaaatgaaaaagcagCCTGATCTTCCTT
CCAGTCCACCACCAAAGAAGGGGGCTAAAGACCATCGTCATCGACGTacc
gagaaagaagaagatgaagagcTTTTGGAAGATTCCAAGAGTTCTCAAGC
ACATGTTGTTCAATTCACCGCTTCACCTTCATATATTAAATTTGGAACAA
TGAGGGACTACCAGATTAGAGGATTGAATTGGATGATTTCGCTTTATGAA
AATGGTATCAATGGAATTCTAGCTGATGAAATGggTCTTGGTAAAACTTT
GCAAACTATTTCATTGATTGGTTACATGAAACATCACAGAAACAACTCTG
GTCCACACATTGTAATTGTTCCCAAATCCACTCTTGCTAATTGGATGGCT
GAGTTTGCAAGATGGTGTCCAACTATAAGGACAGTTTGTTTAATTGGTAA
CCAAGATCAGAGGTCAGCAATAATCAGAGATACATTGCTACCGGGAGAAT
GGGATGTTCTTGTTACATCATACGAAATGTGTATTCGTGAAAAAACTGTA
CTCAAGAAATTCGCTTGGAGATTCTTGTGTATTGATGAAGCTCAcagaat
caaaaatgaaaaatcactgCTTTCAAGCATTGTTCGTGAATTCAAATCAT
CAAACAGACTTCTGCTCACTGGTACCCCACTACAAAATAACCTCCATGAA
TTATGGGCTTTGTTAAATTTCTTACTCCCTGATGTGTTCAATTCGTCTGA
TGACTTCGATGCTTGGTTTAATGCTGAGAATTTGTCCGAAGAAGATGCCA
TTGTCAAACGGTTGCACGCTGTTTTACGTCCTTTCTTACTACGTCGTTTG
AAAAGTGAAGTCGAGAAATCTCTCCTTCCAAAGAAGATCACCAACGTTTA
CATAGGATTGAGTGCAATGCAAAGACAATGGTACACCAAGTTACTGATGA
AGGATATTGATATTGTCAACGGTGCTGGTAAAACTGACCGGATGAGATTG
TTGAATATCCTTATGCAGCTTCGAAAATGTTGTAATCACCCTTATCTTTT
CGATGGAGCTGAACCTGGACCACCATATACAACAGACGTTCATTTGGTTG
ATAATTGCGGTAAAATGAGTGTCTTGGATAAACTGTTGGTGAGAATGAAG
GAGCGAGGATCACGTGTTTTGGTGTTTAGTCAGATGACTCGTATGCTTGA
TATCCTGGAAGATTACTCTATGTGGAGAGGTTTCCAATACTGTCGATTGG
ACGGTCAAACACCACATGAAGAACGTACCGCTCAAATTAACGATTTCAAC
TCACCTGGAAGTgacaaatttgtgttttttctgAGTACACGTGCTGGAGG
TCTGGGTATCAATCTTGCAACAGCTGATGTGGTCGTCATGTTTGATAATG
ATTGGAATCCACAAGTCGATCTCCAAGCACAGGATCGAGCACATCGTATC
GGTCAAACCAAACAAGTACAAGTATTCCGTTTCATCACCGAAAACACCAT
CGAAGAAAGAATTATTGAACGTGCTGAAATGAAATTACGTCTTGATCGTG
TTGTCATTCAACAAGGTCGATTGGTGGAAGGACAAACGAAACTACAGAAG
GATGAAGTACTGAACATGATTCGACATGGTGCTGATAAAGTCTTCGCTTC
CAAAGATTCAACTGTCACTGGTGAAGATATTGATCTTATCTTGGAAAGAG
GTGCTAAGAAGACTGAGGAGATtgccaaaaaaatgtcagattTGGGCGAA
GGCCAACTCAAGAATTTCACCATGGATGCACCTGACAGTATTTACAAATT
CGAAGGTCAAGATTTCCGTGAGACGCACGATAAACCCGGCGTATCTCACT
GGATCGAACCACCAAAGCGTGAACGTAAAGCCAACTACGCTGTTGACACC
TACTTCAAAGAACTAATGAGAGTAAACGAGCCCAAAGCACCCAAAGCTCC
TCGACCACCCAAACAACCTAACGTCCAAGATTTCCAATTCTTTCCACCAA
GATTATTCGAACTTTTGGATATCGAGATTTACAGCTACCGAAAGGGGATT
GGATACAAGGTACCACGTGATTATGACATGGATGACGCCGAATCGAAGAA
ATTCCAAAAAGAAGAACAATCAAAGATCGATAATGCTGAACCACTGAGCG
AAGAAGAACAAACGGAAAAAGAACAATTGTTAGCTCAAGGTTTCACCAAT
TGGAATAAACGCGATTTCAATCAATTCATCAAGGCTTGCGAGAAATACGG
TCGTGATGATTtgaattctatttgtaaagaagTGGAAGGGAAATCACAAG
CGGAGGTCCGAGAATATGCTGGTGTGTTTTGGGAACGTTGCAATGAGCTG
ACTGACATTGACAAAATCATGGCACAGATCGAACGTGGCGAAGCCAAAAT
TCAACGAAGAATTTCTATTAAAAGAGCCATGGAGGCTAAGATGGCAAGGT
ACAAGTCACCGTTTCACCAGCTCCGCATACAATACGGAACTAACAAAGGA
AAGAATTATACCGAAGAAGAGGACAGGTTTATCGTATGCATGTTACACAA
ATTGGGATTCGATCGGGAGAATGTATACGAAGAATTACGTCAATCTGTCC
GAAGTGCTCCTCAATTTCGATTTGATTGGTTTATCAAATCTCGAACTGCA
GTGGAATTGCAAAGACGCTGCAACACTTTGATCACTCTCATTGAAAGAGA
AAACCAAGAGCTTGAAGAGCGAGAGAAACGTGAAAAACGCAAAGGAGCCA
AACCAAATGCTGCTAGAACCCCTGCTCAAGGAAAGAGGAAAAATGAAGTT
GTGGCTGCTAAACCCGCCAAGAAAGCCAAAAACTAACGACGCGGGAAATG
TAATCTGACAtctgattttttaaatatatactTTGTACATGTTTGGCCta
attttacaatatttttagaatattatactcaaaaaatggctgaTCAAGTT
GACGAAAAAACAATCCAAAATACTGATGAAGTATCTAAGGAAGAAACCAA
AGAAGAGGAGGTGACAACGAAAAAGGAAGATGAGAAGACAAATGAACAAG
AATCGGAAGGAGAATCTACTGATGATGAAGATGACAAACCAAAACCGCCA
CCAGTTAAAATCAATAAAGCTATGGCTGTCAATGAAGAATACAATGAAAA
GATGGAACATGATAGAGCATCAAGATTCAGTTTTCTATTAAAACAAACTG
AAATATTTTCCCATTTCTTAAATGGAGCTGGTAAAAAGCCACCAAAAAgt
cctttaaaaatgaaaaagcagCCTGATCTTCCTTCCAGTCCACCACCAAA
GAAGGGGGCTAAAGACCATCGTCATCGACGTaccgagaaagaagaagatg
aagagcTTTTGGAAGATTCCAAGAGTTCTCAAGCACATGTTGTTCAATTC
ACCGCTTCACCTTCATATATTAAATTTGGAACAATGAGGGACTACCAGAT
TAGAGGATTGAATTGGATGATTTCGCTTTATGAAAATGGTATCAATGGAA
TTCTAGCTGATGAAATGggTCTTGGTAAAACTTTGCAAACTATTTCATTG
ATTGGTTACATGAAACATCACAGAAACAACTCTGGTCCACACATTGTAAT
TGTTCCCAAATCCACTCTTGCTAATTGGATGGCTGAGTTTGCAAGATGGT
GTCCAACTATAAGGACAGTTTGTTTAATTGGTAACCAAGATCAGAGGTCA
GCAATAATCAGAGATACATTGCTACCGGGAGAATGGGATGTTCTTGTTAC
ATCATACGAAATGTGTATTCGTGAAAAAACTGTACTCAAGAAATTCGCTT
GGAGATTCTTGTGTATTGATGAAGCTCAcagaatcaaaaatgaaaaatca
ctgCTTTCAAGCATTGTTCGTGAATTCAAATCATCAAACAGACTTCTGCT
CACTGGTACCCCACTACAAAATAACCTCCATGAATTATGGGCTTTGTTAA
ATTTCTTACTCCCTGATGTGTTCAATTCGTCTGATGACTTCGATGCTTGG
TTTAATGCTGAGAATTTGTCCGAAGAAGATGCCATTGTCAAACGGTTGCA
CGCTGTTTTACGTCCTTTCTTACTACGTCGTTTGAAAAGTGAAGTCGAGA
AATCTCTCCTTCCAAAGAAGATCACCAACGTTTACATAGGATTGAGTGCA
ATGCAAAGACAATGGTACACCAAGTTACTGATGAAGGATATTGATATTGT
CAACGGTGCTGGTAAAACTGACCGGATGAGATTGTTGAATATCCTTATGC
AGCTTCGAAAATGTTGTAATCACCCTTATCTTTTCGATGGAGCTGAACCT
GGACCACCATATACAACAGACGTTCATTTGGTTGATAATTGCGGTAAAAT
GAGTGTCTTGGATAAACTGTTGGTGAGAATGAAGGAGCGAGGATCACGTG
TTTTGGTGTTTAGTCAGATGACTCGTATGCTTGATATCCTGGAAGATTAC
TCTATGTGGAGAGGTTTCCAATACTGTCGATTGGACGGTCAAACACCACA
TGAAGAACGTACCGCTCAAATTAACGATTTCAACTCACCTGGAAGTgaca
aatttgtgttttttctgAGTACACGTGCTGGAGGTCTGGGTATCAATCTT
GCAACAGCTGATGTGGTCGTCATGTTTGATAATGATTGGAATCCACAAGT
CGATCTCCAAGCACAGGATCGAGCACATCGTATCGGTCAAACCAAACAAG
TACAAGTATTCCGTTTCATCACCGAAAACACCATCGAAGAAAGAATTATT
GAACGTGCTGAAATGAAATTACGTCTTGATCGTGTTGTCATTCAACAAGG
TCGATTGGTGGAAGGACAAACGAAACTACAGAAGGATGAAGTACTGAACA
TGATTCGACATGGTGCTGATAAAGTCTTCGCTTCCAAAGATTCAACTGTC
ACTGGTGAAGATATTGATCTTATCTTGGAAAGAGGTGCTAAGAAGACTGA
GGAGATtgccaaaaaaatgtcagattTGGGCGAAGGCCAACTCAAGAATT
TCACCATGGATGCACCTGACAGTATTTACAAATTCGAAGGTCAAGATTTC
CGTGAGACGCACGATAAACCCGGCGTATCTCACTGGATCGAACCACCAAA
GCGTGAACGTAAAGCCAACTACGCTGTTGACACCTACTTCAAAGAACTAA
TGAGAGTAAACGAGCCCAAAGCACCCAAAGCTCCTCGACCACCCAAACAA
CCTAACGTCCAAGATTTCCAATTCTTTCCACCAAGATTATTCGAACTTTT
GGATATCGAGATTTACAGCTACCGAAAGGGGATTGGATACAAGGTACCAC
GTGATTATGACATGGATGACGCCGAATCGAAGAAATTCCAAAAAGAAGAA
CAATCAAAGATCGATAATGCTGAACCACTGAGCGAAGAAGAACAAACGGA
AAAAGAACAATTGTTAGCTCAAGGTTTCACCAATTGGAATAAACGCGATT
TCAATCAATTCATCAAGGCTTGCGAGAAATACGGTCGTGATGATTtgaat
tctatttgtaaagaagTGGAAGGGAAATCACAAGCGGAGGTCCGAGAATA
TGCTGGTGTGTTTTGGGAACGTTGCAATGAGCTGACTGACATTGACAAAA
TCATGGCACAGATCGAACGTGGCGAAGCCAAAATTCAACGAAGAATTTCT
ATTAAAAGAGCCATGGAGGCTAAGATGGCAAGGTACAAGTCACCGTTTCA
CCAGCTCCGCATACAATACGGAACTAACAAAGGAAAGAATTATACCGAAG
AAGAGGACAGGTTTATCGTATGCATGTTACACAAATTGGGATTCGATCGG
GAGAATGTATACGAAGAATTACGTCAATCTGTCCGAAGTGCTCCTCAATT
TCGATTTGATTGGTTTATCAAATCTCGAACTGCAGTGGAATTGCAAAGAC
GCTGCAACACTTTGATCACTCTCATTGAAAGAGAAAACCAAGAGCTTGAA
GAGCGAGAGAAACGTGAAAAACGCAAAGGAGCCAAACCAAATGCTGCTAG
AACCCCTGCTCAAGGAAAGAGGAAAAATGAAGTTGTGGCTGCTAAACCCG
CCAAGAAAGCCAAAAACTAACGACGCGGGAAATGTAATCTGACAtctgat
tttttaaatatatactTTGTACATGTTTGGCCtaattttacaatattttt
agaatattatactcaaaaaatggctgaTCAAGTTGACGAAAAAACAATCC
AAAATACTGATGAAGTATCTAAGGAAGAAACCAAAGAAGAGGAGGTGACA
ACGAAAAAGGAAGATGAGAAGACAAATGAACAAGAATCGGAAGGAGAATC
TACTGATGATGAAGATGACAAACCAAAACCGCCACCAGTTAAAATCAATA
AAGCTATGGCTGTCAATGAAGAATACAATGAAAAGATGGAACATGATAGA
GCATCAAGATTCAGTTTTCTATTAAAACAAACTGAAATATTTTCCCATTT
CTTAAATGGAGCTGGTAAAAAGCCACCAAAAAgtcctttaaaaatgaaaa
agcagCCTGATCTTCCTTCCAGTCCACCACCAAAGAAGGGGGCTAAAGAC
CATCGTCATCGACGTaccgagaaagaagaagatgaagagcTTTTGGAAGA
TTCCAAGAGTTCTCAAGCACATGTTGTTCAATTCACCGCTTCACCTTCAT
ATATTAAATTTGGAACAATGAGGGACTACCAGATTAGAGGATTGAATTGG
ATGATTTCGCTTTATGAAAATGGTATCAATGGAATTCTAGCTGATGAAAT
GggTCTTGGTAAAACTTTGCAAACTATTTCATTGATTGGTTACATGAAAC
ATCACAGAAACAACTCTGGTCCACACATTGTAATTGTTCCCAAATCCACT
CTTGCTAATTGGATGGCTGAGTTTGCAAGATGGTGTCCAACTATAAGGAC
AGTTTGTTTAATTGGTAACCAAGATCAGAGGTCAGCAATAATCAGAGATA
CATTGCTACCGGGAGAATGGGATGTTCTTGTTACATCATACGAAATGTGT
ATTCGTGAAAAAACTGTACTCAAGAAATTCGCTTGGAGATTCTTGTGTAT
TGATGAAGCTCAcagaatcaaaaatgaaaaatcactgCTTTCAAGCATTG
TTCGTGAATTCAAATCATCAAACAGACTTCTGCTCACTGGTACCCCACTA
CAAAATAACCTCCATGAATTATGGGCTTTGTTAAATTTCTTACTCCCTGA
TGTGTTCAATTCGTCTGATGACTTCGATGCTTGGTTTAATGCTGAGAATT
TGTCCGAAGAAGATGCCATTGTCAAACGGTTGCACGCTGTTTTACGTCCT
TTCTTACTACGTCGTTTGAAAAGTGAAGTCGAGAAATCTCTCCTTCCAAA
