Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000597 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000597
Unique NameTCONS_00000597
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2574

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000597 ID=TCONS_00000597|Name=TCONS_00000597|organism=Clytia hemisphaerica|type=transcript|length=2574bp
TAACAGGGTGATGATTTCCAATGCTGACTTTTCATTGAGTCGCGGAGACA
TCGAACAAGCTCTTGAAATGTTACGCAAAATTACTCCTGATCAAAGCTAT
TTCATTCAAGCGAGAGAGAAGATGGCGGAAATTTACTTGAAATATCGTAA
GGACAAACGGCTGTATGTTAGTGTCTACAGGGAACTGGTAGAGAAGATGC
CAACTTCTGAATCTTTTCTCCTTCTCGGAGATGCGTACATGAGCATCATG
GAGCCTGAGAAAGCAATTGAGGTTTACGAAAGCGCTTTGAAGAAGAACCC
CAAGGACTATTCATTACAAATGAAGATCGGTCAAGCATTTATCAAGACTC
ATCAATACGCTAAAGCAATCAGTTACTATGAAGCAGCAGTGAGAGCTGGT
AACCATGTTCTAAGattcgACCTTGCTGAACTTCACATGAAGCTTGGAAA
CTTTGAGAAGGCGGAACGAATATTGAAACAAACCttgttgaaaaatgaaa
caacaaCTGCACTATCTCGTAGCATCGAGGAGGCTCGTTGTCAATTCTTG
TTGGCTCAGATTTATCAAAAGACTAAAGAGTCCGAAGAAATTCTCGAAGC
TTATTTGAAAGCCAAAGAATTGCAATCAAAGGTTATCAAGAGAGTGGCCA
CAGAACAACCAGATGATTTACAAGAACACAAAGCTCTAGCAGCAAAGGTT
TCTTACAACATCGGTCAATACTATTACAATGGAAAGGACTTCGATCGAGC
CATCAAGTCGTATAAAGAAGCGACTTACTTCAATGAATCTGAAATAACGT
ACATTCTTGCATTGGCTGAGTTGTATCTTTTGAATCAAGATCTCGATGCT
TGCCAATCACAACTACAAACCATTCTCAAGAATAATAAAGATTGCGATCG
AGCTACTCTGATGATGGCAGACTTGCTGTTCCGCAAGGGAGAGTACGATT
CTGCTACTTTCCATTTCCAAGAAATACTCAGTAGAAAACCAAGTTATTAT
GATGCACTTGCCAAACTTGTCGAACTTTTACGTCGTGCTGGAAAGCTGGA
AGATGGACCAAAATACTTAGATCAGGCTCTTGCAAGCAACCCACGTGCCC
AAATGGAAGCTGGCTACAATTATTGCAAAGGTTTATATGAATGGTACCAA
AACAATGCTTCGTCTGCactcaaatttttcaatcttgCTCGCAAAGATAG
TTTATGGGGTGAGAAAGCTTTGTTCAACATGATCGATATTTGTTTGAATC
CTGATAGTGATATCGTTGGAGGTGAAACATTTGATGTCGCCGAAGGAACC
AATCAATATGAAAAGCACGATACTGAACAAATGGCTATCAAGACGGCAGA
AAAATTACTGAAAGAGATGAAACCGAGTCGTAATCCCTTAAAACAGAAGC
TGTTTGAAAATCAACTACTCGTGACCACAAGAAACACGCAACTCGTACAA
AAAGCTCTCAATAACTTGATGGAAATTGCTCAAGTTGAGAATGACTATGT
ACCAGCGCTTTTGGGGATGGCCACAGCTCACATGATACTCAAACAAACAC
CAAAAGCCCGGAATCAACTCAAACGTATCTCCAAAATGTCATGGAACTCT
GAGGATGCTGAAGACTTTGAACGAAGTTGGCTTCTCCTCGCTGATATATT
TATTCAGAATGGGAAATACGATATGGCACAAGAACAACTCAAAAAGTGTT
TGACTTATAATAAGAGTTGTGCCAAAGCATGGGAATATCTTGGTTTCATT
ATGGAGAAAGAACAATCATACAAAGACGCAGCATTGAATTATGAAAACGC
ATGGAAATTCACCAATGAATCCAGTCCTGCTATAGGTTATCGTTTGGGAT
TCAATTATTTGAAAGCTAAAAGATTCGTAGATGCAATAGATGTATGTCAC
AAGGTACTTGGTAAGCATCCCAATTATCCAAAAATACGTAAAGAGATTTT
GGATAAAGCAAGAGCTCAGTTGCGGACGTGAAATTTGGAGACAGAGCATT
GGTGAACGACCGTCATGATAAACAACCAGCTTTATTTAAACTTTTCGACT
TCTTAAAGTCGAAAGAATTCTCCATGATCACTGCATATCGATCTGCGAGA
TTTCCTTTCTCAAAGATGCGTcttaaattttctgaaaatgctatTGAACT
TTCACTGGGATGGAAGCTGTAAGCATCATATTGAGGATCTCCCTCAAGCA
ATACCATGTGTTCCgaaaaaaagcggacaaatttttttatataaagtaaa
atccacataatttatgcaaaatatctcaatcttaaaaaccttttcaatcg
ttttgggaattgaatatctattgattgagCAGAGTATTGTCATCTTAATT
CAATTATTCTAAGCTCAGGTTAGATAATGGTTTTAgcggattttacttta
tataacaATTTGTCCCCCTTTTTTTCGGACatacTGTATGTCctgttttt
