Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000611 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000611
Unique NameTCONS_00000611
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1612

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000611 ID=TCONS_00000611|Name=TCONS_00000611|organism=Clytia hemisphaerica|type=transcript|length=1612bp
GaaaacatggatttttaacgttgtAGAGAAAAACTTATCACGGATTTACT
TAtagaaaaaGAAGGTGGCGACCCGTCTTTCTTTTAAGAAGGACGATGAA
ACGGTTTTTGGTTTCGGTGTTGTGTTTGGTACTTCTTATTCAAAATGTTG
AATCACAACGCAAAAACAAAAGCATCAAAAAGGTAATGTTGCTGAGGGTT
ACTCCAACGAACGAACAGCAATTGGACTTTCTGACATCATTGAAGACATA
TAAAGGTGACTTGAAGATTCAACTTTGGAGACATCCAGACGAAGTTGATC
GCCACGTCGATGTCTGGATATCACCAAAATCAAttgacaaatttaaaaaa
ctttctgGAGCTTTGAACATGACATATgaagttttgacaaaaaatatttt
cgatgaATGGGACAAAGAATATTCTATGAATAATATCGAAGATTTTGATA
TGGTCTATCAAAAATATGACGAGATAGTTGGAGAATTGAAACGACTTGCA
TCTGTTTATTCAGACATTATGGAGTTACAAAGTATCGGAAAATCTTACGA
GAAAAATGATATATACTCAGTTCATATTAGTTTAAATCGAAGTGACAGTC
GTGAAATCATTTATTTGAACTGTGGATCACACGCAAGAGAATTCTTATCC
GTCTCTTCATGCAAATATGTCATTCGAAAGATTCTGTTCGATTCTAAATA
TGAtgataaaatcaaagatttGTTGCATAATTTCGACATTGTGATGACAC
CGCTATTGAATCCAGATGGTTATATTTTTGCACACAATAAAAAACTCAAG
CTGAACAGACTATGGCGTAAATCACGTTCACCGACTTCTGATCGAACTTG
TTATGGAGTTGATTTGAACCGGAATTTCGATCATCGATGGGGAGGATACG
GTGGTTCTGGTGATCCATGTGATAACATATACAGCGGGCCACGTCCTTTT
TCCGAACAAGAAACGCTGTCTTTAGCACGCTACCTATACAAATTACGACG
TCGTCTGGTATCTTACATGGACGTCCACGTTTNGCACGCTACCTGTACAA
ATTACGACGTCGTCTGGTATCTTACATGGATGTCCACGTTTTTGGTCAAC
TCTGGATGAGTCCATGGGGATATTCAAGTACAACACCAAAGCATGCTGCT
ATACATGAGGCCATGCTGAAACAAATTAAAGCAAATTTATTCAAAGAGCA
GAACATCGTTTACGAAGTTGGACAGTCTGCAGTAGTATTATatCAAACAA
GCGGCGACTCTATCGATTGGGTATACGGCCGTCTTGGTGTCGTTCACTCT
TATGGCGTCGAATTACGCCCTAACCTGACTGTAAGGCGTGGTTTCCGATA
TCATTCCAACTTTACAAAACCTACTGGAGAAGATCTTCTCGTAGGTATTA
TGACGATCTCAAATGAATTGTCAAGAGAGAGAAATGAGAGAATGGGTGCT
ATGCTATGATGAATAGTTGGTatctttttctgaaagattttctaaaagat
tattttattttttgaatatttaacaaatgaaataaaaattttataccATA
ACTTGGACCTATCTTTATTCATGGCGTTTCGAAATTATTAGAGTATCGAT
ATTTCATTGGGG
Run BLAST on NCBI

transcript from alignment at sc0000002:1545150..1551975-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000611 ID=TCONS_00000611|Name=TCONS_00000611|organism=Clytia hemisphaerica|type=transcript|length=6826bp|location=Sequence derived from alignment at sc0000002:1545150..1551975- (Clytia hemisphaerica)