GAAGATCACCAACGTTTACATAGGATTGAGTGCAATGCAAAGACAATGGT
ACACCAAGTTACTGATGAAGGATATTGATATTGTCAACGGTGCTGGTAAA
ACTGACCGGATGAGATTGTTGAATATCCTTATGCAGCTTCGAAAATGTTG
TAATCACCCTTATCTTTTCGATGGAGCTGAACCTGGACCACCATATACAA
CAGACGTTCATTTGGTTGATAATTGCGGTAAAATGAGTGTCTTGGATAAA
CTGTTGGTGAGAATGAAGGAGCGAGGATCACGTGTTTTGGTGTTTAGTCA
GATGACTCGTATGCTTGATATCCTGGAAGATTACTCTATGTGGAGAGGTT
TCCAATACTGTCGATTGGACGGTCAAACACCACATGAAGAACGTACCGCT
CAAATTAACGATTTCAACTCACCTGGAAGTgacaaatttgtgttttttct
gAGTACACGTGCTGGAGGTCTGGGTATCAATCTTGCAACAGCTGATGTGG
TCGTCATGTTTGATAATGATTGGAATCCACAAGTCGATCTCCAAGCACAG
GATCGAGCACATCGTATCGGTCAAACCAAACAAGTACAAGTATTCCGTTT
CATCACCGAAAACACCATCGAAGAAAGAATTATTGAACGTGCTGAAATGA
AATTACGTCTTGATCGTGTTGTCATTCAACAAGGTCGATTGGTGGAAGGA
CAAACGAAACTACAGAAGGATGAAGTACTGAACATGATTCGACATGGTGC
TGATAAAGTCTTCGCTTCCAAAGATTCAACTGTCACTGGTGAAGATATTG
ATCTTATCTTGGAAAGAGGTGCTAAGAAGACTGAGGAGATtgccaaaaaa
atgtcagattTGGGCGAAGGCCAACTCAAGAATTTCACCATGGATGCACC
TGACAGTATTTACAAATTCGAAGGTCAAGATTTCCGTGAGACGCACGATA
AACCCGGCGTATCTCACTGGATCGAACCACCAAAGCGTGAACGTAAAGCC
AACTACGCTGTTGACACCTACTTCAAAGAACTAATGAGAGTAAACGAGCC
CAAAGCACCCAAAGCTCCTCGACCACCCAAACAACCTAACGTCCAAGATT
TCCAATTCTTTCCACCAAGATTATTCGAACTTTTGGATATCGAGATTTAC
AGCTACCGAAAGGGGATTGGATACAAGGTACCACGTGATTATGACATGGA
TGACGCCGAATCGAAGAAATTCCAAAAAGAAGAACAATCAAAGATCGATA
ATGCTGAACCACTGAGCGAAGAAGAACAAACGGAAAAAGAACAATTGTTA
GCTCAAGGTTTCACCAATTGGAATAAACGCGATTTCAATCAATTCATCAA
GGCTTGCGAGAAATACGGTCGTGATGATTtgaattctatttgtaaagaag
TGGAAGGGAAATCACAAGCGGAGGTCCGAGAATATGCTGGTGTGTTTTGG
GAACGTTGCAATGAGCTGACTGACATTGACAAAATCATGGCACAGATCGA
ACGTGGCGAAGCCAAAATTCAACGAAGAATTTCTATTAAAAGAGCCATGG
AGGCTAAGATGGCAAGGTACAAGTCACCGTTTCACCAGCTCCGCATACAA
TACGGAACTAACAAAGGAAAGAATTATACCGAAGAAGAGGACAGGTTTAT
CGTATGCATGTTACACAAATTGGGATTCGATCGGGAGAATGTATACGAAG
AATTACGTCAATCTGTCCGAAGTGCTCCTCAATTTCGATTTGATTGGTTT
ATCAAATCTCGAACTGCAGTGGAATTGCAAAGACGCTGCAACACTTTGAT
CACTCTCATTGAAAGAGAAAACCAAGAGCTTGAAGAGCGAGAGAAACGTG
AAAAACGCAAAGGAGCCAAACCAAATGCTGCTAGAACCCCTGCTCAAGGA
AAGAGGAAAAATGAAGTTGTGGCTGCTAAACCCGCCAAGAAAGCCAAAAA
CTAACGACGCGGGAAATGTAATCTGACAtctgattttttaaatatatact
TTGTACATGTTTGGCCtaattttacaatatttttagaatattatactcaa
aaaatggctgaTCAAGTTGACGAAAAAACAATCCAAAATACTGATGAAGT
ATCTAAGGAAGAAACCAAAGAAGAGGAGGTGACAACGAAAAAGGAAGATG
AGAAGACAAATGAACAAGAATCGGAAGGAGAATCTACTGATGATGAAGAT
GACAAACCAAAACCGCCACCAGTTAAAATCAATAAAGCTATGGCTGTCAA
TGAAGAATACAATGAAAAGATGGAACATGATAGAGCATCAAGATTCAGTT
TTCTATTAAAACAAACTGAAATATTTTCCCATTTCTTAAATGGAGCTGGT
AAAAAGCCACCAAAAAgtcctttaaaaatgaaaaagcagCCTGATCTTCC
TTCCAGTCCACCACCAAAGAAGGGGGCTAAAGACCATCGTCATCGACGTa
ccgagaaagaagaagatgaagagcTTTTGGAAGATTCCAAGAGTTCTCAA
GCACATGTTGTTCAATTCACCGCTTCACCTTCATATATTAAATTTGGAAC
AATGAGGGACTACCAGATTAGAGGATTGAATTGGATGATTTCGCTTTATG
AAAATGGTATCAATGGAATTCTAGCTGATGAAATGggTCTTGGTAAAACT
TTGCAAACTATTTCATTGATTGGTTACATGAAACATCACAGAAACAACTC
TGGTCCACACATTGTAATTGTTCCCAAATCCACTCTTGCTAATTGGATGG
CTGAGTTTGCAAGATGGTGTCCAACTATAAGGACAGTTTGTTTAATTGGT
AACCAAGATCAGAGGTCAGCAATAATCAGAGATACATTGCTACCGGGAGA
ATGGGATGTTCTTGTTACATCATACGAAATGTGTATTCGTGAAAAAACTG
TACTCAAGAAATTCGCTTGGAGATTCTTGTGTATTGATGAAGCTCAcaga
atcaaaaatgaaaaatcactgCTTTCAAGCATTGTTCGTGAATTCAAATC
ATCAAACAGACTTCTGCTCACTGGTACCCCACTACAAAATAACCTCCATG
AATTATGGGCTTTGTTAAATTTCTTACTCCCTGATGTGTTCAATTCGTCT
GATGACTTCGATGCTTGGTTTAATGCTGAGAATTTGTCCGAAGAAGATGC
CATTGTCAAACGGTTGCACGCTGTTTTACGTCCTTTCTTACTACGTCGTT
TGAAAAGTGAAGTCGAGAAATCTCTCCTTCCAAAGAAGATCACCAACGTT
TACATAGGATTGAGTGCAATGCAAAGACAATGGTACACCAAGTTACTGAT
GAAGGATATTGATATTGTCAACGGTGCTGGTAAAACTGACCGGATGAGAT
TGTTGAATATCCTTATGCAGCTTCGAAAATGTTGTAATCACCCTTATCTT
TTCGATGGAGCTGAACCTGGACCACCATATACAACAGACGTTCATTTGGT
TGATAATTGCGGTAAAATGAGTGTCTTGGATAAACTGTTGGTGAGAATGA
AGGAGCGAGGATCACGTGTTTTGGTGTTTAGTCAGATGACTCGTATGCTT
GATATCCTGGAAGATTACTCTATGTGGAGAGGTTTCCAATACTGTCGATT
GGACGGTCAAACACCACATGAAGAACGTACCGCTCAAATTAACGATTTCA
ACTCACCTGGAAGTgacaaatttgtgttttttctgAGTACACGTGCTGGA
GGTCTGGGTATCAATCTTGCAACAGCTGATGTGGTCGTCATGTTTGATAA
TGATTGGAATCCACAAGTCGATCTCCAAGCACAGGATCGAGCACATCGTA
TCGGTCAAACCAAACAAGTACAAGTATTCCGTTTCATCACCGAAAACACC
ATCGAAGAAAGAATTATTGAACGTGCTGAAATGAAATTACGTCTTGATCG
TGTTGTCATTCAACAAGGTCGATTGGTGGAAGGACAAACGAAACTACAGA
AGGATGAAGTACTGAACATGATTCGACATGGTGCTGATAAAGTCTTCGCT
TCCAAAGATTCAACTGTCACTGGTGAAGATATTGATCTTATCTTGGAAAG
AGGTGCTAAGAAGACTGAGGAGATtgccaaaaaaatgtcagattTGGGCG
AAGGCCAACTCAAGAATTTCACCATGGATGCACCTGACAGTATTTACAAA
TTCGAAGGTCAAGATTTCCGTGAGACGCACGATAAACCCGGCGTATCTCA
CTGGATCGAACCACCAAAGCGTGAACGTAAAGCCAACTACGCTGTTGACA
CCTACTTCAAAGAACTAATGAGAGTAAACGAGCCCAAAGCACCCAAAGCT
CCTCGACCACCCAAACAACCTAACGTCCAAGATTTCCAATTCTTTCCACC
AAGATTATTCGAACTTTTGGATATCGAGATTTACAGCTACCGAAAGGGGA
TTGGATACAAGGTACCACGTGATTATGACATGGATGACGCCGAATCGAAG
AAATTCCAAAAAGAAGAACAATCAAAGATCGATAATGCTGAACCACTGAG
CGAAGAAGAACAAACGGAAAAAGAACAATTGTTAGCTCAAGGTTTCACCA
ATTGGAATAAACGCGATTTCAATCAATTCATCAAGGCTTGCGAGAAATAC
GGTCGTGATGATTtgaattctatttgtaaagaagTGGAAGGGAAATCACA
AGCGGAGGTCCGAGAATATGCTGGTGTGTTTTGGGAACGTTGCAATGAGC
TGACTGACATTGACAAAATCATGGCACAGATCGAACGTGGCGAAGCCAAA
ATTCAACGAAGAATTTCTATTAAAAGAGCCATGGAGGCTAAGATGGCAAG
GTACAAGTCACCGTTTCACCAGCTCCGCATACAATACGGAACTAACAAAG
GAAAGAATTATACCGAAGAAGAGGACAGGTTTATCGTATGCATGTTACAC
AAATTGGGATTCGATCGGGAGAATGTATACGAAGAATTACGTCAATCTGT
CCGAAGTGCTCCTCAATTTCGATTTGATTGGTTTATCAAATCTCGAACTG
CAGTGGAATTGCAAAGACGCTGCAACACTTTGATCACTCTCATTGAAAGA
GAAAACCAAGAGCTTGAAGAGCGAGAGAAACGTGAAAAACGCAAAGGAGC
CAAACCAAATGCTGCTAGAACCCCTGCTCAAGGAAAGAGGAAAAATGAAG
TTGTGGCTGCTAAACCCGCCAAGAAAGCCAAAAACTAACGACGCGGGAAA
TGTAATCTGACAtctgattttttaaatatatactTTGTACATGTTTGGCC
taattttacaatatttttagaatattatactcaaaaaatggctgaTCAAG
TTGACGAAAAAACAATCCAAAATACTGATGAAGTATCTAAGGAAGAAACC
AAAGAAGAGGAGGTGACAACGAAAAAGGAAGATGAGAAGACAAATGAACA
AGAATCGGAAGGAGAATCTACTGATGATGAAGATGACAAACCAAAACCGC
CACCAGTTAAAATCAATAAAGCTATGGCTGTCAATGAAGAATACAATGAA
AAGATGGAACATGATAGAGCATCAAGATTCAGTTTTCTATTAAAACAAAC
TGAAATATTTTCCCATTTCTTAAATGGAGCTGGTAAAAAGCCACCAAAAA
gtcctttaaaaatgaaaaagcagCCTGATCTTCCTTCCAGTCCACCACCA
AAGAAGGGGGCTAAAGACCATCGTCATCGACGTaccgagaaagaagaaga
tgaagagcTTTTGGAAGATTCCAAGAGTTCTCAAGCACATGTTGTTCAAT
TCACCGCTTCACCTTCATATATTAAATTTGGAACAATGAGGGACTACCAG
ATTAGAGGATTGAATTGGATGATTTCGCTTTATGAAAATGGTATCAATGG
AATTCTAGCTGATGAAATGggTCTTGGTAAAACTTTGCAAACTATTTCAT
TGATTGGTTACATGAAACATCACAGAAACAACTCTGGTCCACACATTGTA
ATTGTTCCCAAATCCACTCTTGCTAATTGGATGGCTGAGTTTGCAAGATG
GTGTCCAACTATAAGGACAGTTTGTTTAATTGGTAACCAAGATCAGAGGT
CAGCAATAATCAGAGATACATTGCTACCGGGAGAATGGGATGTTCTTGTT
ACATCATACGAAATGTGTATTCGTGAAAAAACTGTACTCAAGAAATTCGC
TTGGAGATTCTTGTGTATTGATGAAGCTCAcagaatcaaaaatgaaaaat
cactgCTTTCAAGCATTGTTCGTGAATTCAAATCATCAAACAGACTTCTG
CTCACTGGTACCCCACTACAAAATAACCTCCATGAATTATGGGCTTTGTT
AAATTTCTTACTCCCTGATGTGTTCAATTCGTCTGATGACTTCGATGCTT
GGTTTAATGCTGAGAATTTGTCCGAAGAAGATGCCATTGTCAAACGGTTG
CACGCTGTTTTACGTCCTTTCTTACTACGTCGTTTGAAAAGTGAAGTCGA
GAAATCTCTCCTTCCAAAGAAGATCACCAACGTTTACATAGGATTGAGTG
CAATGCAAAGACAATGGTACACCAAGTTACTGATGAAGGATATTGATATT
GTCAACGGTGCTGGTAAAACTGACCGGATGAGATTGTTGAATATCCTTAT
GCAGCTTCGAAAATGTTGTAATCACCCTTATCTTTTCGATGGAGCTGAAC
CTGGACCACCATATACAACAGACGTTCATTTGGTTGATAATTGCGGTAAA
ATGAGTGTCTTGGATAAACTGTTGGTGAGAATGAAGGAGCGAGGATCACG
TGTTTTGGTGTTTAGTCAGATGACTCGTATGCTTGATATCCTGGAAGATT
ACTCTATGTGGAGAGGTTTCCAATACTGTCGATTGGACGGTCAAACACCA
CATGAAGAACGTACCGCTCAAATTAACGATTTCAACTCACCTGGAAGTga
caaatttgtgttttttctgAGTACACGTGCTGGAGGTCTGGGTATCAATC
TTGCAACAGCTGATGTGGTCGTCATGTTTGATAATGATTGGAATCCACAA
GTCGATCTCCAAGCACAGGATCGAGCACATCGTATCGGTCAAACCAAACA
AGTACAAGTATTCCGTTTCATCACCGAAAACACCATCGAAGAAAGAATTA
TTGAACGTGCTGAAATGAAATTACGTCTTGATCGTGTTGTCATTCAACAA
GGTCGATTGGTGGAAGGACAAACGAAACTACAGAAGGATGAAGTACTGAA
CATGATTCGACATGGTGCTGATAAAGTCTTCGCTTCCAAAGATTCAACTG
TCACTGGTGAAGATATTGATCTTATCTTGGAAAGAGGTGCTAAGAAGACT
GAGGAGATtgccaaaaaaatgtcagattTGGGCGAAGGCCAACTCAAGAA