gtaaatatttgttTGTAAGTAAGTGAATTATACTTCGTGTAAACTATTGA
TTTTAATTTGGTAATTATACATTTTTAATTGTAAGAAAGATAAATGTGTT
GTACATACATTTAAAGAAGGATAT
Run BLAST on NCBI

protein sequence of TCONS_00000597-protein

>TCONS_00000597-protein ID=TCONS_00000597-protein|Name=TCONS_00000597-protein|organism=Clytia hemisphaerica|type=polypeptide|length=659bp
NRVMISNADFSLSRGDIEQALEMLRKITPDQSYFIQAREKMAEIYLKYRK
DKRLYVSVYRELVEKMPTSESFLLLGDAYMSIMEPEKAIEVYESALKKNP
KDYSLQMKIGQAFIKTHQYAKAISYYEAAVRAGNHVLRFDLAELHMKLGN
FEKAERILKQTLLKNETTTALSRSIEEARCQFLLAQIYQKTKESEEILEA
YLKAKELQSKVIKRVATEQPDDLQEHKALAAKVSYNIGQYYYNGKDFDRA
IKSYKEATYFNESEITYILALAELYLLNQDLDACQSQLQTILKNNKDCDR
ATLMMADLLFRKGEYDSATFHFQEILSRKPSYYDALAKLVELLRRAGKLE
DGPKYLDQALASNPRAQMEAGYNYCKGLYEWYQNNASSALKFFNLARKDS
LWGEKALFNMIDICLNPDSDIVGGETFDVAEGTNQYEKHDTEQMAIKTAE
KLLKEMKPSRNPLKQKLFENQLLVTTRNTQLVQKALNNLMEIAQVENDYV
PALLGMATAHMILKQTPKARNQLKRISKMSWNSEDAEDFERSWLLLADIF
IQNGKYDMAQEQLKKCLTYNKSCAKAWEYLGFIMEKEQSYKDAALNYENA
WKFTNESSPAIGYRLGFNYLKAKRFVDAIDVCHKVLGKHPNYPKIRKEIL
DKARAQLRT
Run BLAST on NCBI

transcript from alignment at sc0000002:1345044..1361485-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000597 ID=TCONS_00000597|Name=TCONS_00000597|organism=Clytia hemisphaerica|type=transcript|length=16442bp|location=Sequence derived from alignment at sc0000002:1345044..1361485- (Clytia hemisphaerica)
TAACAGGGTGATGATTTCCAATGCTGACTTTTCATTGAGTCGCGGAGACA TCGAACAAGCTCTTGAAATGTTACGCAAAATTACTCCTGATCAAAGGTAT GAATGTCCAATAAAATGGCTTTTGAAATCTTAAATATATTTTGAAAAATA TTAAGACCTTTTAATGACAAATACTACAGTTAACTCTCGCTAAATCGAAT TCGAATGTGACGTCATATTTGTTAGAATTACAGAGAGTTTTTAATTAAAG TATTTTAAGAGCGTTTCCCCTTGACGAGAAATGATTCGAATTATAAAAAG ATTCGAATATTCAAAGTTCGAATTAGCAAAATTCCATTGTATACGATACT GTAACAACAGATCCTACAAAAAAACAAGCTTAGATCGAGTCCTACGTCTA GAGCAGTAAAGATTTTCCCGATATGAGTAAGTTCAAACGAGAGTTAGGTT GGGAAGACTTTTTGAAAACAAGTTAGTATCTCACTCAGCATTTTTAATTC ATGACTGTGACTTATTTTTCTTACTTCTAAAACTTGTTCCAGCTATTTCA TTCAAGCGAGAGAGAAGATGGCGGAAATTTACTTGAAATATCGTAAGGAC AAACGGCTGTATGTTAGTGTCTACAGGTTAGAAAGTTAAGATTTTGTTAT TCTTATTATCAGTAGTCTTTTAGGAATCGACGTAAATTTTTTTTAATTCA ATTGTTAATACATCTTGAGAAGAGTGTTGACTGGGCGACTGGGTAAGGAT TTTCTTCGTTTTTTTATTTTCATTTTTTGATTTACCGAAAAAAGTGTACA CTGAAAATCTTATCATATTATTCTTTTACAGTTATGAAACAAATAAAAAC ATAAACTTCAGCTGTGTACCTTTTATTTCTCATCTTATCTAGGGAACTGG TAGAGAAGATGCCAACTTCTGAATCTTTTCTCCTTCTCGGAGATGCGTAC ATGAGCATCATGGAGGTTTGTACACAATACTATCAGTTCCGAGCCTGCAG AAATGAAATCACTGAAGTGAAGCTACTTCCAACCACAGTTTACTAGAAAG TTGAACGTGTCACCCTACTGATTGCCGGAAAGTCCTCCCCTGGAGAATAC CTCCGGTGAATTATCACCCGGAAATATCCCCCTGGTGGATTCCTAAACAT ATATTTTTGCTTCCGAATTTGCTTAGACATCCATTGTATTTTATTCATTA AAGCAGAAGTTACTAGATAAAATTTGCTTAATCGACTTTCAACGTACAAA GAGGTAGTAAAATAACAAAGATGTTTTTTTTTTGGGGGGGGGGGTTCCGG ACATCACTCTATTGCTTACTCTTGATTTTCTGAAAGGCGCTAATTCATCT TTCGAAAAATTTTCACCAGGGACATTCTTATTCAAACTACCCCTTCCAAA AACGCTGCTATTTTTGTTGAAAATATTTAACAAAGTTCCTTCTTTTGCCC