Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000625 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000625
Unique NameTCONS_00000625
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2026

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000625 ID=TCONS_00000625|Name=TCONS_00000625|organism=Clytia hemisphaerica|type=transcript|length=2026bp
ATTcgacaaaaagttgatttttttcttcttcatttttcattttcattttc
caaatttttttgatttttttctgttttataaCATTCCCACTCCTTATTGT
CTTTTCAaaaagcacaaaaccgctagtTAATTcgaattttaccaaaattt
acAGCCTGTTGATAAGCGTACCGTTTCGGAAAAGATTATCTTAGTTGACA
AGGATGAAATTGTAAATAGTGATTCTACTACAGCTGAACTTTTTGATACT
TATTTCAATGGTATAACTAAGACACTGGACATATATCAGTGGTCGCAATA
TGCCGAGCCGATCTACGACGATCCGGTGCTCAATACTCAGATCATCCTAg
cattataaaaatcaaaagtatTTTAGCTGGTAACTCTCCTTCGAGTTTAC
AAAAACTGACACTGAAACTGTCCACAAATTAGTTATGTCATTGAATAGTA
AAAAATCTACATCTGGGGAAATAAGCACCAAAATCCTACAGAAGTCTGCT
AATATCTGTTCTTTTGCACTCAAAGATTGCTTCACCTCTTGTCTCGACAA
GACTATTTTCCTGGAATCCTTAAAACGAGCTACAATTACCCCGGTTCTTA
AAGAAGGCAATCCGACGAGTGTTAAAAACTACAGACCTATTAGCATACTT
CCTACAGTATCCAaagtatttgaaaaaatcattgccCAACAATTAAatcc
ttttttagaaaactgtTTTTTCAGATTTACTGTGTGGCTTTCGAAAAGAA
CATACAGTACACAACATGCTCTATTGCGATTATTACATCTCTGGCAAAGG
GCACTTGATGATTCAAATATTGTGGGTACAATACTTATGGATTTATCAAA
AGCTTACGATtgtttaccccctgatttactTATTGCAAAATTAGCAGCAT
ATGGTGTTAACCACAATAGTCTACTCTTTATATATGATTATTTGATAAAC
CGTTACCATAGagtcaaaattggaaatagtCTGAGTAGCTTCTTATCTAT
TAGTATGGGCGTCCCTCAGGGATCCATTTTAGGCCCAATtctttttaaca
tatttttgaaTAATCTCTTACTATCTGACCTTGAAGCAGAACTCTGTAAC
TTTGCTGATGACAACACCCTTTTCGCAATCGCTAAAGCCCTTGCTGAAAT
TATCGAAATTCAAGATATTTTGTACTGGGGTAAAATCAATGGGCTTGTTG
CCAATCCAGGAAAGTTCGAAGTTATGTTTCTTGGTAGATTTGAGCCTATA
TCTACTTTTAATATAGGAAATATCaaagttaaagttaaaaatCAGGTCAA
ACTTTTAGGTATCTAATATTGTTAAATCTTTATATTGATAATAACTTTAA
CTCCCACGTTGAATTAAAATGCCAGTCGGTGGGAAATAAAATCAGCGTTC
TTCGGCGCATCCGTCCCTTCGTTTCTCTTAAAACAGCGAAGGCCTTGTTC
CACGCctatattttttctaattttaattaTTGTCCATTAATTTGGATGAA
TTTTGTAAAACACAACaacaaacaaattgaaaaaattcaacgAAGAGCTC
TTAGCGTAGTTTATGAAAACTATGACTCTAATTTATATCAATTATTAATT
TATCTAGAACTGCATCTTTTCACATCAAATTTATTCATAAAATTCTTGAG
GAAATTtataaaactcttaaaaaactAAACCCGCCTTTCTTAGCTGAGCT
CTTTGTCACAAAAACCTCGGGCTATAAACTTAGACGAGGAGAGCAACTGT
TACCTCCGGCTAACACAGTTAGTTAAGTTTGGTTTACAATCTTGAAGTTT
TGTTGGGTTCGGGTTTTGGAATCGTCTCTCTAAGGATGTGAAAAGCTCTG
CAACGTTTAATACATTTAGGGGCAAATTAAAAATGTTGCCAAACGATTTT
TGAACCTGCCCAATATGTAAATTGTGGtagatatttttaactttttttat
aaaagttggATTTTGTTAGTAACGGTTTAAGGCTGTAACTATTTAGGACG
TTAGGTCCTTTACTTTATGtaccaac
Run BLAST on NCBI