TTTCACCATGGATGCACCTGACAGTATTTACAAATTCGAAGGTCAAGATT
TCCGTGAGACGCACGATAAACCCGGCGTATCTCACTGGATCGAACCACCA
AAGCGTGAACGTAAAGCCAACTACGCTGTTGACACCTACTTCAAAGAACT
AATGAGAGTAAACGAGCCCAAAGCACCCAAAGCTCCTCGACCACCCAAAC
AACCTAACGTCCAAGATTTCCAATTCTTTCCACCAAGATTATTCGAACTT
TTGGATATCGAGATTTACAGCTACCGAAAGGGGATTGGATACAAGGTACC
ACGTGATTATGACATGGATGACGCCGAATCGAAGAAATTCCAAAAAGAAG
AACAATCAAAGATCGATAATGCTGAACCACTGAGCGAAGAAGAACAAACG
GAAAAAGAACAATTGTTAGCTCAAGGTTTCACCAATTGGAATAAACGCGA
TTTCAATCAATTCATCAAGGCTTGCGAGAAATACGGTCGTGATGATTtga
attctatttgtaaagaagTGGAAGGGAAATCACAAGCGGAGGTCCGAGAA
TATGCTGGTGTGTTTTGGGAACGTTGCAATGAGCTGACTGACATTGACAA
AATCATGGCACAGATCGAACGTGGCGAAGCCAAAATTCAACGAAGAATTT
CTATTAAAAGAGCCATGGAGGCTAAGATGGCAAGGTACAAGTCACCGTTT
CACCAGCTCCGCATACAATACGGAACTAACAAAGGAAAGAATTATACCGA
AGAAGAGGACAGGTTTATCGTATGCATGTTACACAAATTGGGATTCGATC
GGGAGAATGTATACGAAGAATTACGTCAATCTGTCCGAAGTGCTCCTCAA
TTTCGATTTGATTGGTTTATCAAATCTCGAACTGCAGTGGAATTGCAAAG
ACGCTGCAACACTTTGATCACTCTCATTGAAAGAGAAAACCAAGAGCTTG
AAGAGCGAGAGAAACGTGAAAAACGCAAAGGAGCCAAACCAAATGCTGCT
AGAACCCCTGCTCAAGGAAAGAGGAAAAATGAAGTTGTGGCTGCTAAACC
CGCCAAGAAAGCCAAAAACTAACGACGCGGGAAATGTAATCTGACAtctg
attttttaaatatatactTTGTACATGTTTGGCCtaattttacaatattt
ttagaatattatactcaaaaaatggctgaTCAAGTTGACGAAAAAACAAT
CCAAAATACTGATGAAGTATCTAAGGAAGAAACCAAAGAAGAGGAGGTGA
CAACGAAAAAGGAAGATGAGAAGACAAATGAACAAGAATCGGAAGGAGAA
TCTACTGATGATGAAGATGACAAACCAAAACCGCCACCAGTTAAAATCAA
TAAAGCTATGGCTGTCAATGAAGAATACAATGAAAAGATGGAACATGATA
GAGCATCAAGATTCAGTTTTCTATTAAAACAAACTGAAATATTTTCCCAT
TTCTTAAATGGAGCTGGTAAAAAGCCACCAAAAAgtcctttaaaaatgaa
aaagcagCCTGATCTTCCTTCCAGTCCACCACCAAAGAAGGGGGCTAAAG
ACCATCGTCATCGACGTaccgagaaagaagaagatgaagagcTTTTGGAA
GATTCCAAGAGTTCTCAAGCACATGTTGTTCAATTCACCGCTTCACCTTC
ATATATTAAATTTGGAACAATGAGGGACTACCAGATTAGAGGATTGAATT
GGATGATTTCGCTTTATGAAAATGGTATCAATGGAATTCTAGCTGATGAA
ATGggTCTTGGTAAAACTTTGCAAACTATTTCATTGATTGGTTACATGAA
ACATCACAGAAACAACTCTGGTCCACACATTGTAATTGTTCCCAAATCCA
CTCTTGCTAATTGGATGGCTGAGTTTGCAAGATGGTGTCCAACTATAAGG
ACAGTTTGTTTAATTGGTAACCAAGATCAGAGGTCAGCAATAATCAGAGA
TACATTGCTACCGGGAGAATGGGATGTTCTTGTTACATCATACGAAATGT
GTATTCGTGAAAAAACTGTACTCAAGAAATTCGCTTGGAGATTCTTGTGT
ATTGATGAAGCTCAcagaatcaaaaatgaaaaatcactgCTTTCAAGCAT
TGTTCGTGAATTCAAATCATCAAACAGACTTCTGCTCACTGGTACCCCAC
TACAAAATAACCTCCATGAATTATGGGCTTTGTTAAATTTCTTACTCCCT
GATGTGTTCAATTCGTCTGATGACTTCGATGCTTGGTTTAATGCTGAGAA
TTTGTCCGAAGAAGATGCCATTGTCAAACGGTTGCACGCTGTTTTACGTC
CTTTCTTACTACGTCGTTTGAAAAGTGAAGTCGAGAAATCTCTCCTTCCA
AAGAAGATCACCAACGTTTACATAGGATTGAGTGCAATGCAAAGACAATG
GTACACCAAGTTACTGATGAAGGATATTGATATTGTCAACGGTGCTGGTA
AAACTGACCGGATGAGATTGTTGAATATCCTTATGCAGCTTCGAAAATGT
TGTAATCACCCTTATCTTTTCGATGGAGCTGAACCTGGACCACCATATAC
AACAGACGTTCATTTGGTTGATAATTGCGGTAAAATGAGTGTCTTGGATA
AACTGTTGGTGAGAATGAAGGAGCGAGGATCACGTGTTTTGGTGTTTAGT
CAGATGACTCGTATGCTTGATATCCTGGAAGATTACTCTATGTGGAGAGG
TTTCCAATACTGTCGATTGGACGGTCAAACACCACATGAAGAACGTACCG
CTCAAATTAACGATTTCAACTCACCTGGAAGTgacaaatttgtgtttttt
ctgAGTACACGTGCTGGAGGTCTGGGTATCAATCTTGCAACAGCTGATGT
GGTCGTCATGTTTGATAATGATTGGAATCCACAAGTCGATCTCCAAGCAC
AGGATCGAGCACATCGTATCGGTCAAACCAAACAAGTACAAGTATTCCGT
TTCATCACCGAAAACACCATCGAAGAAAGAATTATTGAACGTGCTGAAAT
GAAATTACGTCTTGATCGTGTTGTCATTCAACAAGGTCGATTGGTGGAAG
GACAAACGAAACTACAGAAGGATGAAGTACTGAACATGATTCGACATGGT
GCTGATAAAGTCTTCGCTTCCAAAGATTCAACTGTCACTGGTGAAGATAT
TGATCTTATCTTGGAAAGAGGTGCTAAGAAGACTGAGGAGATtgccaaaa
aaatgtcagattTGGGCGAAGGCCAACTCAAGAATTTCACCATGGATGCA
CCTGACAGTATTTACAAATTCGAAGGTCAAGATTTCCGTGAGACGCACGA
TAAACCCGGCGTATCTCACTGGATCGAACCACCAAAGCGTGAACGTAAAG
CCAACTACGCTGTTGACACCTACTTCAAAGAACTAATGAGAGTAAACGAG
CCCAAAGCACCCAAAGCTCCTCGACCACCCAAACAACCTAACGTCCAAGA
TTTCCAATTCTTTCCACCAAGATTATTCGAACTTTTGGATATCGAGATTT
ACAGCTACCGAAAGGGGATTGGATACAAGGTACCACGTGATTATGACATG
GATGACGCCGAATCGAAGAAATTCCAAAAAGAAGAACAATCAAAGATCGA
TAATGCTGAACCACTGAGCGAAGAAGAACAAACGGAAAAAGAACAATTGT
TAGCTCAAGGTTTCACCAATTGGAATAAACGCGATTTCAATCAATTCATC
AAGGCTTGCGAGAAATACGGTCGTGATGATTtgaattctatttgtaaaga
agTGGAAGGGAAATCACAAGCGGAGGTCCGAGAATATGCTGGTGTGTTTT
GGGAACGTTGCAATGAGCTGACTGACATTGACAAAATCATGGCACAGATC
GAACGTGGCGAAGCCAAAATTCAACGAAGAATTTCTATTAAAAGAGCCAT
GGAGGCTAAGATGGCAAGGTACAAGTCACCGTTTCACCAGCTCCGCATAC
AATACGGAACTAACAAAGGAAAGAATTATACCGAAGAAGAGGACAGGTTT
ATCGTATGCATGTTACACAAATTGGGATTCGATCGGGAGAATGTATACGA
AGAATTACGTCAATCTGTCCGAAGTGCTCCTCAATTTCGATTTGATTGGT
TTATCAAATCTCGAACTGCAGTGGAATTGCAAAGACGCTGCAACACTTTG
ATCACTCTCATTGAAAGAGAAAACCAAGAGCTTGAAGAGCGAGAGAAACG
TGAAAAACGCAAAGGAGCCAAACCAAATGCTGCTAGAACCCCTGCTCAAG
GAAAGAGGAAAAATGAAGTTGTGGCTGCTAAACCCGCCAAGAAAGCCAAA
AACTAACGACGCGGGAAATGTAATCTGACAtctgattttttaaatatata
ctTTGTACATGTTTGGCCtaattttacaatatttttagaatattatactc
aaaaaatggctgaTCAAGTTGACGAAAAAACAATCCAAAATACTGATGAA
GTATCTAAGGAAGAAACCAAAGAAGAGGAGGTGACAACGAAAAAGGAAGA
TGAGAAGACAAATGAACAAGAATCGGAAGGAGAATCTACTGATGATGAAG
ATGACAAACCAAAACCGCCACCAGTTAAAATCAATAAAGCTATGGCTGTC
AATGAAGAATACAATGAAAAGATGGAACATGATAGAGCATCAAGATTCAG
TTTTCTATTAAAACAAACTGAAATATTTTCCCATTTCTTAAATGGAGCTG
GTAAAAAGCCACCAAAAAgtcctttaaaaatgaaaaagcagCCTGATCTT
CCTTCCAGTCCACCACCAAAGAAGGGGGCTAAAGACCATCGTCATCGACG
TaccgagaaagaagaagatgaagagcTTTTGGAAGATTCCAAGAGTTCTC
AAGCACATGTTGTTCAATTCACCGCTTCACCTTCATATATTAAATTTGGA
ACAATGAGGGACTACCAGATTAGAGGATTGAATTGGATGATTTCGCTTTA
TGAAAATGGTATCAATGGAATTCTAGCTGATGAAATGggTCTTGGTAAAA
CTTTGCAAACTATTTCATTGATTGGTTACATGAAACATCACAGAAACAAC
TCTGGTCCACACATTGTAATTGTTCCCAAATCCACTCTTGCTAATTGGAT
GGCTGAGTTTGCAAGATGGTGTCCAACTATAAGGACAGTTTGTTTAATTG
GTAACCAAGATCAGAGGTCAGCAATAATCAGAGATACATTGCTACCGGGA
GAATGGGATGTTCTTGTTACATCATACGAAATGTGTATTCGTGAAAAAAC
TGTACTCAAGAAATTCGCTTGGAGATTCTTGTGTATTGATGAAGCTCAca
gaatcaaaaatgaaaaatcactgCTTTCAAGCATTGTTCGTGAATTCAAA
TCATCAAACAGACTTCTGCTCACTGGTACCCCACTACAAAATAACCTCCA
TGAATTATGGGCTTTGTTAAATTTCTTACTCCCTGATGTGTTCAATTCGT
CTGATGACTTCGATGCTTGGTTTAATGCTGAGAATTTGTCCGAAGAAGAT
GCCATTGTCAAACGGTTGCACGCTGTTTTACGTCCTTTCTTACTACGTCG
TTTGAAAAGTGAAGTCGAGAAATCTCTCCTTCCAAAGAAGATCACCAACG
TTTACATAGGATTGAGTGCAATGCAAAGACAATGGTACACCAAGTTACTG
ATGAAGGATATTGATATTGTCAACGGTGCTGGTAAAACTGACCGGATGAG
ATTGTTGAATATCCTTATGCAGCTTCGAAAATGTTGTAATCACCCTTATC
TTTTCGATGGAGCTGAACCTGGACCACCATATACAACAGACGTTCATTTG
GTTGATAATTGCGGTAAAATGAGTGTCTTGGATAAACTGTTGGTGAGAAT
GAAGGAGCGAGGATCACGTGTTTTGGTGTTTAGTCAGATGACTCGTATGC
TTGATATCCTGGAAGATTACTCTATGTGGAGAGGTTTCCAATACTGTCGA
TTGGACGGTCAAACACCACATGAAGAACGTACCGCTCAAATTAACGATTT
CAACTCACCTGGAAGTgacaaatttgtgttttttctgAGTACACGTGCTG
GAGGTCTGGGTATCAATCTTGCAACAGCTGATGTGGTCGTCATGTTTGAT
AATGATTGGAATCCACAAGTCGATCTCCAAGCACAGGATCGAGCACATCG
TATCGGTCAAACCAAACAAGTACAAGTATTCCGTTTCATCACCGAAAACA
CCATCGAAGAAAGAATTATTGAACGTGCTGAAATGAAATTACGTCTTGAT
CGTGTTGTCATTCAACAAGGTCGATTGGTGGAAGGACAAACGAAACTACA
GAAGGATGAAGTACTGAACATGATTCGACATGGTGCTGATAAAGTCTTCG
CTTCCAAAGATTCAACTGTCACTGGTGAAGATATTGATCTTATCTTGGAA
AGAGGTGCTAAGAAGACTGAGGAGATtgccaaaaaaatgtcagattTGGG
CGAAGGCCAACTCAAGAATTTCACCATGGATGCACCTGACAGTATTTACA
AATTCGAAGGTCAAGATTTCCGTGAGACGCACGATAAACCCGGCGTATCT
CACTGGATCGAACCACCAAAGCGTGAACGTAAAGCCAACTACGCTGTTGA
CACCTACTTCAAAGAACTAATGAGAGTAAACGAGCCCAAAGCACCCAAAG
CTCCTCGACCACCCAAACAACCTAACGTCCAAGATTTCCAATTCTTTCCA
CCAAGATTATTCGAACTTTTGGATATCGAGATTTACAGCTACCGAAAGGG
GATTGGATACAAGGTACCACGTGATTATGACATGGATGACGCCGAATCGA
AGAAATTCCAAAAAGAAGAACAATCAAAGATCGATAATGCTGAACCACTG
AGCGAAGAAGAACAAACGGAAAAAGAACAATTGTTAGCTCAAGGTTTCAC
CAATTGGAATAAACGCGATTTCAATCAATTCATCAAGGCTTGCGAGAAAT
ACGGTCGTGATGATTtgaattctatttgtaaagaagTGGAAGGGAAATCA
CAAGCGGAGGTCCGAGAATATGCTGGTGTGTTTTGGGAACGTTGCAATGA
GCTGACTGACATTGACAAAATCATGGCACAGATCGAACGTGGCGAAGCCA
AAATTCAACGAAGAATTTCTATTAAAAGAGCCATGGAGGCTAAGATGGCA
AGGTACAAGTCACCGTTTCACCAGCTCCGCATACAATACGGAACTAACAA
AGGAAAGAATTATACCGAAGAAGAGGACAGGTTTATCGTATGCATGTTAC
ACAAATTGGGATTCGATCGGGAGAATGTATACGAAGAATTACGTCAATCT
GTCCGAAGTGCTCCTCAATTTCGATTTGATTGGTTTATCAAATCTCGAAC