TAATTCTTCTAAATAAAACATCTATTCTCACTAAAAATTTTCATCCGGGC ATTTTTTTATTCCTCCCCGCTCTTTTCAATCCTGTCGTCCGGGTACTCGA AAGTATACTACGATAGTGTCAAGAGCATACTTTGCTAATACATCACATTC ATTTCAGCCTGAGAAAGCAATTGAGGTTTACGAAAGCGCTTTGAAGAAGA ACCCCAAGGACTATTCATTACAAATGAAGATCGGTCAAGCATTTATCAAG ACTCATCAATACGCTAAAGTAAGTCGATTTTTCTGTAATTCACTTCTACA TTTAATCGAATCTGAATTGTGATGTTCGTAGGGTCTTTTATAATCCATAA ATACATTAATTTGGTTGTCATATGTTAATACGATAATTTAGCCGAATCAG TCATCTATCATGACTATTCTTAGGGTTGTTTGTACGGTCTACCTAAATCT ACTGAAACTTGTTCTTTGACAAAAAATCATTCGGTTTCACTTTTTTGCAA TATATTTTCTGCCGATAAAGTTCATAAAATAGAGTGTCGATTTTTTCAAT TTCATGATAAAATGTATTCAGGGGTAACACGGATAGGTGCTGATTTTTGT CCTTAAAAATCAGGCTGGATAATTGTTTCCATAATTTCCATTGTAGGCAA TCAGTTACTATGAAGCAGCAGTGAGAGCTGGTAACCATGTTCTAAGGTAT GATCACGCCTACTTTATTCATTTTTACAAACATTTTTATTCAATTATTAT TGAATGCATAGTAGAAAAATACTAATACTAACATCGAATGAAAATGGCAT ATTTTTTACCCGATGTATCGTGGTAAGCGTTGGTAAGGGTGTACTTTCAA GTGGAGTCAAGCATTTTGTGTTATCGTGTTCAGCCCGGAAACCACTTTTA ATTTTCTCCTTTTTGCCTAATTTTTGGCTAATTTCTGTCGATAAGCAGAC AAGGAGACAAATTAGAGGAAGCAATAGTTTTCTTTTTATTGTCATTCGAT TTTCATCTTCAATATATTTGATAGTTGGGAGATGTCACTTTGCTTGCTAT TTAGCATCTTTAAATGAAAAAGAAAAATAGCATTCCCATTTAAAGCGATT TGTTTCTAGGATGCTATTGTGTTAGTCTACTGACATCCACTAACGGATTC GTGCTCCTTACAGAGGATGCTTCCTTCAATAATTTCTTTGTCTAGAGATT TGCCGCCTTTAGCCGATATACGGCTAAAGACATTTTTAGCTGGCGATGGT CTACCAATATAACATAATGTAAATGTAATGTAATGTTTAAATTTTCTGTG AGGCACCAAATCATAGATTGGAAAATGTTATTTAAATTTCGAAAAAGAAG TAGGCGGAAGGAAGTTTGCTTGTTTTTTTTCTTCCTTTCTTGTTTAATGT GGAGATTTTGTAAAAGATGAGAAATTAGATTTATTGAATTTAAGTGCCCT GATGTATCTTCTGTGTGTACCAACAAATTTTTGCCTCATAAAATTACATT TTGATGCTTGAAATTGGACTTGTATGAGTGTATAATCTTTTACCAAACTG GATTTGTTGATCACTTTGGCTTCAGATAATTGTTTTGTCAGCTCTACAGA TATGTTGCAGATTATTCATAGTTTCTACCCCCCTACATTTAGGAGAGGTT TTAAATAAGGGGGATCTTCTTTGAATTATGACTCTTGTACAATCGTTTCA TTTTATACTGATTTTCTAAGGGGGGTGTGAAATTTTAAATGAATTTCCTA AGGGGGGTTAGCACTTAAGGGGGGATCCTTTTACCTAAGGGGGGTCTTGA CCCCTCTAGAAACTATGTTATTTTAAGGTATTTTAGATATGTATATACAG TACATTTTTGGGGTTGTATTGAATATTTCTGACATTACTTTTTTATGATT CTACTAAAGAGAGTGTTGTTGTTCCCTTGTTAAATGTTAAAACAAGCAAA GAACTTTTCTTCAGCCTTGGCATTTCACTTTTCGATACTATGTGGCCTTT GTGTTTATCTTTTTCAGGTACTATAGCTTCAATTCTTTTGAAGAGATTGA AGTGTCTTTGGTTGTTTTCTTTCGCACTTTTGTGTTTTTATTTGTATTTT TGAGTTTCGACCGAAGAGCTGAGGGAAAAGTTTTGATAAATTTACAGACC AGATATCTTATAAAAGCAAAAGTAAAAAATAAATCTACATACTGTACAAA ATGTGCGCATTAGATTGTTTTTATCTTTTTTTCTGTTTTGTTTTTCTGGT CTGTGATTCGAATTTCGAATGTAAACATTCTATTGAAAATTTTCGAAACG ATCGTTTTTGCGCGCACATCAATGTCAATCAAATTATTAACTCGCCAAGA TTCTGTAAAATACATCGGAATAAATAAACCGAACCGGAAAGCGGTTGGTA GATAATAAAGCAGACCTATACTACCTAGGGTTTTGTAGGGGTCTGCGATT CAGACTACTATTGTATTGGCTAGAAGCTTTGTGGAAATAGAATGCCAAAA GTGAAGCAAAGCGAAATAGTAACAAACCAAAAGAATCATATGTATTGAAT ATTTATCTTTAAGTGAACTCATTTTAACAAAATGACAAATCATATCATAA ACAAGAAAAATCGTATTTTATTTGCGTCGTACTTTCATTTCGGAAAAACT TAGACGTTTGTGTCTCCAGGCGAAGTTTTTCCACTCGTGCAGCTGTTGGT ATGGGTCGTAAGCTCCATTTAAGTTGACTTCATGACAAGCCTTCGTCCAT CCTGCGCCGTAATTGACAAGGGCGCAATTGCCATTAGACCATTTGTCATT