protein sequence of TCONS_00000625-protein

>TCONS_00000625-protein ID=TCONS_00000625-protein|Name=TCONS_00000625-protein|organism=Clytia hemisphaerica|type=polypeptide|length=293bp
MSLNSKKSTSGEISTKILQKSANICSFALKDCFTSCLDKTIFLESLKRAT
ITPVLKEGNPTSVKNYRPISILPTVSKVFEKIIAQQLNPFLENCFFRFTV
WLSKRTYSTQHALLRLLHLWQRALDDSNIVGTILMDLSKAYDCLPPDLLI
AKLAAYGVNHNSLLFIYDYLINRYHRVKIGNSLSSFLSISMGVPQGSILG
PILFNIFLNNLLLSDLEAELCNFADDNTLFAIAKALAEIIEIQDILYWGK
INGLVANPGKFEVMFLGRFEPISTFNIGNIKVKVKNQVKLLGI
Run BLAST on NCBI

transcript from alignment at sc0000002:371501..373526

Legend: exonthree_prime_UTRCDSfive_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000625 ID=TCONS_00000625|Name=TCONS_00000625|organism=Clytia hemisphaerica|type=transcript|length=2026bp|location=Sequence derived from alignment at sc0000002:371501..373526 (Clytia hemisphaerica)
gttggtaCATAAAGTAAAGGACCTAACGTCCTAAATAGTTACAGCCTTAA ACCGTTACTAACAAAATccaacttttataaaaaaagttaaaaatatctaC CACAATTTACATATTGGGCAGGTTCAAAAATCGTTTGGCAACATTTTTAA TTTGCCCCTAAATGTATTAAACGTTGCAGAGCTTTTCACATCCTTAGAGA GACGATTCCAAAACCCGAACCCAACAAAACTTCAAGATTGTAAACCAAAC TTAACTAACTGTGTTAGCCGGAGGTAACAGTTGCTCTCCTCGTCTAAGTT TATAGCCCGAGGTTTTTGTGACAAAGAGCTCAGCTAAGAAAGGCGGGTTT agttttttaagagttttataAATTTCCTCAAGAATTTTATGAATAAATTT GATGTGAAAAGATGCAGTTCTAGATAAATTAATAATTGATATAAATTAGA GTCATAGTTTTCATAAACTACGCTAAGAGCTCTTcgttgaattttttcaa tttgtttgttGTTGTGTTTTACAAAATTCATCCAAATTAATGGACAAtaa ttaaaattagaaaaaatatagGCGTGGAACAAGGCCTTCGCTGTTTTAAG AGAAACGAAGGGACGGATGCGCCGAAGAACGCTGATTTTATTTCCCACCG ACTGGCATTTTAATTCAACGTGGGAGTTAAAGTTATTATCAATATAAAGA TTTAACAATATTAGATACCTAAAAGTTTGACCTGatttttaactttaact ttGATATTTCCTATATTAAAAGTAGATATAGGCTCAAATCTACCAAGAAA CATAACTTCGAACTTTCCTGGATTGGCAACAAGCCCATTGATTTTACCCC AGTACAAAATATCTTGAATTTCGATAATTTCAGCAAGGGCTTTAGCGATT GCGAAAAGGGTGTTGTCATCAGCAAAGTTACAGAGTTCTGCTTCAAGGTC AGATAGTAAGAGATTAttcaaaaatatgttaaaaagaATTGGGCCTAAAA TGGATCCCTGAGGGACGCCCATACTAATAGATAAGAAGCTACTCAGacta tttccaattttgactCTATGGTAACGGTTTATCAAATAATCATATATAAA GAGTAGACTATTGTGGTTAACACCATATGCTGCTAATTTTGCAATAagta aatcagggggtaaacaATCGTAAGCTTTTGATAAATCCATAAGTATTGTA CCCACAATATTTGAATCATCAAGTGCCCTTTGCCAGAGATGTAATAATCG CAATAGAGCATGTTGTGTACTGTATGTTCTTTTCGAAAGCCACACAGTAA ATCTGAAAAAacagttttctaaaaaaggatTTAATTGTTGggcaatgatt ttttcaaatacttTGGATACTGTAGGAAGTATGCTAATAGGTCTGTAGTT TTTAACACTCGTCGGATTGCCTTCTTTAAGAACCGGGGTAATTGTAGCTC GTTTTAAGGATTCCAGGAAAATAGTCTTGTCGAGACAAGAGGTGAAGCAA TCTTTGAGTGCAAAAGAACAGATATTAGCAGACTTCTGTAGGATTTTGGT GCTTATTTCCCCAGATGTAGATTTTTTACTATTCAATGACATAACTAATT TGTGGACAGTTTCAGTGTCAGTTTTTGTAAACTCGAAGGAGAGTTACCAG CTAAAatacttttgatttttataatgcTAGGATGATCTGAGTATTGAGCA CCGGATCGTCGTAGATCGGCTCGGCATATTGCGACCACTGATATATGTCC AGTGTCTTAGTTATACCATTGAAATAAGTATCAAAAAGTTCAGCTGTAGT AGAATCACTATTTACAATTTCATCCTTGTCAACTAAGATAATCTTTTCCG AAACGGTACGCTTATCAACAGGCTgtaaattttggtaaaattcgAATTAa ctagcggttttgtgcttttTGAAAAGACAATAAGGAGTGGGAATGttata aaacagaaaaaaatcaaaaaaatttggaaaatgaaaatgaaaaatgaaga agaaaaaaatcaactttttgtcgAAT