TGCAGTGGAATTGCAAAGACGCTGCAACACTTTGATCACTCTCATTGAAA
GAGAAAACCAAGAGCTTGAAGAGCGAGAGAAACGTGAAAAACGCAAAGGA
GCCAAACCAAATGCTGCTAGAACCCCTGCTCAAGGAAAGAGGAAAAATGA
AGTTGTGGCTGCTAAACCCGCCAAGAAAGCCAAAAACTAACGACGCGGGA
AATGTAATCTGACAtctgattttttaaatatatactTTGTACATGTTTGG
CCtaattttacaatatttttagaatattatactcaaaaaatggctgaTCA
AGTTGACGAAAAAACAATCCAAAATACTGATGAAGTATCTAAGGAAGAAA
CCAAAGAAGAGGAGGTGACAACGAAAAAGGAAGATGAGAAGACAAATGAA
CAAGAATCGGAAGGAGAATCTACTGATGATGAAGATGACAAACCAAAACC
GCCACCAGTTAAAATCAATAAAGCTATGGCTGTCAATGAAGAATACAATG
AAAAGATGGAACATGATAGAGCATCAAGATTCAGTTTTCTATTAAAACAA
ACTGAAATATTTTCCCATTTCTTAAATGGAGCTGGTAAAAAGCCACCAAA
AAgtcctttaaaaatgaaaaagcagCCTGATCTTCCTTCCAGTCCACCAC
CAAAGAAGGGGGCTAAAGACCATCGTCATCGACGTaccgagaaagaagaa
gatgaagagcTTTTGGAAGATTCCAAGAGTTCTCAAGCACATGTTGTTCA
ATTCACCGCTTCACCTTCATATATTAAATTTGGAACAATGAGGGACTACC
AGATTAGAGGATTGAATTGGATGATTTCGCTTTATGAAAATGGTATCAAT
GGAATTCTAGCTGATGAAATGggTCTTGGTAAAACTTTGCAAACTATTTC
ATTGATTGGTTACATGAAACATCACAGAAACAACTCTGGTCCACACATTG
TAATTGTTCCCAAATCCACTCTTGCTAATTGGATGGCTGAGTTTGCAAGA
TGGTGTCCAACTATAAGGACAGTTTGTTTAATTGGTAACCAAGATCAGAG
GTCAGCAATAATCAGAGATACATTGCTACCGGGAGAATGGGATGTTCTTG
TTACATCATACGAAATGTGTATTCGTGAAAAAACTGTACTCAAGAAATTC
GCTTGGAGATTCTTGTGTATTGATGAAGCTCAcagaatcaaaaatgaaaa
atcactgCTTTCAAGCATTGTTCGTGAATTCAAATCATCAAACAGACTTC
TGCTCACTGGTACCCCACTACAAAATAACCTCCATGAATTATGGGCTTTG
TTAAATTTCTTACTCCCTGATGTGTTCAATTCGTCTGATGACTTCGATGC
TTGGTTTAATGCTGAGAATTTGTCCGAAGAAGATGCCATTGTCAAACGGT
TGCACGCTGTTTTACGTCCTTTCTTACTACGTCGTTTGAAAAGTGAAGTC
GAGAAATCTCTCCTTCCAAAGAAGATCACCAACGTTTACATAGGATTGAG
TGCAATGCAAAGACAATGGTACACCAAGTTACTGATGAAGGATATTGATA
TTGTCAACGGTGCTGGTAAAACTGACCGGATGAGATTGTTGAATATCCTT
ATGCAGCTTCGAAAATGTTGTAATCACCCTTATCTTTTCGATGGAGCTGA
ACCTGGACCACCATATACAACAGACGTTCATTTGGTTGATAATTGCGGTA
AAATGAGTGTCTTGGATAAACTGTTGGTGAGAATGAAGGAGCGAGGATCA
CGTGTTTTGGTGTTTAGTCAGATGACTCGTATGCTTGATATCCTGGAAGA
TTACTCTATGTGGAGAGGTTTCCAATACTGTCGATTGGACGGTCAAACAC
CACATGAAGAACGTACCGCTCAAATTAACGATTTCAACTCACCTGGAAGT
gacaaatttgtgttttttctgAGTACACGTGCTGGAGGTCTGGGTATCAA
TCTTGCAACAGCTGATGTGGTCGTCATGTTTGATAATGATTGGAATCCAC
AAGTCGATCTCCAAGCACAGGATCGAGCACATCGTATCGGTCAAACCAAA
CAAGTACAAGTATTCCGTTTCATCACCGAAAACACCATCGAAGAAAGAAT
TATTGAACGTGCTGAAATGAAATTACGTCTTGATCGTGTTGTCATTCAAC
AAGGTCGATTGGTGGAAGGACAAACGAAACTACAGAAGGATGAAGTACTG
AACATGATTCGACATGGTGCTGATAAAGTCTTCGCTTCCAAAGATTCAAC
TGTCACTGGTGAAGATATTGATCTTATCTTGGAAAGAGGTGCTAAGAAGA
CTGAGGAGATtgccaaaaaaatgtcagattTGGGCGAAGGCCAACTCAAG
AATTTCACCATGGATGCACCTGACAGTATTTACAAATTCGAAGGTCAAGA
TTTCCGTGAGACGCACGATAAACCCGGCGTATCTCACTGGATCGAACCAC
CAAAGCGTGAACGTAAAGCCAACTACGCTGTTGACACCTACTTCAAAGAA
CTAATGAGAGTAAACGAGCCCAAAGCACCCAAAGCTCCTCGACCACCCAA
ACAACCTAACGTCCAAGATTTCCAATTCTTTCCACCAAGATTATTCGAAC
TTTTGGATATCGAGATTTACAGCTACCGAAAGGGGATTGGATACAAGGTA
CCACGTGATTATGACATGGATGACGCCGAATCGAAGAAATTCCAAAAAGA
AGAACAATCAAAGATCGATAATGCTGAACCACTGAGCGAAGAAGAACAAA
CGGAAAAAGAACAATTGTTAGCTCAAGGTTTCACCAATTGGAATAAACGC
GATTTCAATCAATTCATCAAGGCTTGCGAGAAATACGGTCGTGATGATTt
gaattctatttgtaaagaagTGGAAGGGAAATCACAAGCGGAGGTCCGAG
AATATGCTGGTGTGTTTTGGGAACGTTGCAATGAGCTGACTGACATTGAC
AAAATCATGGCACAGATCGAACGTGGCGAAGCCAAAATTCAACGAAGAAT
TTCTATTAAAAGAGCCATGGAGGCTAAGATGGCAAGGTACAAGTCACCGT
TTCACCAGCTCCGCATACAATACGGAACTAACAAAGGAAAGAATTATACC
GAAGAAGAGGACAGGTTTATCGTATGCATGTTACACAAATTGGGATTCGA
TCGGGAGAATGTATACGAAGAATTACGTCAATCTGTCCGAAGTGCTCCTC
AATTTCGATTTGATTGGTTTATCAAATCTCGAACTGCAGTGGAATTGCAA
AGACGCTGCAACACTTTGATCACTCTCATTGAAAGAGAAAACCAAGAGCT
TGAAGAGCGAGAGAAACGTGAAAAACGCAAAGGAGCCAAACCAAATGCTG
CTAGAACCCCTGCTCAAGGAAAGAGGAAAAATGAAGTTGTGGCTGCTAAA
CCCGCCAAGAAAGCCAAAAACTAACGACGCGGGAAATGTAATCTGACAtc
tgattttttaaatatatactTTGTACATGTTTGGCCtaattttacaatat
ttttagaatattatactcaaaaaatggctgaTCAAGTTGACGAAAAAACA
ATCCAAAATACTGATGAAGTATCTAAGGAAGAAACCAAAGAAGAGGAGGT
GACAACGAAAAAGGAAGATGAGAAGACAAATGAACAAGAATCGGAAGGAG
AATCTACTGATGATGAAGATGACAAACCAAAACCGCCACCAGTTAAAATC
AATAAAGCTATGGCTGTCAATGAAGAATACAATGAAAAGATGGAACATGA
TAGAGCATCAAGATTCAGTTTTCTATTAAAACAAACTGAAATATTTTCCC
ATTTCTTAAATGGAGCTGGTAAAAAGCCACCAAAAAgtcctttaaaaatg
aaaaagcagCCTGATCTTCCTTCCAGTCCACCACCAAAGAAGGGGGCTAA
AGACCATCGTCATCGACGTaccgagaaagaagaagatgaagagcTTTTGG
AAGATTCCAAGAGTTCTCAAGCACATGTTGTTCAATTCACCGCTTCACCT
TCATATATTAAATTTGGAACAATGAGGGACTACCAGATTAGAGGATTGAA
TTGGATGATTTCGCTTTATGAAAATGGTATCAATGGAATTCTAGCTGATG
AAATGggTCTTGGTAAAACTTTGCAAACTATTTCATTGATTGGTTACATG
AAACATCACAGAAACAACTCTGGTCCACACATTGTAATTGTTCCCAAATC
CACTCTTGCTAATTGGATGGCTGAGTTTGCAAGATGGTGTCCAACTATAA
GGACAGTTTGTTTAATTGGTAACCAAGATCAGAGGTCAGCAATAATCAGA
GATACATTGCTACCGGGAGAATGGGATGTTCTTGTTACATCATACGAAAT
GTGTATTCGTGAAAAAACTGTACTCAAGAAATTCGCTTGGAGATTCTTGT
GTATTGATGAAGCTCAcagaatcaaaaatgaaaaatcactgCTTTCAAGC
ATTGTTCGTGAATTCAAATCATCAAACAGACTTCTGCTCACTGGTACCCC
ACTACAAAATAACCTCCATGAATTATGGGCTTTGTTAAATTTCTTACTCC
CTGATGTGTTCAATTCGTCTGATGACTTCGATGCTTGGTTTAATGCTGAG
AATTTGTCCGAAGAAGATGCCATTGTCAAACGGTTGCACGCTGTTTTACG
TCCTTTCTTACTACGTCGTTTGAAAAGTGAAGTCGAGAAATCTCTCCTTC
CAAAGAAGATCACCAACGTTTACATAGGATTGAGTGCAATGCAAAGACAA
TGGTACACCAAGTTACTGATGAAGGATATTGATATTGTCAACGGTGCTGG
TAAAACTGACCGGATGAGATTGTTGAATATCCTTATGCAGCTTCGAAAAT
GTTGTAATCACCCTTATCTTTTCGATGGAGCTGAACCTGGACCACCATAT
ACAACAGACGTTCATTTGGTTGATAATTGCGGTAAAATGAGTGTCTTGGA
TAAACTGTTGGTGAGAATGAAGGAGCGAGGATCACGTGTTTTGGTGTTTA
GTCAGATGACTCGTATGCTTGATATCCTGGAAGATTACTCTATGTGGAGA
GGTTTCCAATACTGTCGATTGGACGGTCAAACACCACATGAAGAACGTAC
CGCTCAAATTAACGATTTCAACTCACCTGGAAGTgacaaatttgtgtttt
ttctgAGTACACGTGCTGGAGGTCTGGGTATCAATCTTGCAACAGCTGAT
GTGGTCGTCATGTTTGATAATGATTGGAATCCACAAGTCGATCTCCAAGC
ACAGGATCGAGCACATCGTATCGGTCAAACCAAACAAGTACAAGTATTCC
GTTTCATCACCGAAAACACCATCGAAGAAAGAATTATTGAACGTGCTGAA
ATGAAATTACGTCTTGATCGTGTTGTCATTCAACAAGGTCGATTGGTGGA
AGGACAAACGAAACTACAGAAGGATGAAGTACTGAACATGATTCGACATG
GTGCTGATAAAGTCTTCGCTTCCAAAGATTCAACTGTCACTGGTGAAGAT
ATTGATCTTATCTTGGAAAGAGGTGCTAAGAAGACTGAGGAGATtgccaa
aaaaatgtcagattTGGGCGAAGGCCAACTCAAGAATTTCACCATGGATG
CACCTGACAGTATTTACAAATTCGAAGGTCAAGATTTCCGTGAGACGCAC
GATAAACCCGGCGTATCTCACTGGATCGAACCACCAAAGCGTGAACGTAA
AGCCAACTACGCTGTTGACACCTACTTCAAAGAACTAATGAGAGTAAACG
AGCCCAAAGCACCCAAAGCTCCTCGACCACCCAAACAACCTAACGTCCAA
GATTTCCAATTCTTTCCACCAAGATTATTCGAACTTTTGGATATCGAGAT
TTACAGCTACCGAAAGGGGATTGGATACAAGGTACCACGTGATTATGACA
TGGATGACGCCGAATCGAAGAAATTCCAAAAAGAAGAACAATCAAAGATC
GATAATGCTGAACCACTGAGCGAAGAAGAACAAACGGAAAAAGAACAATT
GTTAGCTCAAGGTTTCACCAATTGGAATAAACGCGATTTCAATCAATTCA
TCAAGGCTTGCGAGAAATACGGTCGTGATGATTtgaattctatttgtaaa
gaagTGGAAGGGAAATCACAAGCGGAGGTCCGAGAATATGCTGGTGTGTT
TTGGGAACGTTGCAATGAGCTGACTGACATTGACAAAATCATGGCACAGA
TCGAACGTGGCGAAGCCAAAATTCAACGAAGAATTTCTATTAAAAGAGCC
ATGGAGGCTAAGATGGCAAGGTACAAGTCACCGTTTCACCAGCTCCGCAT
ACAATACGGAACTAACAAAGGAAAGAATTATACCGAAGAAGAGGACAGGT
TTATCGTATGCATGTTACACAAATTGGGATTCGATCGGGAGAATGTATAC
GAAGAATTACGTCAATCTGTCCGAAGTGCTCCTCAATTTCGATTTGATTG
GTTTATCAAATCTCGAACTGCAGTGGAATTGCAAAGACGCTGCAACACTT
TGATCACTCTCATTGAAAGAGAAAACCAAGAGCTTGAAGAGCGAGAGAAA
CGTGAAAAACGCAAAGGAGCCAAACCAAATGCTGCTAGAACCCCTGCTCA
AGGAAAGAGGAAAAATGAAGTTGTGGCTGCTAAACCCGCCAAGAAAGCCA
AAAACTAACGACGCGGGAAATGTAATCTGACAtctgattttttaaatata
tactTTGTACATGTTTGGCCtaattttacaatatttttagaatattatac
tcaaaaaatggctgaTCAAGTTGACGAAAAAACAATCCAAAATACTGATG
AAGTATCTAAGGAAGAAACCAAAGAAGAGGAGGTGACAACGAAAAAGGAA
GATGAGAAGACAAATGAACAAGAATCGGAAGGAGAATCTACTGATGATGA
AGATGACAAACCAAAACCGCCACCAGTTAAAATCAATAAAGCTATGGCTG
TCAATGAAGAATACAATGAAAAGATGGAACATGATAGAGCATCAAGATTC
AGTTTTCTATTAAAACAAACTGAAATATTTTCCCATTTCTTAAATGGAGC
TGGTAAAAAGCCACCAAAAAgtcctttaaaaatgaaaaagcagCCTGATC
TTCCTTCCAGTCCACCACCAAAGAAGGGGGCTAAAGACCATCGTCATCGA
CGTaccgagaaagaagaagatgaagagcTTTTGGAAGATTCCAAGAGTTC
TCAAGCACATGTTGTTCAATTCACCGCTTCACCTTCATATATTAAATTTG
GAACAATGAGGGACTACCAGATTAGAGGATTGAATTGGATGATTTCGCTT