ATCTCTATCGAAAGTGCTGAACTTCATTCCGCTATAACCACTCACCCCAT CTCCTGCGTTGCCAGAATATCCTGCGAAATTTGAATATTTGGCCCATATT TTCGTTCCATCTTTCTGAACCATATCGAAACGGACTTCACTTCCTGTCCG ATGTGCTTGTGCGGTTAAATGGTAGAGATTCTTGTTTCCCAACCAAAACT CCCGATACAAGCAACCGAAACCTTATTTGTAGGCTTCCCAATTTCGTTGA AAGTTTGTACTGCCGTCGACGCGTCGCTGCACAAGGGTCCAGCCACCTCC GTTAGCCTGTTGATCACAATTGACCTGGATGACCACATCTATCATGTTTT TATTGATACGGTACAGACCATTTGTTCTATCGACTTGTGCATAATGATCC TTGCAATCTCTCCTGACCGGTTTGGCGCGACAATCACAATAATATTTCTC AACCAGGTTATAGTCCTCTACACAAAAACAAGATCCGCATGAGGCAGCCT TTGTTTGACAAAAACCATTTCGAACGCGATCCTTGGTTTTCAGAAATTCC AGCAGCTCAATCTTTCTTGAGAGGGCTTGAATCTGTGACTTTAATACACT GGTATCCGTGGACGGTTTCAGCTCAGATATTTGCAGGCTCGCCAAGAAGA TATTGATTATGAGAAGCGACTTCATTTCTAACTTCATTTAAGTAAATGTG CTCTCTAATGTGAGACGTTAACACCCATTTGACTGATATACTTGTTTTCG CTTTATACACACTCGTATAAAAAGAGTGGGCGTTTCTTTTGTAGATTGCA GTACTCTTTATCTTTTTGTTTCTTATGTACACTGAAAGTTAGGCTACAAT GTTGCTGCTTTTTGTGAGATCTGTAGTCTCGTCCCCGTTCACTCGTTTTA TACATGGTCAACATCTTGGTATAAATTGTAAGCTTTATTTAACAGGATAC ATAATGGATCAGAATTTCATAGCCTACAGACCAATGATTTATTTGTAGGA TGTGTTATGTAACCCCAGTCATATGTCCAAATATTATCTGCATTGAGTGT TTTTTGATGTACAAACACCCTGAAACTATCAACCTACGTTTCCAATCAAT ATATGTGTTTAAACATCTGCTAAAGTGTTTGTAAAAAATTATCTAAAAAT ATTTCTTGAAATGTTTACCGCATCTGTCCCAGAAACAAATATGGTGCTCG TGAAAACTTCTGAGAGCCCCGGATTACTGGGTTTGCAAGTCGACAACGTG TGCGGTAACATCACGGTCTGAAATTTACACGTCTATTTTGCCGAAATTTC TACAATTTCTATTTTTGATTACCTTGAGATACAACTCTTCAGCTGGCCCA AAAATTAAAAAGGGGGGTAATTTAAAAGTGGGTCCAAAAAAAGCATATCA AAGTCTAAGCTCGGTATGTGCAAAATGTCATGCTTTCAGCAAAACCTTCC ATTAATAAGAAATCCATTAATATCGTGCAACATTGAATACAATTCTTTGA TTTTAGATCTTTTTTCATTGTCTCAAGTTCACCTTTCTACACTGTTTTAT TTTTTAGATTCGACCTTGCTGAACTTCACATGAAGCTTGGAAACTTTGAG AAGGCGGAACGAATATTGAAACAAACCTTGTTGAAAAATGAAACAAGTGA GAAATTTAGTTTTTGTCAAAACACTGGATATTCAAGTCCTCCAAGATTTC CTCTTTGAACTGTCTTTGAACTCTGGTGTTATAATAATGGACTGACAAAT GATATCTTATACTCTTTTCTGAATAAAATAAATATTCATAATTACATTTT TTAACCTCTGTTTGTTTTAGAAACTCCTTGACTTAAGTGTTAAGAAGATA TTTCGATTCACTTCCCATTATACTGGGACATAAGTCATTCTTTTTGCTTC ACGACATTTCTTTTTTTCAGCAACTGCACTATCTCGTAGCATCGAGGAGG CTCGTTGTCAATTCTTGTTGGCTCAGATTTATCAAAAGACTAAAGAGTCC GAAGAAATTCTCGAAGCTTATTTGAAAGCCAAAGAATTGCAATCAAAGTA GGCATCGTTCAATTTTATTTTCAATAGTATTAGACATTCAGTCAACCTAG GTCAACTCGTTCGAATGACTGCTATTTTTAAAATAACTGCTTTTGTCCGA TATTAGCACACCTCTATTCTACGATATTCATGACGTAATTCATTTCTACG GAAGAATCCCGGTTTTTGCCAGTAGTGGCAAATTTTGATCAATTTTCACT AGTCAAAATTTGCCACTACTGGTAAAAACCGGGATGTTTCCGTGGAAAAC ATTACGTCATGAATACTAACCTTTTTTAACTTTCAGGGTTATCAAGAGAG TGGCCACAGAACAACCAGATGATTTACAAGAACACAAAGCTCTAGCAGCA AAGTATGTAACTTAGTGGAGAATAAATTTTGAGAAATAATTTTAATCCTT AACTTTACTTATACTTAACGTCACAGTTTGGTTCACGCACCGATTTTATG GTTATCTCTCTCTAATTCGATCTTTATGGGACCAAAAATTTTCTTCTTAA ATAGAGAAACATTCGAATTACAGAGCGTAATTTAAACCACTTTTCAGTTT AGGGGATCAATATTTTAGTTCGAATTACAGAAAGATTCGGATAATAGAGA TGAGGTTCGAATTAGAGTGGGGTCACTGTATGCTGTATGTACAAAAACAG ATTCAATGAAATTGAATAGTATAAATTGTGGAACGATTCCGGAATTTTAC AGCTAGCCCTCTGGAAATATTACGGCCTATTAATCGTTCTACTGGAAAGC