GAAAACATGGATTTTTAACGTTGTAGAGAAAAACTTATCACGGATTTACT TATAGAAAAAGTTAATTTTTTGACAAATTTTATTGGAATGGAAAGTTGAT TTTTGCTAAATTTATTATAGTGAAATTTTTTTTTCATAACAATTCAGCAA GCAAAAACCGCTATTTGATTATAATTTCTTCAATCAAAAATTACAGCATC TTTCTTGTTCACTGCAGATTATTTTGAGACAGACTTTATATCCCTTCTCT AGACCTTCTCTTAACTTTTATATAAGTAAATTTTTGCAAAACACGTGACC TTGTCAACAGATCTATAATTATTTATTTCAAGGAAGGTGGCGACCCGTCT TTCTTTTAAGAAGGACGATGAAACGGTTTTTGGTTTCGGTGTTGTGTTTG GTACTTCTTATTCAAAATGTTGAATCACAACGCAAAAACAAAAGCATCAA AAAGTAAGTTAATTTCTCTCATATTCTCAAAATAGGCTGTTAAAACATAC AGGGGGATGGACGAACCTCTTCAAGACAAAAAAATTATTGAAAATGTGTG GATACCCCCCCTGGAAAATGGCAAAACTTGCAAAAATACCCTAGGAAAGA TTCTTTTCATACCTTAAAGTGAAGGTAGACGAACTGAAATCAGTCTTTTA TCCCCTTGGAAAAATGAAAAAAAACCCTGGAAATTCTGCTCGGATCACCC ACTGGAAATCTTCGTCCACCCCCCCCCCCTGTATGGATAAAAAATGGAGT GGCCCAATACTACGGGTTATAAGACAGGGTGAAGAGTCTACGTAGTAAAA TTTTAAGTATGCTTTTCTCGAATTCGATCTTCAAGGAGTGTCTAAGACTT TTCCTCAGAAATTCGTTCTACCCAAATTTGATAAATTTGGAATCCAAATT TGGAATCATATTGCCTTAAAATAGTTTTCCGTCATTCAGCAAGTTAACAA AGTTTCTATGACTTCGATCTTACCACAACTAAGGGGTTGTTAGGACGAGA GAAAAAAACTTCGATGGGCTTTAAACGCACTGTAAGTGTAAGTGGTACCG GAAATGTTTGAATATCAAAAGTTATTGTTTAGTTTGTTTTGTTTATGGTT TGAATGACAGTTATGTAAACAAACAGTCAACACAAAAAATTCTTAACTTT GGTCGTCAACCCCATTCTAAAATAGAGTTCTGAAAATAACCTTTTTTATA AGCATCTCTGCCCGCATTCTTGACTGTATTTCTCTTCTAATAATAAATAC TTGCTTTGCCCTATCTACACTTTGTCAAACTCTCGATGTTTTATAAACAC ACCTCTGCCTCGCTAATACAAAGAGGACATTGCAACACACATAATGAAAA GTATATTGCAACAAAAGGGGCAACTAAGCTCTGTCTCTGTTCTCAATAAA ACCAATCCAAAATTGCAATCTAATATCGCACAACCGTCTTTAAAAGCCAA ATTCTTTAAAAGTAAATCAATCTATTCATGACATCCCATTCTCACAGACT CGGTAGGACTTTTTCAGCCAGTGGGGATAGAAATAGCAGACTAAAACTCG ATGGGGATTGATATTCCCATATTTTTTATGGCTGGGGATTTAAATTGCAT TGCTTTCAAGTCAGAAAAATAGTGGGGATGGGGAAAACAGCATGATATTA TGTAGTGAGGATTGGTTTGTTTGATTATTTTCAGTGGGGACAAAAATTGG AGTACAATTTTCACTGGGGACGTTATTTTGGCCATTTTTTCCAGTGGGAA GGATTCCCAGTGGATCTGTGAGAAGGGGGTGTTTTATGTCAGTGTGGAGG AGGGGACTTTTAAATCTCATGAAACTGATAAAACGACTTGTTGTTGGGAA AAAAGTTTGGATGTTTTGCATCTATGAAGGCTTACTATACCTTTCTTAGG GTAATGTTGCTGAGGGTTACTCCAACGAACGAACAGCAATTGGACTTTCT GACATCATTGAAGACATATAAAGGTGACTTGAAGGTACGAGGTTAGATCT CCACATTCACTGATTGAAGCCTTCCCCCAGCGGACCCAAAATTCACGCCA TTACGTCAATTCTTTTCAAATTTCACGATGTCACGCCTGTGAAATTCGAT ATTCACGATAAAGCCATTTTTTCTCGAAAATCACGCCACGGAAAACCCTG GGAGTTGCTAAATTCAAGCCACTCAAGCTCACGACTTGATTTTCATCAAA GCCAATCAAAAAATTAAAAGCGATGAGTCGTTTTTAAATAGGAAGCCCTT CGATACTTTCTGTAGGTCAATACAAAGACAAGTATTTCCACAAAATTGGG GTGTCACTATTCTTTAGACTTATCCACGGCATCAATCATAGAAAACAAAA AGCCTTAGCCCGGGGGGGGGGTACTTAGGCAAAATTGGTGCCGGGTATGT GCGAGCCATAAGGGTACCTTTTCTCATTCCTCAAAAGTCTGAAAGGGTCC CAAAATCACGAAAATCAAAAATTTCTCTCTCAAAGGGTCACGATTTCCAA AAATTTTGACCAAAATTTGCGTGAAAATCAAACCAAAATTTAGGAAAAAG TCTCTCAAAGGGTCCCAAAATCACCAAAATTTTGTCTCTCCAAGGGTCGA TTTTCGATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCGGGAGCCTTAGCCTCACCA TATGAATTAATTCGATAAATTAGTCATGAGAAAAGGCATTTCTAGCGTGA CTGTATTGTTGTTAACCACACTCTGAAGTTCTTAACTTCTGTCAACACAG