TATGAAAATGGTATCAATGGAATTCTAGCTGATGAAATGggTCTTGGTAA
AACTTTGCAAACTATTTCATTGATTGGTTACATGAAACATCACAGAAACA
ACTCTGGTCCACACATTGTAATTGTTCCCAAATCCACTCTTGCTAATTGG
ATGGCTGAGTTTGCAAGATGGTGTCCAACTATAAGGACAGTTTGTTTAAT
TGGTAACCAAGATCAGAGGTCAGCAATAATCAGAGATACATTGCTACCGG
GAGAATGGGATGTTCTTGTTACATCATACGAAATGTGTATTCGTGAAAAA
ACTGTACTCAAGAAATTCGCTTGGAGATTCTTGTGTATTGATGAAGCTCA
cagaatcaaaaatgaaaaatcactgCTTTCAAGCATTGTTCGTGAATTCA
AATCATCAAACAGACTTCTGCTCACTGGTACCCCACTACAAAATAACCTC
CATGAATTATGGGCTTTGTTAAATTTCTTACTCCCTGATGTGTTCAATTC
GTCTGATGACTTCGATGCTTGGTTTAATGCTGAGAATTTGTCCGAAGAAG
ATGCCATTGTCAAACGGTTGCACGCTGTTTTACGTCCTTTCTTACTACGT
CGTTTGAAAAGTGAAGTCGAGAAATCTCTCCTTCCAAAGAAGATCACCAA
CGTTTACATAGGATTGAGTGCAATGCAAAGACAATGGTACACCAAGTTAC
TGATGAAGGATATTGATATTGTCAACGGTGCTGGTAAAACTGACCGGATG
AGATTGTTGAATATCCTTATGCAGCTTCGAAAATGTTGTAATCACCCTTA
TCTTTTCGATGGAGCTGAACCTGGACCACCATATACAACAGACGTTCATT
TGGTTGATAATTGCGGTAAAATGAGTGTCTTGGATAAACTGTTGGTGAGA
ATGAAGGAGCGAGGATCACGTGTTTTGGTGTTTAGTCAGATGACTCGTAT
GCTTGATATCCTGGAAGATTACTCTATGTGGAGAGGTTTCCAATACTGTC
GATTGGACGGTCAAACACCACATGAAGAACGTACCGCTCAAATTAACGAT
TTCAACTCACCTGGAAGTgacaaatttgtgttttttctgAGTACACGTGC
TGGAGGTCTGGGTATCAATCTTGCAACAGCTGATGTGGTCGTCATGTTTG
ATAATGATTGGAATCCACAAGTCGATCTCCAAGCACAGGATCGAGCACAT
CGTATCGGTCAAACCAAACAAGTACAAGTATTCCGTTTCATCACCGAAAA
CACCATCGAAGAAAGAATTATTGAACGTGCTGAAATGAAATTACGTCTTG
ATCGTGTTGTCATTCAACAAGGTCGATTGGTGGAAGGACAAACGAAACTA
CAGAAGGATGAAGTACTGAACATGATTCGACATGGTGCTGATAAAGTCTT
CGCTTCCAAAGATTCAACTGTCACTGGTGAAGATATTGATCTTATCTTGG
AAAGAGGTGCTAAGAAGACTGAGGAGATtgccaaaaaaatgtcagattTG
GGCGAAGGCCAACTCAAGAATTTCACCATGGATGCACCTGACAGTATTTA
CAAATTCGAAGGTCAAGATTTCCGTGAGACGCACGATAAACCCGGCGTAT
CTCACTGGATCGAACCACCAAAGCGTGAACGTAAAGCCAACTACGCTGTT
GACACCTACTTCAAAGAACTAATGAGAGTAAACGAGCCCAAAGCACCCAA
AGCTCCTCGACCACCCAAACAACCTAACGTCCAAGATTTCCAATTCTTTC
CACCAAGATTATTCGAACTTTTGGATATCGAGATTTACAGCTACCGAAAG
GGGATTGGATACAAGGTACCACGTGATTATGACATGGATGACGCCGAATC
GAAGAAATTCCAAAAAGAAGAACAATCAAAGATCGATAATGCTGAACCAC
TGAGCGAAGAAGAACAAACGGAAAAAGAACAATTGTTAGCTCAAGGTTTC
ACCAATTGGAATAAACGCGATTTCAATCAATTCATCAAGGCTTGCGAGAA
ATACGGTCGTGATGATTtgaattctatttgtaaagaagTGGAAGGGAAAT
CACAAGCGGAGGTCCGAGAATATGCTGGTGTGTTTTGGGAACGTTGCAAT
GAGCTGACTGACATTGACAAAATCATGGCACAGATCGAACGTGGCGAAGC
CAAAATTCAACGAAGAATTTCTATTAAAAGAGCCATGGAGGCTAAGATGG
CAAGGTACAAGTCACCGTTTCACCAGCTCCGCATACAATACGGAACTAAC
AAAGGAAAGAATTATACCGAAGAAGAGGACAGGTTTATCGTATGCATGTT
ACACAAATTGGGATTCGATCGGGAGAATGTATACGAAGAATTACGTCAAT
CTGTCCGAAGTGCTCCTCAATTTCGATTTGATTGGTTTATCAAATCTCGA
ACTGCAGTGGAATTGCAAAGACGCTGCAACACTTTGATCACTCTCATTGA
AAGAGAAAACCAAGAGCTTGAAGAGCGAGAGAAACGTGAAAAACGCAAAG
GAGCCAAACCAAATGCTGCTAGAACCCCTGCTCAAGGAAAGAGGAAAAAT
GAAGTTGTGGCTGCTAAACCCGCCAAGAAAGCCAAAAACTAACGACGCGG
GAAATGTAATCTGACAtctgattttttaaatatatactTTGTACATGTTT
GGCCtaattttacaatatttttagaatattatactcaaaaaatggctgaT
CAAGTTGACGAAAAAACAATCCAAAATACTGATGAAGTATCTAAGGAAGA
AACCAAAGAAGAGGAGGTGACAACGAAAAAGGAAGATGAGAAGACAAATG
AACAAGAATCGGAAGGAGAATCTACTGATGATGAAGATGACAAACCAAAA
CCGCCACCAGTTAAAATCAATAAAGCTATGGCTGTCAATGAAGAATACAA
TGAAAAGATGGAACATGATAGAGCATCAAGATTCAGTTTTCTATTAAAAC
AAACTGAAATATTTTCCCATTTCTTAAATGGAGCTGGTAAAAAGCCACCA
AAAAgtcctttaaaaatgaaaaagcagCCTGATCTTCCTTCCAGTCCACC
ACCAAAGAAGGGGGCTAAAGACCATCGTCATCGACGTaccgagaaagaag
aagatgaagagcTTTTGGAAGATTCCAAGAGTTCTCAAGCACATGTTGTT
CAATTCACCGCTTCACCTTCATATATTAAATTTGGAACAATGAGGGACTA
CCAGATTAGAGGATTGAATTGGATGATTTCGCTTTATGAAAATGGTATCA
ATGGAATTCTAGCTGATGAAATGggTCTTGGTAAAACTTTGCAAACTATT
TCATTGATTGGTTACATGAAACATCACAGAAACAACTCTGGTCCACACAT
TGTAATTGTTCCCAAATCCACTCTTGCTAATTGGATGGCTGAGTTTGCAA
GATGGTGTCCAACTATAAGGACAGTTTGTTTAATTGGTAACCAAGATCAG
AGGTCAGCAATAATCAGAGATACATTGCTACCGGGAGAATGGGATGTTCT
TGTTACATCATACGAAATGTGTATTCGTGAAAAAACTGTACTCAAGAAAT
TCGCTTGGAGATTCTTGTGTATTGATGAAGCTCAcagaatcaaaaatgaa
aaatcactgCTTTCAAGCATTGTTCGTGAATTCAAATCATCAAACAGACT
TCTGCTCACTGGTACCCCACTACAAAATAACCTCCATGAATTATGGGCTT
TGTTAAATTTCTTACTCCCTGATGTGTTCAATTCGTCTGATGACTTCGAT
GCTTGGTTTAATGCTGAGAATTTGTCCGAAGAAGATGCCATTGTCAAACG
GTTGCACGCTGTTTTACGTCCTTTCTTACTACGTCGTTTGAAAAGTGAAG
TCGAGAAATCTCTCCTTCCAAAGAAGATCACCAACGTTTACATAGGATTG
AGTGCAATGCAAAGACAATGGTACACCAAGTTACTGATGAAGGATATTGA
TATTGTCAACGGTGCTGGTAAAACTGACCGGATGAGATTGTTGAATATCC
TTATGCAGCTTCGAAAATGTTGTAATCACCCTTATCTTTTCGATGGAGCT
GAACCTGGACCACCATATACAACAGACGTTCATTTGGTTGATAATTGCGG
TAAAATGAGTGTCTTGGATAAACTGTTGGTGAGAATGAAGGAGCGAGGAT
CACGTGTTTTGGTGTTTAGTCAGATGACTCGTATGCTTGATATCCTGGAA
GATTACTCTATGTGGAGAGGTTTCCAATACTGTCGATTGGACGGTCAAAC
ACCACATGAAGAACGTACCGCTCAAATTAACGATTTCAACTCACCTGGAA
GTgacaaatttgtgttttttctgAGTACACGTGCTGGAGGTCTGGGTATC
AATCTTGCAACAGCTGATGTGGTCGTCATGTTTGATAATGATTGGAATCC
ACAAGTCGATCTCCAAGCACAGGATCGAGCACATCGTATCGGTCAAACCA
AACAAGTACAAGTATTCCGTTTCATCACCGAAAACACCATCGAAGAAAGA
ATTATTGAACGTGCTGAAATGAAATTACGTCTTGATCGTGTTGTCATTCA
ACAAGGTCGATTGGTGGAAGGACAAACGAAACTACAGAAGGATGAAGTAC
TGAACATGATTCGACATGGTGCTGATAAAGTCTTCGCTTCCAAAGATTCA
ACTGTCACTGGTGAAGATATTGATCTTATCTTGGAAAGAGGTGCTAAGAA
GACTGAGGAGATtgccaaaaaaatgtcagattTGGGCGAAGGCCAACTCA
AGAATTTCACCATGGATGCACCTGACAGTATTTACAAATTCGAAGGTCAA
GATTTCCGTGAGACGCACGATAAACCCGGCGTATCTCACTGGATCGAACC
ACCAAAGCGTGAACGTAAAGCCAACTACGCTGTTGACACCTACTTCAAAG
AACTAATGAGAGTAAACGAGCCCAAAGCACCCAAAGCTCCTCGACCACCC
AAACAACCTAACGTCCAAGATTTCCAATTCTTTCCACCAAGATTATTCGA
ACTTTTGGATATCGAGATTTACAGCTACCGAAAGGGGATTGGATACAAGG
TACCACGTGATTATGACATGGATGACGCCGAATCGAAGAAATTCCAAAAA
GAAGAACAATCAAAGATCGATAATGCTGAACCACTGAGCGAAGAAGAACA
AACGGAAAAAGAACAATTGTTAGCTCAAGGTTTCACCAATTGGAATAAAC
GCGATTTCAATCAATTCATCAAGGCTTGCGAGAAATACGGTCGTGATGAT
TtgaattctatttgtaaagaagTGGAAGGGAAATCACAAGCGGAGGTCCG
AGAATATGCTGGTGTGTTTTGGGAACGTTGCAATGAGCTGACTGACATTG
ACAAAATCATGGCACAGATCGAACGTGGCGAAGCCAAAATTCAACGAAGA
ATTTCTATTAAAAGAGCCATGGAGGCTAAGATGGCAAGGTACAAGTCACC
GTTTCACCAGCTCCGCATACAATACGGAACTAACAAAGGAAAGAATTATA
CCGAAGAAGAGGACAGGTTTATCGTATGCATGTTACACAAATTGGGATTC
GATCGGGAGAATGTATACGAAGAATTACGTCAATCTGTCCGAAGTGCTCC
TCAATTTCGATTTGATTGGTTTATCAAATCTCGAACTGCAGTGGAATTGC
AAAGACGCTGCAACACTTTGATCACTCTCATTGAAAGAGAAAACCAAGAG
CTTGAAGAGCGAGAGAAACGTGAAAAACGCAAAGGAGCCAAACCAAATGC
TGCTAGAACCCCTGCTCAAGGAAAGAGGAAAAATGAAGTTGTGGCTGCTA
AACCCGCCAAGAAAGCCAAAAACTAACGACGCGGGAAATGTAATCTGACA
tctgattttttaaatatatactTTGTACATGTTTGGCCtaattttacaat
atttttagaatattatactcaaaaaatggctgaTCAAGTTGACGAAAAAA
CAATCCAAAATACTGATGAAGTATCTAAGGAAGAAACCAAAGAAGAGGAG
GTGACAACGAAAAAGGAAGATGAGAAGACAAATGAACAAGAATCGGAAGG
AGAATCTACTGATGATGAAGATGACAAACCAAAACCGCCACCAGTTAAAA
TCAATAAAGCTATGGCTGTCAATGAAGAATACAATGAAAAGATGGAACAT
GATAGAGCATCAAGATTCAGTTTTCTATTAAAACAAACTGAAATATTTTC
CCATTTCTTAAATGGAGCTGGTAAAAAGCCACCAAAAAgtcctttaaaaa
tgaaaaagcagCCTGATCTTCCTTCCAGTCCACCACCAAAGAAGGGGGCT
AAAGACCATCGTCATCGACGTaccgagaaagaagaagatgaagagcTTTT
GGAAGATTCCAAGAGTTCTCAAGCACATGTTGTTCAATTCACCGCTTCAC
CTTCATATATTAAATTTGGAACAATGAGGGACTACCAGATTAGAGGATTG
AATTGGATGATTTCGCTTTATGAAAATGGTATCAATGGAATTCTAGCTGA
TGAAATGggTCTTGGTAAAACTTTGCAAACTATTTCATTGATTGGTTACA
TGAAACATCACAGAAACAACTCTGGTCCACACATTGTAATTGTTCCCAAA
TCCACTCTTGCTAATTGGATGGCTGAGTTTGCAAGATGGTGTCCAACTAT
AAGGACAGTTTGTTTAATTGGTAACCAAGATCAGAGGTCAGCAATAATCA
GAGATACATTGCTACCGGGAGAATGGGATGTTCTTGTTACATCATACGAA
ATGTGTATTCGTGAAAAAACTGTACTCAAGAAATTCGCTTGGAGATTCTT
GTGTATTGATGAAGCTCAcagaatcaaaaatgaaaaatcactgCTTTCAA
GCATTGTTCGTGAATTCAAATCATCAAACAGACTTCTGCTCACTGGTACC
CCACTACAAAATAACCTCCATGAATTATGGGCTTTGTTAAATTTCTTACT
CCCTGATGTGTTCAATTCGTCTGATGACTTCGATGCTTGGTTTAATGCTG
AGAATTTGTCCGAAGAAGATGCCATTGTCAAACGGTTGCACGCTGTTTTA
CGTCCTTTCTTACTACGTCGTTTGAAAAGTGAAGTCGAGAAATCTCTCCT
TCCAAAGAAGATCACCAACGTTTACATAGGATTGAGTGCAATGCAAAGAC
AATGGTACACCAAGTTACTGATGAAGGATATTGATATTGTCAACGGTGCT
GGTAAAACTGACCGGATGAGATTGTTGAATATCCTTATGCAGCTTCGAAA
ATGTTGTAATCACCCTTATCTTTTCGATGGAGCTGAACCTGGACCACCAT
ATACAACAGACGTTCATTTGGTTGATAATTGCGGTAAAATGAGTGTCTTG