TTAGCTTGTGTGTTGTTTTTTTACTTAGAACTTGTTTCAAGACCGTGTCA TTCAGGTTAACCCTTTTACCTACCCTTTCCTCTTTCCTCTTTAACAGGGT TTCTTACAACATCGGTCAATACTATTACAATGGAAAGGACTTCGATCGAG CCATCAAGTCGTATAAAGAAGCGACTTACTTCAATGAATCTGAAATAACG GTAGGACTTTTCAAAAACCTGCGGTTTCCGCAAGTAGTAGCGTGGTGGTA ACGGTGCGCAGGTTTTTTATGGCTCCGAGATGCAACTCATATTATTAATT TTGTCATCTCTCCCCTTTTTTCACACGACAGAGAACAGTTTTTAGCCAAA AAGAGGAAAGAAAATCTTCCAACAAACTTCACATGCAAATCATTCTTTGA TTTGCCACCAAATAGTAAACTTATCTCTAGAATAAAAATTGAACATCATC CTTTGCGGTAAAGGTCAGGGAGACCGACACGGTTTATTTGGTTAAGCAAT TCTTTGCCTAAACAACCACTCGCCTGATTTTATTGCTTTTAATGTTCGAA CAATCTTACAGTTCTTATATTTGATATCAAAATAATAAATAACTGCACAT TGTCTCGTTTACAGTACATTCTTGCATTGGCTGAGTTGTATCTTTTGAAT CAAGATCTCGATGCTTGCCAATCACAACTACAAACCATTCTCAAGAATAA TAAAGATTGCGATCGAGCTACTCTGGTAAGATTGAATGATCAAGAACTAT ATTAAATACATAGCGGCTGTAGTATGAAGGTAGAGCACCCAAAGGTTGTG GGTTCGATCCCTGGTCAGGTCTACCAAAGATTTAGAAAATGGCACTTCTC TGCTTGATGCTCAGCAATTAAAGAGTAGGGTCAAGGGTAAGAGGAGAAAT CCAGGGAAAGAGTGACGTCATCTCCTACAATTTAGGCAGTTAAAGAAAAG AAAGACTATGGTCGCCCTCGATTCTAGTCTCAAAGCTATGTATACTGGAA TCAAATAATTTTAGTTTGCCAAAGTAGCTTCACCTGAAAATTAATAAACG CCCGTCTTTGTTACTTAATTTTTTATGAATATGAAAAGAACCAATCCTGG TATTTCAATGATTGTGTGTGTATTTTTGAATCATTTAGATATTCTCTTTC TTTGATTTGTAGATGATGGCAGACTTGCTGTTCCGCAAGGGAGAGTACGA TTCTGCTACTTTCCATTTCCAAGAAATACTCAGTAGAAAACCAAGTAAGT CGCATGAATGGATGATAGAGCAGCAGTGGCGCTATATGAAGGCGGCCCAA ACTTATTTTCGCTCCTTCACTAAAACTCCTCCAAAAACTTTTCAACCCAT GCGTACTGACAAACCTTTTGATTGTTACAGTAATTTTTTGAATGCATTCC ATAGAATAGAGCTTGATGTTAAATTGTCAATTAAACTTTACTCCAACTTA TCATTACAGGTTATTATGATGCACTTGCCAAACTTGTCGAACTTTTACGT CGTGCTGGAAAGCTGGAAGATGGACCAAAATACTTAGATCAGGTAACATT AGAAATTCAATCTTCGGTGTTCATTTCATCAAGATTTGATTTTCATTCAT TTCAAAAAACCATTTTGCCTCGTCAGCAATGTCCACAATCAAGCATGGTT CAATTGTCGATAAAACTGATTTTTAAAGCCGGAACTTTCTAAAAATCGCC GGAACAGCCGATTTTCGCCGGAAAAACGGTATTTCTTGAATTTCTCGAGC TGTACTTTATATTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN CGAAAATGCCGGAAATATGCCGGAAAAACTGTTTTTTTGGCATTTTCTCG AGATTTTATCATTAGTTTTTTCTGATTTTTCGCTCAAAGGTGCGTATTAA TATTGCCCAAAACATGGCGAAGTCCGATTTTTGAGAAAAAAATTTTTCCG GCCGAAAATGCTGGAAATATGCCGGAAAGACAGTATTTCTTGAATTTCTC GAGCTCTACTTTATATTTTTTTTGTGAAATTTTGCACACTGATGCAATAT GACAATACCTAAAATGTGACGGAGCCCGATTTTCGAAAAACATTTTTTCC GGCCGAAAATGCCGGAAATATGCCGGAAAAACCGTTTTTTACATTTTCTC GAATTTTCATCTTCAGTTTTTTCTAATTTTTTTGCAGAAAGATGCGTATT CGCAATGCTCAACTGAGTTCGATTTTTGAGAAATGCCGGAAATCGCCGTT TTTGCAGATTTTCATTAGATTTTTTTACTTGTATTTCTATGTTTTTGACA CAAAAACATTATTGATAACAATGCTCACAATCAAGCATTATTCAATTGTC AATAAAACTGATTTTTGCGACCAGAACTTTCTATTTATTTTTTCCCTACA ACCCTTCCCTCTCTCCTTATCAACAATCAATGATGAATTTATTGCGTTAT GCATTTTCCCTAAACGCTATATTTTCTGACTGATTTTTTTCTCCTCGCAT TGCTTTCTAACTTTCATCATCAGGTAGGTCCATTCAGCATCTAGCTTGTT TATTATCGAATAAGAATTTAGAAATTCATGAAATAATTGAATTTCATTTC TCCCTTGCACTTGATAGGCTCTTGCAAGCAACCCACGTGCCCAAATGGAA GCTGGCTACAATTATTGCAAAGGTTTATATGAATGGTACGTTGTATTCAT TTGCTTTGTCTAATACACTGTATTTTACAATTTACTTTTTGGCTACTTTA AACACAAATAAGTTCTTTTTTTATTTTCTTATTTTGACTTTTTTCCCAGG