ATTCAACTTTGGAGACATCCAGACGAAGTTGATCGCCACGTCGATGTCTG GATATCACCAAAATCAATTGACAAATTTAAAAAACTTTCTGGAGCTTTGA ACATGACATATGAAGTTTTGACAAAAAATATTTTCGATGAATGGGACAAA GAATATTCTATGAATAATATCGAAGATTTTGATATGGTCTATCAAAAATA TGACGAGGTATGTAATTATCACACCCGAAATATGTTTGCAATCTAATTAT AATTAGATGTAAAGCATGCAATCTTTAACTTCTTCACTACTGTTGGAAAG ATTTTTCAATGCAATTTTCTCGGCTCGGCTTAAGCAAAATAGGTTATGTT TTGGTCTGTTGGAAAGCTCTTTTCAGGATCTATATTTTCAGTATGCCACA TTTTGAAGCAGGTCCTCAATCAAAATCACCGGAAGCCAAAAGAATCGTTT ATAAATGAAGGAATTTCAGTTTGGCAGTACTCATGAAGTAGAGAGCTGCC AGTGTATTATTACTATATTCAGAAACTCCACTGTGCCAGGAATACCTCCT TTTACTCTTTTATTAAAGTAATAATACCCAATTCCCCTCACATTACATGA GTTGACTTGGGCGAAGGTATATTTACTTGCTAAGTGGATGTTAGCACTGA ATAGGTATCGAAGCCCGACCTGCTGGACAGAAGTTAAAGCGGATAATCTC AACACCACACGTATCCATGAGAACTAGTGTATACATTATCAAGGTTTTCA GAAAAAAACAACTCAGATTTTGTCTCTTTGATTTCTGCTAACAGGGTCAT TCGTCTTAAACTCTTGTTTAGATAGTTGGAGAATTGAAACGACTTGCATC TGTTTATTCAGACATTATGGAGTTACAAAGTATCGGAAAATCTTACGAGA AAAATGATATATACTCAGTTCATGTAAGTTTATTTATTTTTGTTTATCTA ACGTCTATCATTCTTTAACTATTCATGCATCCACAGCTGACATAAAACAG GCCCGAGGCTACATACGAAAAACAGGTGACGGGTATGTGCAAGCCATAAG GGTACCCTTATTCATAACACCTTTATGTCATAGACCCAGACCCCCTTTCT ACAATCAGATTCCTATGCTTTATCCTCACAGAGAAAGCTTTTGGGTTATT ATCAAGTATAGGTTCATTTAAAATGTTGAAGTTTTTCTGTTTCTCAGATT AGTTTAAATCGAAGTGACAGTCGTGAAATCATTTATTTGAACTGTGGATC ACACGCAAGAGAATTCTTATCCGTCTCTTCATGCAAATATGTCATTCGAA AGGTAAGACACTTTCATGAGCTAAATACATCATTTATCCAACTAACCTAC TAGCTTTCAAAGAAGTTATCATTCAAAACCGCGCTGTCGATCGCAGAATT TTCTCCTTGATTGAATCTGAAAATAACCGCAATGTGAAACATGGTTCTCT CTCGTCTGTCTTTTTTAGATTCTGTTCGATTCTAAATATGATGATAAAAT CAAAGATTTGTTGCATAATTTCGACATTGTGATGACACCGCTATTGAATC CAGATGGTTATATTTTTGCACACAATAAAAAACTCAAGGTAGGTGCATAA GTTAATAAAAACGCCGTTAACGATGAGGGAACTTTTCTAATCTTTTCAAC TTTGAGAAACTTTTATTCTCATGAAAGATTTCACTTCAATAGTCCCTTCG TAAAAATATTAGTTATTTTTCCTTTTCTCGAGGTCAGATTTCTTATCTCC ACATGCAGTAGAGTCTCCATAACTCGACCACGCACGGGGAAAACAAATTT GTTCGAGAAATTTCGAGTTATGGAGTAAGGTTTATAAGACATTGTTAACT CAAAGATCGAGAAAACTTGTTCGAGTTAAAAAGACATTCAAGTTATAGAG GTTCGAATTAAAGATACATTGTGGTTCGGGGCTCTTATATTAATAACCAA CCATACGCGATAAAGGATAATTTCTTTACAGCTGAACAGACTATGGCGTA AATCACGTTCACCGACTTCTGATCGAACTTGTTATGGAGTTGATTTGAAC CGGAATTTCGATCATCGATGGGGAGGTGAGATAAATCAATGCTTTTGTAA ATCGAACGTTGAAGGGTGTTGTGATGTTGAGAGTATTGCATATTTTTACA TGTTATTTTATGCTAAATACCCAAACCTGATTATAAGCATAAAGTTGGCG AATATTTTAGTCAAATTTTTACGAAATTGGTGTACCAGTCGATATTACAC CCCCTTCTCACAGACCCAGTAGGATTTTCTCAGCCAGTGGGGATAAAAAT GACGGACTGTAACTGGATGGGGATTTATATTCCCATATTTTTTATGACTG GGGATTCAAATTCTTTTGTTTTCAAGTCAGAAAAATTCAGTGGAGATAAG AAACATAGCATCATAATATTTTGCAATGAGGGTTGGTTTATTTTATTATT TTCCGTGGGGGAAAAATTGAAGTATAGTTTTCCACCGGGACGATATTTTG GCCAAATTTTTCTAGTGGGAAAGGGTCCCAGTGGGTCTGTGAGAAGGGGG