Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000658 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000658
Unique NameTCONS_00000658
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1051

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000658 ID=TCONS_00000658|Name=TCONS_00000658|organism=Clytia hemisphaerica|type=transcript|length=1051bp
tctacaaaaattgtttgtttttcttacCAGTTTTGGTTACATAGTTATAG
ATTTAGATTTTAGCACACAAATACATAGTGTTCGCTGTCCACAAGTTCTT
TGATCTTTGGTTTTATAACAGATTAAAAATgtattattaaattttttatt
attaatcATCAGTATTATTAAATTAGACCAACTGTTAGTAAATGGAAAGC
TCACACAATTCAACAGCAACTGATGCATcgggaaatgaaaatgaaattcc
tcCTTGCTTGGAAAGCTCAAAAGAACTATCAAAAGGTGTATTAGAACTTT
ATCAGAATGATTTGAAACCAGTGCAAGACAATGTTACAGAGCTGCTCAGA
AATCAAGGGGTATTACGAGACATTACACAAAACGAAATAACACAAgtcaa
agaaaatattatgtTGGCCGAGATCACTGACacttttgaaacaatgaaat
tatatcaaaagaaaCTGGTTGCAATGAAAAAAGAGATGAACAATTTAACT
TCAAGGATAGATAAGTTTAAAATCAGAGCACAGAAACTTCAATTACAAAA
AGAGAGAGAGGAATTGGAATCTGCAAAGGAGAAAGAACGACAACGTAAAT
ATGAACGAGATTTGACAGCTAAACCGGCACAATCCACTGGTGCTACTTCC
AAGTAATTTTAAGTACATGATTTAACATGGGTGGTGTATCTTGTTGAAAC
TTTGGTTGAGAAATTGGTAGATACTTGatatattgataatttttcctttt
ttatattttcacaaAAGTATTAAAAGTCTTGGACCTGATTTCTAGTAGGA
CGATCTTTTATATCACTTTTactaaatgtatttttttaatttattatata
TAAATTAGTACTATATTTTGGTGGatttatttgaatttaaaatactAAAT
TTAGTTTACAAACAAATTAAAGAAGAATAATCTCTATTTAAAAGTTATGC
ATAATTATTTCGATAATTGATATAAATTTTACAATAGAAATAACCTGAAA
AGTAGCAGCATCCTTCTTGAAAATACTTGATGTTGGTTTCTTTTATCGCC
A
Run BLAST on NCBI

protein sequence of TCONS_00000658-protein

>TCONS_00000658-protein ID=TCONS_00000658-protein|Name=TCONS_00000658-protein|organism=Clytia hemisphaerica|type=polypeptide|length=154bp
MESSHNSTATDASGNENEIPPCLESSKELSKGVLELYQNDLKPVQDNVTE
LLRNQGVLRDITQNEITQVKENIMLAEITDTFETMKLYQKKLVAMKKEMN
NLTSRIDKFKIRAQKLQLQKEREELESAKEKERQRKYERDLTAKPAQSTG
ATSK
Run BLAST on NCBI