TACCAAAACAATGCTTCGTCTGCACTCAAATTTTTCAATCTTGCTCGCAA AGATAGTTTATGGTATGTATATTATCCTTTCTTTTTATTACACGTTTTTT TATAAGAACATCCAAAGTTTTTGAAGCCTTCTAATGTTGTTAACTTTTTG AGTTTTAAGCCTAAAATGTTCTTAACAATAACATGTTCTTATTTCCACCA TTTTTGGGGCATTTTTGTCCATTTTCCTAAGAAAGCGGATGTTTTAGAGT CTGCGAAGCCTTAAATTGTTCTTAACTTGTTCTTAACATTTTGGCCATCG AAGCCTTATGTTCTTATATAGTTTGTTCTTATAAAAAACGTTGATTCTGA TGTAACGCAATTCATTTATCAATTCTTACCAGGCGTTGTTCACATGGAGA CAAGCCGCCCATGTCGGTGAAATACCTGTAAACCCGTCAAATTGTTATAA GGCAAAATGGTTACTAAGAGGCGAGAATGTCAATATAATTATGGTGTTCT AATTTGAATAATGAATTTAGAACACAATGACCTTGGTCAACTAATTACAT CAGTCTTCCATTGAACATTCTCTCATAACACCTCTGTGTCACAGACACGC TGGGACCCAGCCCTACTGGGAAATTGACTTTGATTTCATCCCCATCCGAA AATCAATGTATAAAAACTGCACTCCGAAACCATCCCCACTGGATTTTCTA ACCTTAGAACAATAGAATTTATATCCCCACTTGAATTTCGATAGGAATTC TTATCCCCACTGAAGAATAAAGCTCCACCGGGGCTGTGAGACAGGGGTGT CTAATACACAAGATTCAAATGGTGAGAATTATTCTTGTCTTTTTTTCTGT ACAGGGGTGAGAAAGCTTTGTTCAACATGATCGATATTTGTTTGAATCCT GATAGTGATATCGTTGGAGGTGAAACATTTGATGTCGCCGAAGGAACCAA GTAAGTGCATTTTCATCTTTTGAAAAATACTTTAAGGGCAGAAGGTTTCG CGAAGTCAAAAAGTCGTGAAATACAGCGAATTTAAGATTCTCGAATGATG GTTTTAGCCGAAATTTCACAGATAGAACTTTCGCGAAATCGTATAAAACT TACCTTTTTTGGAAAGTTTCTGCCAGGTAAAAAATTAAACCTGAAAAACG CGAAAGTATTTTTTCGCGTAAAATAAACTTTCCTACTCAGTTTTGCACTG TTTGCTAAATTTTTGCGTGTTTTGTGAGTTTGTTTCTGCCCGCGAAAGTT TCTACCCTTAAAGTAAACGAAGTGTTAATTTTTTTTGTTTTTAACAAGCA ACGCGGCTTCTGATTGTTCAATAAGATGCGATTCTATCTGCCTATCAACC CCTTTTGTCAAAAGCTACATGGAAGAGTATTACTTCCTACTTTCCAGGGC CAAATGACTTCAAATATTTAAAATGAATTCTTTCTTCTACTAAAATTATA CATACCGTAAGCACGGGACTTTTGGTCTACCCTCGAACTTAAATCTCATT TGAAGTAAGTCTTAACAGCGAGCTCTAGTTTAACCGATCAGCTTTTTGCT CTGTCCATTCTAATTGTTGGAGTAGGCAAAAACAGTATAGGCAAAACGTT GGCAGGTTAAATCTTTACCTGAATAAGTTTGAATCGTTGACTTTCTAGAG CCATCTTTTTGCTCGCTTCAAAGACATTCTTTTTCATAATATAGAATTCA ACACTTCAAGAATATCCAAAATGAATTACTAATTATCCAGGGTTGTTCTG TCCTCGAGGATTGCCTCGAGCATTCTGGAAACCTTCTTGCAAGTATTTTG ATCGGTGGTTACCTTTTCAATTCTTTGTTTTACTTTTCTTTCTTACAGTC AATATGAAAAGCACGATACTGAACAAATGGCTATCAAGACGGCAGAAAAA TTACTGAAAGTAAGTCTTGTGGCCTTTCCTTATTTTAAATAAATTCTACT TTAGGGTAAAATGATTCAAGTAAAATTTCAAGTGCTAACTCGTGAAACAC AGGGGTTTGTTTTCCGACGATGACAAATGACTGGGATATTCCAGAAAAAT CCGTACCCCCTATGTTGAGGAAGTCCTGAATATTCTTTTGATTTTCAGGA CCACCCTAAAACTCCTCCATATACCAATACTGAACTCCCGCAGACCCTCC TGGATTTTTGGATTAAAATTCATACCCCCTGGATTTTTTATTTCCAGACC ACCCTGGACGTCACACCTCCCTTCCAGTGAGAGAGCTCTGCATTTTAGAC CTTTAATTAAAAAGACCCTAAATAAACCCATTCTTACATAACATATCATT CCTTGTTCTGGTTCTGGATAGGCCTTTTCGTAAATTTTGAGTGCAACGAC TACCTCGTTTTGAAACCATTACAAAGGTGATTAAATCTTCNATAAATTTT GAGTGAAACGACTACCTCGTTTTGAAACCATTACAAAGGTGATTAAATCT TCTAAGAACTTGTTACTTTTTTATGAATACAATGTACTTCTTATGAACTC CTCGAGGTAAGCGTTGCTTTAACGTAATCTACGAAAAGGTCTATAAGTTT CCTCCTAAGTAGTTCATCCAATCTATCTTTTGAGACGCCCCACTTTTCAT GCCATTCTCAATCTCGATAACTCTTTCACAACCAGGAGATGAAACCGAGT CGTAATCCCTTAAAACAGAAGCTGTTTGAAAATCAACTACTCGTGACCAC AAGAAACACGCAACTCGTACAAAAAGCTCTCAATAACTTGATGGAAATTG