TGTGATATTTAAAATAATCAACCTTGAATGTTGATCTAATTTTCACTCTA AGAAATTCACATTTAGTTTCATAAACCTTTCAAAAATAATTTCTACTTTC TAAGTGTTTCTACTGCAGGATACGGTGGTTCTGGTGATCCATGTGATAAC ATATACAGCGGGCCACGTCCTTTTTCCGAACAAGAAACGCTGTCTTTAGC ACGCTACCTATACAAATTACGACGTCGTCTGGTATCTTACATGGACGTCC ACGTTTNGCACGCTACCTGTACAAATTACGACGTCGTCTGGTATCTTACA TGGATGTCCACGTTTTTGGTCAACTCTGGATGAGTCCATGGGGATATTCA AGTACAACACCAAAGCATGCTGCTATACATGAGGCCATGCTGAAACAAAT TAAAGCAAATTTATTCAAAGAGCAGAACATCGTTTACGAAGTTGGACAGT CTGCAGTAGTATTATGTAAGCATTTTTAAACTTTGTATAAACCTAAAGAG GTACATGGTGTGGTTTTATCAGCCCTTTTCTGGCGGCGTATGAAAAATTG TGACGGTATTTTGGTGGCTAACTTGCAATGCAAAGATTTCAGCAATTATT TCTGTCGGTGTTGACGGATATTCAAAATATATGTAGTGACACCACCCCTC CTGAACGCCCCACACTAGCTGTAGACAAATAAAAATACCCTGTGTCGGCT TTCGAGATTCTCGTTTAAGTCTGGTTTAAGTCAAAAATTAATTTAAAAAG TTTACATTAACGTGATGTAGAAGACTGTTCATCTAACGTTTCCAGATCAT CTAAAAAGAACGACAAATAACATTCAAAAAGCGACTAAAAGAACCCTAAC CCTAACCCTAACCCTAACTATCAAAAACGACATAATTTGGATATTAAAGA CGTAAAAAATTTGGATTTGAATTTTGGTTCGGGAAATAAATCGGGTTAAA GTTTTGGTCGGGAATAAAAAAACCGGATACAAGTTTTGGTCGAGTGATAA AATGTCGAGGGAAAATTAGGTAGCCTCTTTTTATACTTATGACAGAAATC TGTGTGAGACAGAAAACTATTCAAGTAAATATAATTCCTAGCATTTTTAT TTTAGATCAAACAAGCGGCGACTCTATCGATTGGGTATACGGCCGTCTTG GTGTCGTTCACTCTTATGGCGTCGAATTACGCCCTAACCTGACTGTAAGG CGTGGTTTCCGATATCATTCCAACTTTACAAAACCTACTGGAGAAGATCT TCTCGTAGGTATTATGACGATCTCAAATGAATTGTCAAGAGAGAGAAATG AGAGAATGGGTGCTATGCTATGATGAATAGTTGGTATCTTTTTCTGAAAG ATTTTCTAAAAGATTATTTTATTTTTTGAATATTTAACAAATGAAATAAA AATTTTATACCATAACTTGGACCTATCTTTATTCATGGCGTTTCGAAATT ATTAGAGTATCGATATTTCATTGGGG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000358XLOC_000358Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000611-exon-sc0000002-1575043694:1551916..1551975TCONS_00000611-exon-sc0000002-1575043694:1551916..1551975Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1575043694:1551523..1551643TCONS_00000611-exon-sc0000002-1575043694:1551523..1551643Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1575043694:1549992..1550076TCONS_00000611-exon-sc0000002-1575043694:1549992..1550076Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1575043694:1548969..1549175TCONS_00000611-exon-sc0000002-1575043694:1548969..1549175Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1575043694:1548253..1548354TCONS_00000611-exon-sc0000002-1575043694:1548253..1548354Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1575043694:1547874..1547978TCONS_00000611-exon-sc0000002-1575043694:1547874..1547978Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1575043694:1547588..1547707TCONS_00000611-exon-sc0000002-1575043694:1547588..1547707Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