GATAAACTGTTGGTGAGAATGAAGGAGCGAGGATCACGTGTTTTGGTGTT
TAGTCAGATGACTCGTATGCTTGATATCCTGGAAGATTACTCTATGTGGA
GAGGTTTCCAATACTGTCGATTGGACGGTCAAACACCACATGAAGAACGT
ACCGCTCAAATTAACGATTTCAACTCACCTGGAAGTgacaaatttgtgtt
ttttctgAGTACACGTGCTGGAGGTCTGGGTATCAATCTTGCAACAGCTG
ATGTGGTCGTCATGTTTGATAATGATTGGAATCCACAAGTCGATCTCCAA
GCACAGGATCGAGCACATCGTATCGGTCAAACCAAACAAGTACAAGTATT
CCGTTTCATCACCGAAAACACCATCGAAGAAAGAATTATTGAACGTGCTG
AAATGAAATTACGTCTTGATCGTGTTGTCATTCAACAAGGTCGATTGGTG
GAAGGACAAACGAAACTACAGAAGGATGAAGTACTGAACATGATTCGACA
TGGTGCTGATAAAGTCTTCGCTTCCAAAGATTCAACTGTCACTGGTGAAG
ATATTGATCTTATCTTGGAAAGAGGTGCTAAGAAGACTGAGGAGATtgcc
aaaaaaatgtcagattTGGGCGAAGGCCAACTCAAGAATTTCACCATGGA
TGCACCTGACAGTATTTACAAATTCGAAGGTCAAGATTTCCGTGAGACGC
ACGATAAACCCGGCGTATCTCACTGGATCGAACCACCAAAGCGTGAACGT
AAAGCCAACTACGCTGTTGACACCTACTTCAAAGAACTAATGAGAGTAAA
CGAGCCCAAAGCACCCAAAGCTCCTCGACCACCCAAACAACCTAACGTCC
AAGATTTCCAATTCTTTCCACCAAGATTATTCGAACTTTTGGATATCGAG
ATTTACAGCTACCGAAAGGGGATTGGATACAAGGTACCACGTGATTATGA
CATGGATGACGCCGAATCGAAGAAATTCCAAAAAGAAGAACAATCAAAGA
TCGATAATGCTGAACCACTGAGCGAAGAAGAACAAACGGAAAAAGAACAA
TTGTTAGCTCAAGGTTTCACCAATTGGAATAAACGCGATTTCAATCAATT
CATCAAGGCTTGCGAGAAATACGGTCGTGATGATTtgaattctatttgta
aagaagTGGAAGGGAAATCACAAGCGGAGGTCCGAGAATATGCTGGTGTG
TTTTGGGAACGTTGCAATGAGCTGACTGACATTGACAAAATCATGGCACA
GATCGAACGTGGCGAAGCCAAAATTCAACGAAGAATTTCTATTAAAAGAG
CCATGGAGGCTAAGATGGCAAGGTACAAGTCACCGTTTCACCAGCTCCGC
ATACAATACGGAACTAACAAAGGAAAGAATTATACCGAAGAAGAGGACAG
GTTTATCGTATGCATGTTACACAAATTGGGATTCGATCGGGAGAATGTAT
ACGAAGAATTACGTCAATCTGTCCGAAGTGCTCCTCAATTTCGATTTGAT
TGGTTTATCAAATCTCGAACTGCAGTGGAATTGCAAAGACGCTGCAACAC
TTTGATCACTCTCATTGAAAGAGAAAACCAAGAGCTTGAAGAGCGAGAGA
AACGTGAAAAACGCAAAGGAGCCAAACCAAATGCTGCTAGAACCCCTGCT
CAAGGAAAGAGGAAAAATGAAGTTGTGGCTGCTAAACCCGCCAAGAAAGC
CAAAAACTAACGACGCGGGAAATGTAATCTGACAtctgattttttaaata
tatactTTGTACATGTTTGGCCtaattttacaatatttttagaatattat
actcaaaaaatggctgaTCAAGTTGACGAAAAAACAATCCAAAATACTGA
TGAAGTATCTAAGGAAGAAACCAAAGAAGAGGAGGTGACAACGAAAAAGG
AAGATGAGAAGACAAATGAACAAGAATCGGAAGGAGAATCTACTGATGAT
GAAGATGACAAACCAAAACCGCCACCAGTTAAAATCAATAAAGCTATGGC
TGTCAATGAAGAATACAATGAAAAGATGGAACATGATAGAGCATCAAGAT
TCAGTTTTCTATTAAAACAAACTGAAATATTTTCCCATTTCTTAAATGGA
GCTGGTAAAAAGCCACCAAAAAgtcctttaaaaatgaaaaagcagCCTGA
TCTTCCTTCCAGTCCACCACCAAAGAAGGGGGCTAAAGACCATCGTCATC
GACGTaccgagaaagaagaagatgaagagcTTTTGGAAGATTCCAAGAGT
TCTCAAGCACATGTTGTTCAATTCACCGCTTCACCTTCATATATTAAATT
TGGAACAATGAGGGACTACCAGATTAGAGGATTGAATTGGATGATTTCGC
TTTATGAAAATGGTATCAATGGAATTCTAGCTGATGAAATGggTCTTGGT
AAAACTTTGCAAACTATTTCATTGATTGGTTACATGAAACATCACAGAAA
CAACTCTGGTCCACACATTGTAATTGTTCCCAAATCCACTCTTGCTAATT
GGATGGCTGAGTTTGCAAGATGGTGTCCAACTATAAGGACAGTTTGTTTA
ATTGGTAACCAAGATCAGAGGTCAGCAATAATCAGAGATACATTGCTACC
GGGAGAATGGGATGTTCTTGTTACATCATACGAAATGTGTATTCGTGAAA
AAACTGTACTCAAGAAATTCGCTTGGAGATTCTTGTGTATTGATGAAGCT
CAcagaatcaaaaatgaaaaatcactgCTTTCAAGCATTGTTCGTGAATT
CAAATCATCAAACAGACTTCTGCTCACTGGTACCCCACTACAAAATAACC
TCCATGAATTATGGGCTTTGTTAAATTTCTTACTCCCTGATGTGTTCAAT
TCGTCTGATGACTTCGATGCTTGGTTTAATGCTGAGAATTTGTCCGAAGA
AGATGCCATTGTCAAACGGTTGCACGCTGTTTTACGTCCTTTCTTACTAC
GTCGTTTGAAAAGTGAAGTCGAGAAATCTCTCCTTCCAAAGAAGATCACC
AACGTTTACATAGGATTGAGTGCAATGCAAAGACAATGGTACACCAAGTT
ACTGATGAAGGATATTGATATTGTCAACGGTGCTGGTAAAACTGACCGGA
TGAGATTGTTGAATATCCTTATGCAGCTTCGAAAATGTTGTAATCACCCT
TATCTTTTCGATGGAGCTGAACCTGGACCACCATATACAACAGACGTTCA
TTTGGTTGATAATTGCGGTAAAATGAGTGTCTTGGATAAACTGTTGGTGA
GAATGAAGGAGCGAGGATCACGTGTTTTGGTGTTTAGTCAGATGACTCGT
ATGCTTGATATCCTGGAAGATTACTCTATGTGGAGAGGTTTCCAATACTG
TCGATTGGACGGTCAAACACCACATGAAGAACGTACCGCTCAAATTAACG
ATTTCAACTCACCTGGAAGTgacaaatttgtgttttttctgAGTACACGT
GCTGGAGGTCTGGGTATCAATCTTGCAACAGCTGATGTGGTCGTCATGTT
TGATAATGATTGGAATCCACAAGTCGATCTCCAAGCACAGGATCGAGCAC
ATCGTATCGGTCAAACCAAACAAGTACAAGTATTCCGTTTCATCACCGAA
AACACCATCGAAGAAAGAATTATTGAACGTGCTGAAATGAAATTACGTCT
TGATCGTGTTGTCATTCAACAAGGTCGATTGGTGGAAGGACAAACGAAAC
TACAGAAGGATGAAGTACTGAACATGATTCGACATGGTGCTGATAAAGTC
TTCGCTTCCAAAGATTCAACTGTCACTGGTGAAGATATTGATCTTATCTT
GGAAAGAGGTGCTAAGAAGACTGAGGAGATtgccaaaaaaatgtcagatt
TGGGCGAAGGCCAACTCAAGAATTTCACCATGGATGCACCTGACAGTATT
TACAAATTCGAAGGTCAAGATTTCCGTGAGACGCACGATAAACCCGGCGT
ATCTCACTGGATCGAACCACCAAAGCGTGAACGTAAAGCCAACTACGCTG
TTGACACCTACTTCAAAGAACTAATGAGAGTAAACGAGCCCAAAGCACCC
AAAGCTCCTCGACCACCCAAACAACCTAACGTCCAAGATTTCCAATTCTT
TCCACCAAGATTATTCGAACTTTTGGATATCGAGATTTACAGCTACCGAA
AGGGGATTGGATACAAGGTACCACGTGATTATGACATGGATGACGCCGAA
TCGAAGAAATTCCAAAAAGAAGAACAATCAAAGATCGATAATGCTGAACC
ACTGAGCGAAGAAGAACAAACGGAAAAAGAACAATTGTTAGCTCAAGGTT
TCACCAATTGGAATAAACGCGATTTCAATCAATTCATCAAGGCTTGCGAG
AAATACGGTCGTGATGATTtgaattctatttgtaaagaagTGGAAGGGAA
ATCACAAGCGGAGGTCCGAGAATATGCTGGTGTGTTTTGGGAACGTTGCA
ATGAGCTGACTGACATTGACAAAATCATGGCACAGATCGAACGTGGCGAA
GCCAAAATTCAACGAAGAATTTCTATTAAAAGAGCCATGGAGGCTAAGAT
GGCAAGGTACAAGTCACCGTTTCACCAGCTCCGCATACAATACGGAACTA
ACAAAGGAAAGAATTATACCGAAGAAGAGGACAGGTTTATCGTATGCATG
TTACACAAATTGGGATTCGATCGGGAGAATGTATACGAAGAATTACGTCA
ATCTGTCCGAAGTGCTCCTCAATTTCGATTTGATTGGTTTATCAAATCTC
GAACTGCAGTGGAATTGCAAAGACGCTGCAACACTTTGATCACTCTCATT
GAAAGAGAAAACCAAGAGCTTGAAGAGCGAGAGAAACGTGAAAAACGCAA
AGGAGCCAAACCAAATGCTGCTAGAACCCCTGCTCAAGGAAAGAGGAAAA
ATGAAGTTGTGGCTGCTAAACCCGCCAAGAAAGCCAAAAACTAACGACGC
GGGAAATGTAATCTGACAtctgattttttaaatatatactTTGTACATGT
TTGGCCtaattttacaatatttttagaatattatactcaaaaaatggctg
aTCAAGTTGACGAAAAAACAATCCAAAATACTGATGAAGTATCTAAGGAA
GAAACCAAAGAAGAGGAGGTGACAACGAAAAAGGAAGATGAGAAGACAAA
TGAACAAGAATCGGAAGGAGAATCTACTGATGATGAAGATGACAAACCAA
AACCGCCACCAGTTAAAATCAATAAAGCTATGGCTGTCAATGAAGAATAC
AATGAAAAGATGGAACATGATAGAGCATCAAGATTCAGTTTTCTATTAAA
ACAAACTGAAATATTTTCCCATTTCTTAAATGGAGCTGGTAAAAAGCCAC
CAAAAAgtcctttaaaaatgaaaaagcagCCTGATCTTCCTTCCAGTCCA
CCACCAAAGAAGGGGGCTAAAGACCATCGTCATCGACGTaccgagaaaga
agaagatgaagagcTTTTGGAAGATTCCAAGAGTTCTCAAGCACATGTTG
TTCAATTCACCGCTTCACCTTCATATATTAAATTTGGAACAATGAGGGAC
TACCAGATTAGAGGATTGAATTGGATGATTTCGCTTTATGAAAATGGTAT
CAATGGAATTCTAGCTGATGAAATGggTCTTGGTAAAACTTTGCAAACTA
TTTCATTGATTGGTTACATGAAACATCACAGAAACAACTCTGGTCCACAC
ATTGTAATTGTTCCCAAATCCACTCTTGCTAATTGGATGGCTGAGTTTGC
AAGATGGTGTCCAACTATAAGGACAGTTTGTTTAATTGGTAACCAAGATC
AGAGGTCAGCAATAATCAGAGATACATTGCTACCGGGAGAATGGGATGTT
CTTGTTACATCATACGAAATGTGTATTCGTGAAAAAACTGTACTCAAGAA
ATTCGCTTGGAGATTCTTGTGTATTGATGAAGCTCAcagaatcaaaaatg
aaaaatcactgCTTTCAAGCATTGTTCGTGAATTCAAATCATCAAACAGA
CTTCTGCTCACTGGTACCCCACTACAAAATAACCTCCATGAATTATGGGC
TTTGTTAAATTTCTTACTCCCTGATGTGTTCAATTCGTCTGATGACTTCG
ATGCTTGGTTTAATGCTGAGAATTTGTCCGAAGAAGATGCCATTGTCAAA
CGGTTGCACGCTGTTTTACGTCCTTTCTTACTACGTCGTTTGAAAAGTGA
AGTCGAGAAATCTCTCCTTCCAAAGAAGATCACCAACGTTTACATAGGAT
TGAGTGCAATGCAAAGACAATGGTACACCAAGTTACTGATGAAGGATATT
GATATTGTCAACGGTGCTGGTAAAACTGACCGGATGAGATTGTTGAATAT
CCTTATGCAGCTTCGAAAATGTTGTAATCACCCTTATCTTTTCGATGGAG
CTGAACCTGGACCACCATATACAACAGACGTTCATTTGGTTGATAATTGC
GGTAAAATGAGTGTCTTGGATAAACTGTTGGTGAGAATGAAGGAGCGAGG
ATCACGTGTTTTGGTGTTTAGTCAGATGACTCGTATGCTTGATATCCTGG
AAGATTACTCTATGTGGAGAGGTTTCCAATACTGTCGATTGGACGGTCAA
ACACCACATGAAGAACGTACCGCTCAAATTAACGATTTCAACTCACCTGG
AAGTgacaaatttgtgttttttctgAGTACACGTGCTGGAGGTCTGGGTA
TCAATCTTGCAACAGCTGATGTGGTCGTCATGTTTGATAATGATTGGAAT
CCACAAGTCGATCTCCAAGCACAGGATCGAGCACATCGTATCGGTCAAAC
CAAACAAGTACAAGTATTCCGTTTCATCACCGAAAACACCATCGAAGAAA
GAATTATTGAACGTGCTGAAATGAAATTACGTCTTGATCGTGTTGTCATT
CAACAAGGTCGATTGGTGGAAGGACAAACGAAACTACAGAAGGATGAAGT
ACTGAACATGATTCGACATGGTGCTGATAAAGTCTTCGCTTCCAAAGATT
CAACTGTCACTGGTGAAGATATTGATCTTATCTTGGAAAGAGGTGCTAAG
AAGACTGAGGAGATtgccaaaaaaatgtcagattTGGGCGAAGGCCAACT
CAAGAATTTCACCATGGATGCACCTGACAGTATTTACAAATTCGAAGGTC
AAGATTTCCGTGAGACGCACGATAAACCCGGCGTATCTCACTGGATCGAA
CCACCAAAGCGTGAACGTAAAGCCAACTACGCTGTTGACACCTACTTCAA
AGAACTAATGAGAGTAAACGAGCCCAAAGCACCCAAAGCTCCTCGACCAC
CCAAACAACCTAACGTCCAAGATTTCCAATTCTTTCCACCAAGATTATTC