CTCAAGTTGAGGTGAGATTCTATAATGTGTCTGATATGTTTCTTGCAGAT AACTTAATACAAATTAGCAAGTTGATTGACTTAAATATTTTTTTCTCATT TAGTTATTTTTAACTGAACTATATCTGTTCCCCGGTAGGGGAATATTTGG GATCCTTATCTGTCGGGACTTTCTTTCTTTTTTTACCCTTAGCGGGATTT CGAAGGTTCGAAGGTCCTTAAAAGGCGCCCACCCCCTCCGGAATCTGCTC TTTCAGTCCTTTTCTGTTTTGCAGACCACCATACTCCATAAGATATCGTT ATCCGAACTAGAAGATGGACAGAAGCCTACTTCAAATGGTTTTATGAGAC TTTTTATACATCCTTAAAGCGTCTTTAGTTGAGCAATGATTCTTAAAAGA ATATTGAACATCAAGTACCTTTCAATATTTAGAATGACTATGTACCAGCG CTTTTGGGGATGGCCACAGCTCACATGATACTCAAACAAACACCAAAAGC CCGGAATCAACTCAAACGTATCTCCAAAATGTCATGGAACTCTGAGGTTT GTTCTGCCTTTATTTTCCATGAATTGTCATACGTTGACCATAGTCATTAT AAAAAAACACTGGTCTGGAAGGCTTTTGTTTCTTTTTATTGTCAAAAGAT ACAGCTTACGTACCAAAATCGATTTATTTTGCAAACTTTTTGATCATGTG ATTAGAAAATAGACCAATTTCAAGAGGGCATTTCGGTAACGTGATCAAAA AGTATGCAAATTGCAACTTGTCTTTTGCTTGTAACAAAAGAAAATTGAAC AAAAAGCTAAAACAATACATTGCCAGACCGGGTTTTTTTATAATAATTAT GCCTTGACGAGCTGCTAGATCCATCAGTTTTCATGACAACAATAGTGATA GAAACTAGAATTACGGCTGTACCAACTTTATGACCGAGCGTAGATACTTG ATTTGTTAGTTTCAAGTCGACTCATCTAAGTTTGACTTTGAATTCAAAAG TATTCAAATTTTATTAAAATGGTGTGCACAGTTATGTCAATTGAGGGTTA AATGGCTGATTTGCGATTTATTTGTTGACAATAAACTTTACTTTTTAGGA TGCTGAAGACTTTGAACGAAGTTGGCTTCTCCTCGCTGATATATTTATTC AGGTTAGTGAAAATTAATCAATAAGAAGATGTGCCAAGTTGCATTGCTTC ATTGCTACGTGTCTGCTCGCTCATCTAGCAAGTAACCTTATTCAAGAAAT TGAATAAAAAAAGGCAAGAAATGCTAGAAAAATTCACAAGTCTTTTCAGT GATGATATATTACTAATAAGCCTGATCTATTGCCTTAAGGAATCTTCGAC TCTGCGATTTCGAAAACGAAAAAGCGGCAATAAAAAGCACAGATGATCCA ACGTTTTGAACCTTATGAACCACTATGATGCTTATTTTTCTTCCTATTTA GAATGGGAAATACGATATGGCACAAGAACAACTCAAAAAGTGTTTGACTT ATAATAAGGTATAGTATGGTTACGTGGAAGGTTGACACTAAGTTTTACAA TCTATATGTGTGGCAGGGCAGGTGTATGCATTTCGTCCTAAGTTGGCTCG TCAGCATTGTGAACTTCATATATTGAGCCTAATATTTTATGTTCTTTACT CAGTCCACTACGAGAAAAAATAGCAAAGGCCTACTTGCTTCGATTATGTC CCGTCATATTTCTGCACTGTGCCATGAAGGGAAAACGTTTAGTTTATAGA AATCAAATGTTTCCTTAAATTCTTTTTGTAGAGTTGTGCCAAAGCATGGG AATATCTTGGTTTCATTATGGAGAAAGAACAATCATACAAAGACGCAGCA TTGAATTATGAAAACGCATGGAAATTCACCAATGAATCCAGTCCTGCTAT AGGTACTACTTATTCATTTGAAAATCTAGCGGCACTTTGAAAAGTGTTAG TTTTGACTTAAAATTTACATATGAGAGTCCGGAGAATTTCTAATCAGACA TTTCGGACTGGACTGAGTAAGCTCTATATGATTGCCCAAATTACTTATCT TCTAAAATTTTAGGTTATCGTTTGGGATTCAATTATTTGAAAGCTAAAAG ATTCGTAGATGCAATAGATGTATGTCACAAGGTAAGAAATACCGTATCTC TTCTCATCAAAAACCTGACTGAAATTTGATTGTAATTGATTTTCTAGTTT GAGTAAAGAAAACGATTTAAGTTAATTTCATACTCAAAGTTTCATGCCAT CCAGGATGGCAATCTTCAGCGAAATGATTTTCTCAATACAAGATTAGGTA TAGGTTTCGCACTTGACCAAACCTGTTTTTTTTTCGAAGGATTTTTCGAG TGGATCTATATGTCTTAAATTATGTCATTTTTTTATTAAAATTTTGAGGC TCACAGAACTTATCTGTAAAAGTCGTCTTTCGTCTCATTTTTTTTTTTTG TATAGTGAAATTCGAAGTTGCAGATCTAGAACAATAAAACTTGTTATATG AATTCATAATTAGCATTAGGCTTTTGAGAAAAAATTTGAATATGGGGGGT GAAGGATATAACATTTCTTGTAAATTTACCTCCGGACATTGTGACTTTTG ACCCCCCGGACAGCAGGTCTAACCCCCTGACACCGGACAAGCATCAATTG ACCCCTGTACATTCAAAATTACCCCCAAACAGAGCAAATTAACACCCGGA CAAGGCAAATTTTGTAGATTTTTCACTACCCCCGGACACTTTATTCCCCC CATGTACGGATATTTTCTGGAAAAGCCTATTCTGTCGATTGGAAGTGTGA