1575043694:1547101..1547194TCONS_00000611-exon-sc0000002-1575043694:1547101..1547194Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1575043694:1546161..1546507TCONS_00000611-exon-sc0000002-1575043694:1546161..1546507Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1575043694:1545150..1545520TCONS_00000611-exon-sc0000002-1575043694:1545150..1545520Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1510915933:1551916..1551975TCONS_00000611-exon-sc0000002-1510915933:1551916..1551975Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1510915933:1551523..1551643TCONS_00000611-exon-sc0000002-1510915933:1551523..1551643Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1510915933:1549992..1550076TCONS_00000611-exon-sc0000002-1510915933:1549992..1550076Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1510915933:1548969..1549175TCONS_00000611-exon-sc0000002-1510915933:1548969..1549175Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1510915933:1548253..1548354TCONS_00000611-exon-sc0000002-1510915933:1548253..1548354Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1510915933:1547874..1547978TCONS_00000611-exon-sc0000002-1510915933:1547874..1547978Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1510915933:1547588..1547707TCONS_00000611-exon-sc0000002-1510915933:1547588..1547707Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1510915933:1547101..1547194TCONS_00000611-exon-sc0000002-1510915933:1547101..1547194Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1510915933:1546161..1546507TCONS_00000611-exon-sc0000002-1510915933:1546161..1546507Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1510915933:1545150..1545520TCONS_00000611-exon-sc0000002-1510915933:1545150..1545520Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1491911889:1551916..1551975TCONS_00000611-exon-sc0000002-1491911889:1551916..1551975Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1491911889:1551523..1551643TCONS_00000611-exon-sc0000002-1491911889:1551523..1551643Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1491911889:1549992..1550076TCONS_00000611-exon-sc0000002-1491911889:1549992..1550076Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1491911889:1548969..1549175TCONS_00000611-exon-sc0000002-1491911889:1548969..1549175Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1491911889:1548253..1548354TCONS_00000611-exon-sc0000002-1491911889:1548253..1548354Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1491911889:1547874..1547978TCONS_00000611-exon-sc0000002-1491911889:1547874..1547978Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1491911889:1547588..1547707TCONS_00000611-exon-sc0000002-1491911889:1547588..1547707Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1491911889:1547101..1547194TCONS_00000611-exon-sc0000002-1491911889:1547101..1547194Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1491911889:1546161..1546507TCONS_00000611-exon-sc0000002-1491911889:1546161..1546507Clytia