transcript from alignment at sc0000002:1203472..1204522

Legend: exonthree_prime_UTRCDSfive_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000658 ID=TCONS_00000658|Name=TCONS_00000658|organism=Clytia hemisphaerica|type=transcript|length=1051bp|location=Sequence derived from alignment at sc0000002:1203472..1204522 (Clytia hemisphaerica)
TGGCGATAAAAGAAACCAACATCAAGTATTTTCAAGAAGGATGCTGCTAC TTTTCAGGTTATTTCTATTGTAAAATTTATATCAATTATCGAAATAATTA TGCATAACTTTTAAATAGAGATTATTCTTCTTTAATTTGTTTGTAAACTA AATTTagtattttaaattcaaataaatCCACCAAAATATAGTACTAATTT AtatataataaattaaaaaaatacatttagtAAAAGTGATATAAAAGATC GTCCTACTAGAAATCAGGTCCAAGACTTTTAATACTTttgtgaaaatata aaaaaggaaaaattatcaatatatCAAGTATCTACCAATTTCTCAACCAA AGTTTCAACAAGATACACCACCCATGTTAAATCATGTACTTAAAATTACT TGGAAGTAGCACCAGTGGATTGTGCCGGTTTAGCTGTCAAATCTCGTTCA TATTTACGTTGTCGTTCTTTCTCCTTTGCAGATTCCAATTCCTCTCTCTC TTTTTGTAATTGAAGTTTCTGTGCTCTGATTTTAAACTTATCTATCCTTG AAGTTAAATTGTTCATCTCTTTTTTCATTGCAACCAGtttcttttgatat aatttcattgtttcaaaagtGTCAGTGATCTCGGCCAacataatattttc tttgacTTGTGTTATTTCGTTTTGTGTAATGTCTCGTAATACCCCTTGAT TTCTGAGCAGCTCTGTAACATTGTCTTGCACTGGTTTCAAATCATTCTGA TAAAGTTCTAATACACCTTTTGATAGTTCTTTTGAGCTTTCCAAGCAAGg aggaatttcattttcatttcccgATGCATCAGTTGCTGTTGAATTGTGTG AGCTTTCCATTTACTAACAGTTGGTCTAATTTAATAATACTGATgattaa taataaaaaatttaataatacATTTTTAATCTGTTATAAAACCAAAGATC AAAGAACTTGTGGACAGCGAACACTATGTATTTGTGTGCTAAAATCTAAA TCTATAACTATGTAACCAAAACTGgtaagaaaaacaaacaatttttgtag a

Coding sequence (CDS) from alignment at sc0000002:1203472..1204522

>TCONS_00000658 ID=TCONS_00000658|Name=TCONS_00000658|organism=Clytia hemisphaerica|type=CDS|length=465bp|location=Sequence derived from alignment at sc0000002:1203472..1204522 (Clytia hemisphaerica)
TTACTTGGAAGTAGCACCAGTGGATTGTGCCGGTTTAGCTGTCAAATCTC
GTTCATATTTACGTTGTCGTTCTTTCTCCTTTGCAGATTCCAATTCCTCT
CTCTCTTTTTGTAATTGAAGTTTCTGTGCTCTGATTTTAAACTTATCTAT
CCTTGAAGTTAAATTGTTCATCTCTTTTTTCATTGCAACCAGtttctttt
gatataatttcattgtttcaaaagtGTCAGTGATCTCGGCCAacataata
ttttctttgacTTGTGTTATTTCGTTTTGTGTAATGTCTCGTAATACCCC
TTGATTTCTGAGCAGCTCTGTAACATTGTCTTGCACTGGTTTCAAATCAT
TCTGATAAAGTTCTAATACACCTTTTGATAGTTCTTTTGAGCTTTCCAAG
CAAGgaggaatttcattttcatttcccgATGCATCAGTTGCTGTTGAATT
GTGTGAGCTTTCCAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000404XLOC_000404Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000658-proteinTCONS_00000658-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000658-exon-sc0000002-1491911889:1203472..1204522TCONS_00000658-exon-sc0000002-1491911889:1203472..1204522Clytia hemisphaericaexon
TCONS_00000658-exon-sc0000002-1510915933:1203472..1204522TCONS_00000658-exon-sc0000002-1510915933:1203472..1204522Clytia hemisphaericaexon
TCONS_00000658-exon-sc0000002-1575043694:1203472..1204522TCONS_00000658-exon-sc0000002-1575043694:1203472..1204522Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1203472..1204522 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
57.1352 52.1822 12.8333 9.19485 25.2288 18.3197 22.4811 23.7851 19.9546 19.8792 14.0445 9.4568 7.00568 6.95535 11.0776 12.6326 17.2071 13.8759 7.34565 10.8739 11.7735 10.2534 51.4032 47.831 15.5621 18.8144 16.0038 12.2703 25.7217 26.4445
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR028119Snapin/Pallidin/Snn1
IPR017242BLOC-1_pallidin
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000658 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top