Coding sequence (CDS) from alignment at sc0000002:371501..373526

>TCONS_00000625 ID=TCONS_00000625|Name=TCONS_00000625|organism=Clytia hemisphaerica|type=CDS|length=882bp|location=Sequence derived from alignment at sc0000002:371501..373526 (Clytia hemisphaerica)
TTAGATACCTAAAAGTTTGACCTGatttttaactttaactttGATATTTC
CTATATTAAAAGTAGATATAGGCTCAAATCTACCAAGAAACATAACTTCG
AACTTTCCTGGATTGGCAACAAGCCCATTGATTTTACCCCAGTACAAAAT
ATCTTGAATTTCGATAATTTCAGCAAGGGCTTTAGCGATTGCGAAAAGGG
TGTTGTCATCAGCAAAGTTACAGAGTTCTGCTTCAAGGTCAGATAGTAAG
AGATTAttcaaaaatatgttaaaaagaATTGGGCCTAAAATGGATCCCTG
AGGGACGCCCATACTAATAGATAAGAAGCTACTCAGactatttccaattt
tgactCTATGGTAACGGTTTATCAAATAATCATATATAAAGAGTAGACTA
TTGTGGTTAACACCATATGCTGCTAATTTTGCAATAagtaaatcaggggg
taaacaATCGTAAGCTTTTGATAAATCCATAAGTATTGTACCCACAATAT
TTGAATCATCAAGTGCCCTTTGCCAGAGATGTAATAATCGCAATAGAGCA
TGTTGTGTACTGTATGTTCTTTTCGAAAGCCACACAGTAAATCTGAAAAA
acagttttctaaaaaaggatTTAATTGTTGggcaatgattttttcaaata
cttTGGATACTGTAGGAAGTATGCTAATAGGTCTGTAGTTTTTAACACTC
GTCGGATTGCCTTCTTTAAGAACCGGGGTAATTGTAGCTCGTTTTAAGGA
TTCCAGGAAAATAGTCTTGTCGAGACAAGAGGTGAAGCAATCTTTGAGTG
CAAAAGAACAGATATTAGCAGACTTCTGTAGGATTTTGGTGCTTATTTCC
CCAGATGTAGATTTTTTACTATTCAATGACAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000371XLOC_000371Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000625-proteinTCONS_00000625-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000625-exon-sc0000002-1491911889:371501..373526TCONS_00000625-exon-sc0000002-1491911889:371501..373526Clytia hemisphaericaexon
TCONS_00000625-exon-sc0000002-1510915933:371501..373526TCONS_00000625-exon-sc0000002-1510915933:371501..373526Clytia hemisphaericaexon
TCONS_00000625-exon-sc0000002-1575043694:371501..373526TCONS_00000625-exon-sc0000002-1575043694:371501..373526Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:371501..373526 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.254729 0.195582 0.446277 0.416166 0.133992 0.0644282 0.101405 0.190228 0.0991706 0.123197 0.41542 0.248039 2.33999 1.83532 1.369 1.24881 0.442457 0.501042 2.12478 1.93642 0.305052 0.112385 0.250085 0.274377 0.293491 0.286585 0.276152 0 0.0660206 0.0441601
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000477RT_dom
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000625 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top