hemisphaericaexon
TCONS_00000611-exon-sc0000002-1491911889:1545150..1545520TCONS_00000611-exon-sc0000002-1491911889:1545150..1545520Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1545150..1551975 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.66054e-07 4.37242e-08 0 8.73203e-08 8.03791 8.16549 30.5928 28.9472 21.9583 15.3553 24.8559 26.1682 30.3711 48.28 2.98863 1.56157 2.55187 1.63982 14.0461 15.5731 5.74118 13.5458 1.48298 9.53927 20.6688 21.8413 1.98377 5.7097 79.8643 61.5684
Blast
BLAST of TCONS_00000611 vs. Swiss-Prot (Human)
Match: CBPA4 (Carboxypeptidase A4 OS=Homo sapiens GN=CPA4 PE=1 SV=2)

HSP 1 Score: 124.405 bits (311), Expect = 1.552e-39
Identity = 78/267 (29.21%), Postives = 130/267 (48.69%), Query Frame = 3
Query:  189 LLRVTPTNEQQLDFLTSLKTYKGDLKIQLWRHPDEVDRHVDVWISPKSIDKFKKLSGALNMTYEVLTKNI---FDEWDKEYSMNNIED-----FDM-VYQKYDEIVGELKRLASVYSDIMELQSIGKSYEKNDIYSVHISLNRSDSREIIYLNCGSHAREFLSVSSCKYVIRKILFDSKYDDKIKDLLHNFDIVMTPLLNPDGYIFAHXXXXXXXXXXXXXXXPTSDRTCYGVDLNRNFDHRWGGYGGSGDPCDNIYSGPRPFSEQE 962
            +LR+   N  ++  L+ L     +LK+  W+ P   +R VDV +   S+  FK    +  + Y V  +++    D  D E   N  ++     F+   Y   + I  E+  +A+ + D+     IG S+E   +Y +  S  +   R  ++LN G H+RE++S ++  +  RKI+ D + D  I  +L   DI + P+ NPDGY++             +SR+P S  +C G D NRN++  + G G S +PC  +Y GP   SE E
Sbjct:   26 VLRINVRNGDEISKLSQLVN-SNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQ--TQNRLWRKTRSRNPGS--SCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVE 287          

HSP 2 Score: 58.151 bits (139), Expect = 1.552e-39
Identity = 36/111 (32.43%), Postives = 53/111 (47.75%), Query Frame = 2
Query: 1076 MDVHVFGQLWMSPWGYSSTTPKHAAIHEAMLKQIKANLFKEQNIVYEVGQSAVVLYQTSGDSIDWVYGRLGVVHSYGVELRPNLTVRRGFRYHSNFTKPTGEDLLVGIMTI 1408
            +D+H + QL M P+GYS      A   + + +     L       Y+VG +   +Y  SG SIDW Y   G+  ++  ELR   T   GF   +N   PT E+  +G+ TI
Sbjct:  305 IDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDN-GIKFAFTFELRDTGTY--GFLLPANQIIPTAEETWLGLKTI 412          
The following BLAST results are available for this feature:
BLAST of TCONS_00000611 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CBPA41.552e-3929.21Carboxypeptidase A4 OS=Homo sapiens GN=CPA4 PE=1 S... [more]
back to top