GAACTTTTGGATATCGAGATTTACAGCTACCGAAAGGGGATTGGATACAA
GGTACCACGTGATTATGACATGGATGACGCCGAATCGAAGAAATTCCAAA
AAGAAGAACAATCAAAGATCGATAATGCTGAACCACTGAGCGAAGAAGAA
CAAACGGAAAAAGAACAATTGTTAGCTCAAGGTTTCACCAATTGGAATAA
ACGCGATTTCAATCAATTCATCAAGGCTTGCGAGAAATACGGTCGTGATG
ATTtgaattctatttgtaaagaagTGGAAGGGAAATCACAAGCGGAGGTC
CGAGAATATGCTGGTGTGTTTTGGGAACGTTGCAATGAGCTGACTGACAT
TGACAAAATCATGGCACAGATCGAACGTGGCGAAGCCAAAATTCAACGAA
GAATTTCTATTAAAAGAGCCATGGAGGCTAAGATGGCAAGGTACAAGTCA
CCGTTTCACCAGCTCCGCATACAATACGGAACTAACAAAGGAAAGAATTA
TACCGAAGAAGAGGACAGGTTTATCGTATGCATGTTACACAAATTGGGAT
TCGATCGGGAGAATGTATACGAAGAATTACGTCAATCTGTCCGAAGTGCT
CCTCAATTTCGATTTGATTGGTTTATCAAATCTCGAACTGCAGTGGAATT
GCAAAGACGCTGCAACACTTTGATCACTCTCATTGAAAGAGAAAACCAAG
AGCTTGAAGAGCGAGAGAAACGTGAAAAACGCAAAGGAGCCAAACCAAAT
GCTGCTAGAACCCCTGCTCAAGGAAAGAGGAAAAATGAAGTTGTGGCTGC
TAAACCCGCCAAGAAAGCCAAAAACTAACGACGCGGGAAATGTAATCTGA
CAtctgattttttaaatatatactTTGTACATGTTTGGCCtaattttaca
atatttttagaatattatactcaaaaaatggctgaTCAAGTTGACGAAAA
AACAATCCAAAATACTGATGAAGTATCTAAGGAAGAAACCAAAGAAGAGG
AGGTGACAACGAAAAAGGAAGATGAGAAGACAAATGAACAAGAATCGGAA
GGAGAATCTACTGATGATGAAGATGACAAACCAAAACCGCCACCAGTTAA
AATCAATAAAGCTATGGCTGTCAATGAAGAATACAATGAAAAGATGGAAC
ATGATAGAGCATCAAGATTCAGTTTTCTATTAAAACAAACTGAAATATTT
TCCCATTTCTTAAATGGAGCTGGTAAAAAGCCACCAAAAAgtcctttaaa
aatgaaaaagcagCCTGATCTTCCTTCCAGTCCACCACCAAAGAAGGGGG
CTAAAGACCATCGTCATCGACGTaccgagaaagaagaagatgaagagcTT
TTGGAAGATTCCAAGAGTTCTCAAGCACATGTTGTTCAATTCACCGCTTC
ACCTTCATATATTAAATTTGGAACAATGAGGGACTACCAGATTAGAGGAT
TGAATTGGATGATTTCGCTTTATGAAAATGGTATCAATGGAATTCTAGCT
GATGAAATGggTCTTGGTAAAACTTTGCAAACTATTTCATTGATTGGTTA
CATGAAACATCACAGAAACAACTCTGGTCCACACATTGTAATTGTTCCCA
AATCCACTCTTGCTAATTGGATGGCTGAGTTTGCAAGATGGTGTCCAACT
ATAAGGACAGTTTGTTTAATTGGTAACCAAGATCAGAGGTCAGCAATAAT
CAGAGATACATTGCTACCGGGAGAATGGGATGTTCTTGTTACATCATACG
AAATGTGTATTCGTGAAAAAACTGTACTCAAGAAATTCGCTTGGAGATTC
TTGTGTATTGATGAAGCTCAcagaatcaaaaatgaaaaatcactgCTTTC
AAGCATTGTTCGTGAATTCAAATCATCAAACAGACTTCTGCTCACTGGTA
CCCCACTACAAAATAACCTCCATGAATTATGGGCTTTGTTAAATTTCTTA
CTCCCTGATGTGTTCAATTCGTCTGATGACTTCGATGCTTGGTTTAATGC
TGAGAATTTGTCCGAAGAAGATGCCATTGTCAAACGGTTGCACGCTGTTT
TACGTCCTTTCTTACTACGTCGTTTGAAAAGTGAAGTCGAGAAATCTCTC
CTTCCAAAGAAGATCACCAACGTTTACATAGGATTGAGTGCAATGCAAAG
ACAATGGTACACCAAGTTACTGATGAAGGATATTGATATTGTCAACGGTG
CTGGTAAAACTGACCGGATGAGATTGTTGAATATCCTTATGCAGCTTCGA
AAATGTTGTAATCACCCTTATCTTTTCGATGGAGCTGAACCTGGACCACC
ATATACAACAGACGTTCATTTGGTTGATAATTGCGGTAAAATGAGTGTCT
TGGATAAACTGTTGGTGAGAATGAAGGAGCGAGGATCACGTGTTTTGGTG
TTTAGTCAGATGACTCGTATGCTTGATATCCTGGAAGATTACTCTATGTG
GAGAGGTTTCCAATACTGTCGATTGGACGGTCAAACACCACATGAAGAAC
GTACCGCTCAAATTAACGATTTCAACTCACCTGGAAGTgacaaatttgtg
ttttttctgAGTACACGTGCTGGAGGTCTGGGTATCAATCTTGCAACAGC
TGATGTGGTCGTCATGTTTGATAATGATTGGAATCCACAAGTCGATCTCC
AAGCACAGGATCGAGCACATCGTATCGGTCAAACCAAACAAGTACAAGTA
TTCCGTTTCATCACCGAAAACACCATCGAAGAAAGAATTATTGAACGTGC
TGAAATGAAATTACGTCTTGATCGTGTTGTCATTCAACAAGGTCGATTGG
TGGAAGGACAAACGAAACTACAGAAGGATGAAGTACTGAACATGATTCGA
CATGGTGCTGATAAAGTCTTCGCTTCCAAAGATTCAACTGTCACTGGTGA
AGATATTGATCTTATCTTGGAAAGAGGTGCTAAGAAGACTGAGGAGATtg
ccaaaaaaatgtcagattTGGGCGAAGGCCAACTCAAGAATTTCACCATG
GATGCACCTGACAGTATTTACAAATTCGAAGGTCAAGATTTCCGTGAGAC
GCACGATAAACCCGGCGTATCTCACTGGATCGAACCACCAAAGCGTGAAC
GTAAAGCCAACTACGCTGTTGACACCTACTTCAAAGAACTAATGAGAGTA
AACGAGCCCAAAGCACCCAAAGCTCCTCGACCACCCAAACAACCTAACGT
CCAAGATTTCCAATTCTTTCCACCAAGATTATTCGAACTTTTGGATATCG
AGATTTACAGCTACCGAAAGGGGATTGGATACAAGGTACCACGTGATTAT
GACATGGATGACGCCGAATCGAAGAAATTCCAAAAAGAAGAACAATCAAA
GATCGATAATGCTGAACCACTGAGCGAAGAAGAACAAACGGAAAAAGAAC
AATTGTTAGCTCAAGGTTTCACCAATTGGAATAAACGCGATTTCAATCAA
TTCATCAAGGCTTGCGAGAAATACGGTCGTGATGATTtgaattctatttg
taaagaagTGGAAGGGAAATCACAAGCGGAGGTCCGAGAATATGCTGGTG
TGTTTTGGGAACGTTGCAATGAGCTGACTGACATTGACAAAATCATGGCA
CAGATCGAACGTGGCGAAGCCAAAATTCAACGAAGAATTTCTATTAAAAG
AGCCATGGAGGCTAAGATGGCAAGGTACAAGTCACCGTTTCACCAGCTCC
GCATACAATACGGAACTAACAAAGGAAAGAATTATACCGAAGAAGAGGAC
AGGTTTATCGTATGCATGTTACACAAATTGGGATTCGATCGGGAGAATGT
ATACGAAGAATTACGTCAATCTGTCCGAAGTGCTCCTCAATTTCGATTTG
ATTGGTTTATCAAATCTCGAACTGCAGTGGAATTGCAAAGACGCTGCAAC
ACTTTGATCACTCTCATTGAAAGAGAAAACCAAGAGCTTGAAGAGCGAGA
GAAACGTGAAAAACGCAAAGGAGCCAAACCAAATGCTGCTAGAACCCCTG
CTCAAGGAAAGAGGAAAAATGAAGTTGTGGCTGCTAAACCCGCCAAGAAA
GCCAAAAACTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000440XLOC_000440Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000697-proteinTCONS_00000697-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000697-exon-sc0000005-1491911889:447901..448134TCONS_00000697-exon-sc0000005-1491911889:447901..448134Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:447901..448134TCONS_00000697-exon-sc0000005-1510915933:447901..448134Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:447901..448134TCONS_00000697-exon-sc0000005-1575043694:447901..448134Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:454572..454816TCONS_00000697-exon-sc0000005-1491911889:454572..454816Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:454572..454816TCONS_00000697-exon-sc0000005-1510915933:454572..454816Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:454572..454816TCONS_00000697-exon-sc0000005-1575043694:454572..454816Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:454958..455058TCONS_00000697-exon-sc0000005-1491911889:454958..455058Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:454958..455058TCONS_00000697-exon-sc0000005-1510915933:454958..455058Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:454958..455058TCONS_00000697-exon-sc0000005-1575043694:454958..455058Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:455425..455525TCONS_00000697-exon-sc0000005-1491911889:455425..455525Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:455425..455525TCONS_00000697-exon-sc0000005-1510915933:455425..455525Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:455425..455525TCONS_00000697-exon-sc0000005-1575043694:455425..455525Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:455628..455807TCONS_00000697-exon-sc0000005-1491911889:455628..455807Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:455628..455807TCONS_00000697-exon-sc0000005-1510915933:455628..455807Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:455628..455807TCONS_00000697-exon-sc0000005-1575043694:455628..455807Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:456028..456183TCONS_00000697-exon-sc0000005-1491911889:456028..456183Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:456028..456183TCONS_00000697-exon-sc0000005-1510915933:456028..456183Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:456028..456183TCONS_00000697-exon-sc0000005-1575043694:456028..456183Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:456369..456569TCONS_00000697-exon-sc0000005-1491911889:456369..456569Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:456369..456569TCONS_00000697-exon-sc0000005-1510915933:456369..456569Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:456369..456569TCONS_00000697-exon-sc0000005-1575043694:456369..456569Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:456841..457087TCONS_00000697-exon-sc0000005-1491911889:456841..457087Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:456841..457087TCONS_00000697-exon-sc0000005-1510915933:456841..457087Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:456841..457087TCONS_00000697-exon-sc0000005-1575043694:456841..457087Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:457440..457601TCONS_00000697-exon-sc0000005-1491911889:457440..457601Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:457440..457601TCONS_00000697-exon-sc0000005-1510915933:457440..457601Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:457440..457601TCONS_00000697-exon-sc0000005-1575043694:457440..457601Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:457884..458086TCONS_00000697-exon-sc0000005-1491911889:457884..458086Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:457884..458086TCONS_00000697-exon-sc0000005-1510915933:457884..458086Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:457884..458086TCONS_00000697-exon-sc0000005-1575043694:457884..458086Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:459056..459334TCONS_00000697-exon-sc0000005-1491911889:459056..459334Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:459056..459334TCONS_00000697-exon-sc0000005-1510915933:459056..459334Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:459056..459334TCONS_00000697-exon-sc0000005-1575043694:459056..459334Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:459635..459982TCONS_00000697-exon-sc0000005-1491911889:459635..459982Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:459635..459982TCONS_00000697-exon-sc0000005-1510915933:459635..459982Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:459635..459982TCONS_00000697-exon-sc0000005-1575043694:459635..459982Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:460138..460383TCONS_00000697-exon-sc0000005-1491911889:460138..460383Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:460138..460383TCONS_00000697-exon-sc0000005-1510915933:460138..460383Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:460138..460383TCONS_00000697-exon-sc0000005-1575043694:460138..460383Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:460853..460987TCONS_00000697-exon-sc0000005-1491911889:460853..460987Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:460853..460987TCONS_00000697-exon-sc0000005-1510915933:460853..460987Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:460853..460987TCONS_00000697-exon-sc0000005-1575043694:460853..460987Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:461379..461471TCONS_00000697-exon-sc0000005-1491911889:461379..461471Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:461379..461471TCONS_00000697-exon-sc0000005-1510915933:461379..461471Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:461379..461471TCONS_00000697-exon-sc0000005-1575043694:461379..461471Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:461602..461721TCONS_00000697-exon-sc0000005-1491911889:461602..461721Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:461602..461721TCONS_00000697-exon-sc0000005-1510915933:461602..461721Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:461602..461721TCONS_00000697-exon-sc0000005-1575043694:461602..461721Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:461985..462098TCONS_00000697-exon-sc0000005-1491911889:461985..462098Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:461985..462098TCONS_00000697-exon-sc0000005-1510915933:461985..462098Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:461985..462098TCONS_00000697-exon-sc0000005-1575043694:461985..462098Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1491911889:462359..462969TCONS_00000697-exon-sc0000005-1491911889:462359..462969Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1510915933:462359..462969TCONS_00000697-exon-sc0000005-1510915933:462359..462969Clytia hemisphaericaexon
TCONS_00000697-exon-sc0000005-1575043694:462359..462969TCONS_00000697-exon-sc0000005-1575043694:462359..462969Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000005supercontigsc0000005:447901..462969 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
171.448 160.278 237.301 224.915 129.734 103.069 92.8214 102.659 92.4261 97.2955 126.402 87.2932 97.1336 100.425 88.669 93.4823 100.152 106.077 50.6265 47.7125 68.1368 70.4184 83.9484 88.0961 181.642 193.538 62.1234 63.0616 54.0084 55.8986
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR001005SANT/Myb
IPR000330SNF2_N
IPR015194ISWI_HAND-dom
IPR015195SLIDE
IPR017884SANT_dom
IPR009057Homeobox-like
IPR027417P-loop_NTPase
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0031491nucleosome binding
GO:0003676nucleic acid binding
GO:0016818hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0043044ATP-dependent chromatin remodeling
GO:0006338chromatin remodeling
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0043044 ATP-dependent chromatin remodeling
biological_process GO:0006338 chromatin remodeling
cellular_component GO:0005634 nucleus
molecular_function GO:0005524 ATP binding
molecular_function GO:0003677 DNA binding
molecular_function GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0031491 nucleosome binding
Blast
BLAST of TCONS_00000697 vs. Swiss-Prot (Human)
Match: SMCA5 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1)

HSP 1 Score: 1310.05 bits (3389), Expect = 0.000e+0
Identity = 679/937 (72.47%), Postives = 797/937 (85.06%), Query Frame = 1
Query:  304 YNEKMEHDRASRFSFLLKQTEIFSHFLNGAGXXXXXXXXXXXXXXDLPSSPPPKKGAK-------DHRHRRTXXXXXXXXXXXXXXSQAHVVQFTASPSYIKFGTMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLIGYMKHHRNNSGPHIVIVPKSTLANWMAEFARWCPTIRTVCLIGNQDQRSAIIRDTLLPGEWDVLVTSYEMCIREKTVLKKFAWRFLCIDEAHRIKNEKSLLSSIVREFKSSNRLLLTGTPLQNNLHELWALLNFLLPDVFNSSDDFDAWFNAENLSEEDAIVKRLHAVLRPFLLRRLKSEVEKSLLPKKITNVYIGLSAMQRQWYTKLLMKDIDIVNGAGKTDRMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDVHLVDNCGKMSVLDKLLVRMKERGSRVLVFSQMTRMLDILEDYSMWRGFQYCRLDGQTPHEERTAQINDFNSPGSDKFVFFLSTRAGGLGINLATADVVVMFDNDWNPQVDLQAQDRAHRIGQTKQVQVFRFXXXXXXXXXXXXXAEMKLRLDRVVIQQGRLVEGQ-TKLQKDEVLNMIRHGADKVFASKDSTVTGEDIDLILERGAKKTEEIAKKMSDLGEGQLKNFTMDAPDSIYKFEGQDFRETHDKPGVSHWIEPPKRERKANYAVDTYFKELMRVNEXXXXXXXXXXXXXNVQDFQFFPPRLFELLDIEIYSYRKGIGYKVPRDYDMDDAXXXXXXXXXXXXIDNAEPLSEEEQTEKEQLLAQGFTNWNKRDFNQFIKACEKYGRDDLNSICKEVEGKSQAEVREYAGVFWERCNELTDIDKIMAQIERGEAKIQRRISIKRAMEAKMARYKSPFHQLRIQYGTNKGKNYTEEEDRFIVCMLHKLGFDRENVYEELRQSVRSAPQFRFDWFIKSRTAVELQRRCNTLITLI 3090
            Y EKM+ DRA+RF +LLKQTE+F+HF+  A +K P SPLKMK     P  P  KK  K       D+RHRRTE+EEDEELL +S  +     +F  SPSY+K+G +RDYQ+RGLNW+ISLYENGINGILADEMGLGKTLQTISL+GYMKH+RN  GPH+V+VPKSTL NWM+EF RW PT+R+VCLIG+++QR+A +RD LLPGEWDV VTSYEM I+EK+V KKF WR+L IDEAHRIKNEKS LS IVREFK++NRLLLTGTPLQNNLHELW+LLNFLLPDVFNS+DDFD+WF+  N   +  +V+RLH VLRPFLLRR+K++VEKSL PKK   +Y+GLS MQR+WYT++LMKDIDI+N AGK D+MRLLNILMQLRKCCNHPYLFDGAEPGPPYTTD+HLV N GKM VLDKLL ++KE+GSRVL+FSQMTR+LDILEDY MWR ++YCRLDGQTPH+ER   IN +N P S KFVF LSTRAGGLGINLATADVV+++D+DWNPQVDLQA DRAHRIGQTK V+VFRFIT+NT+EERI+ERAEMKLRLD +VIQQGRLV+    K+ KDE+L MIRHGA  VFASK+S +T EDID ILERGAKKT E+ +K+S +GE  L+NFTMD   S+Y FEG+D+RE   K   + WIEPPKRERKANYAVD YF+E +RV+EPKAPKAPRPPKQPNVQDFQFFPPRLFELL+ EI  YRK IGYKVPR+ ++ +A   + QKEEQ KID AE L++EE  EKE+LL QGFTNWNKRDFNQFIKA EK+GRDD+ +I +EVEGK+  EV EY+ VFWERCNEL DI+KIMAQIERGEA+IQRRISIK+A++ K+ RYK+PFHQLRI YGTNKGKNYTEEEDRF++CMLHKLGFD+ENVY+ELRQ +R++PQFRFDWF+KSRTA+ELQRRCNTLITLI
Sbjct:   80 YEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMK-----PGRPRIKKDEKQNLLSVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLRNFTMDTESSVYNFEGEDYREKQ-KIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILFYRKTIGYKVPRNPELPNA--AQAQKEEQLKIDEAESLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLI 1008          
The following BLAST results are available for this feature:
BLAST of TCONS_00000697 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SMCA50.000e+072.47SWI/SNF-related matrix-associated actin-dependent ... [more]
back to top