AGGTTTCGATCATAGACGGTGTACCGCAGAGACTGTTCGAATCTTGGGCA GAATGTTAGGGAAGCATGTAACTGATGAACAAGAATGATTAGGGTTCTCA TTTGCTTTTGTTTTCTAGGTACTTGGTAAGCATCCCAATTATCCAAAAAT ACGTAAAGAGATTTTGGATAAAGCAAGAGCTCAGTTGCGGACGTGAAATT TGGAGACAGAGCATTGGTGAACGACCGTCATGATAAACAACCAGCTTTAT TTAAACTTTTCGACTTCTTAAAGTCGAAAGAATTCTCCATGATCACTGCA TATCGATCTGCGAGATTTCCTTTCTCAAAGATGCGTCTTAAATTTTCTGA AAATGCTATTGAACTTTCACTGGGATGGAAGCTGTAAGCATCATATTGAG GATCTCCCTCAAGCAATACCATGTGTTCCGAAAAAAAGCGGACAAATTTT TTTATATAAAGTAAAATCCACATAATTTATGCAAAATATCTCAATCTTAA AAACCTTTTCAATCGTTTTGGGAATTGAATATCTATTGATTGAGCAGAGT ATTGTCATCTTAATTCAATTATTCTAAGCTCAGGTTAGATAATGGTTTTA GCGGATTTTACTTTATATAACAATTTGTCCCCCTTTTTTTCGGACATACT GTATGTCCTGTTTTTGTAANATAACAATTTGTCCCCCTTTTTTGGGACAT ACTGTATGTCCTGTTTTTGTAAATATTTGTTTGTAAGTAAGTGAATTATA CTTCGTGTAAACTATTGATTTTAATTTGGTAATTATACATTTTTAATTGT AAGAAAGATAAATGTGTTGTACATACATTTAAAGAAGGATAT

Coding sequence (CDS) from alignment at sc0000002:1345044..1361485-

>TCONS_00000597 ID=TCONS_00000597|Name=TCONS_00000597|organism=Clytia hemisphaerica|type=CDS|length=45540bp|location=Sequence derived from alignment at sc0000002:1345044..1361485- (Clytia hemisphaerica)
GTACTTGGTAAGCATCCCAATTATCCAAAAATACGTAAAGAGATTTTGGA
TAAAGCAAGAGCTCAGTTGCGGACGTGAGTTATCGTTTGGGATTCAATTA
TTTGAAAGCTAAAAGATTCGTAGATGCAATAGATGTATGTCACAAGAGTT
GTGCCAAAGCATGGGAATATCTTGGTTTCATTATGGAGAAAGAACAATCA
TACAAAGACGCAGCATTGAATTATGAAAACGCATGGAAATTCACCAATGA
ATCCAGTCCTGCTATAGAATGGGAAATACGATATGGCACAAGAACAACTC
AAAAAGTGTTTGACTTATAATAAGGATGCTGAAGACTTTGAACGAAGTTG
GCTTCTCCTCGCTGATATATTTATTCAGAATGACTATGTACCAGCGCTTT
TGGGGATGGCCACAGCTCACATGATACTCAAACAAACACCAAAAGCCCGG
AATCAACTCAAACGTATCTCCAAAATGTCATGGAACTCTGAGGAGATGAA
ACCGAGTCGTAATCCCTTAAAACAGAAGCTGTTTGAAAATCAACTACTCG
TGACCACAAGAAACACGCAACTCGTACAAAAAGCTCTCAATAACTTGATG
GAAATTGCTCAAGTTGAGTCAATATGAAAAGCACGATACTGAACAAATGG
CTATCAAGACGGCAGAAAAATTACTGAAAGGGTGAGAAAGCTTTGTTCAA
CATGATCGATATTTGTTTGAATCCTGATAGTGATATCGTTGGAGGTGAAA
CATTTGATGTCGCCGAAGGAACCAAGTACCAAAACAATGCTTCGTCTGCA
CTCAAATTTTTCAATCTTGCTCGCAAAGATAGTTTATGGCTCTTGCAAGC
AACCCACGTGCCCAAATGGAAGCTGGCTACAATTATTGCAAAGGTTTATA
TGAATGGTTATTATGATGCACTTGCCAAACTTGTCGAACTTTTACGTCGT
GCTGGAAAGCTGGAAGATGGACCAAAATACTTAGATCAGATGATGGCAGA
CTTGCTGTTCCGCAAGGGAGAGTACGATTCTGCTACTTTCCATTTCCAAG
AAATACTCAGTAGAAAACCAATACATTCTTGCATTGGCTGAGTTGTATCT
TTTGAATCAAGATCTCGATGCTTGCCAATCACAACTACAAACCATTCTCA
AGAATAATAAAGATTGCGATCGAGCTACTCTGGGTTTCTTACAACATCGG
TCAATACTATTACAATGGAAAGGACTTCGATCGAGCCATCAAGTCGTATA
AAGAAGCGACTTACTTCAATGAATCTGAAATAACGGGTTATCAAGAGAGT
GGCCACAGAACAACCAGATGATTTACAAGAACACAAAGCTCTAGCAGCAA
ACAACTGCACTATCTCGTAGCATCGAGGAGGCTCGTTGTCAATTCTTGTT
GGCTCAGATTTATCAAAAGACTAAAGAGTCCGAAGAAATTCTCGAAGCTT
ATTTGAAAGCCAAAGAATTGCAATCAAAATTCGACCTTGCTGAACTTCAC
ATGAAGCTTGGAAACTTTGAGAAGGCGGAACGAATATTGAAACAAACCTT
GTTGAAAAATGAAACAAGCAATCAGTTACTATGAAGCAGCAGTGAGAGCT
GGTAACCATGTTCTAAGCCTGAGAAAGCAATTGAGGTTTACGAAAGCGCT
TTGAAGAAGAACCCCAAGGACTATTCATTACAAATGAAGATCGGTCAAGC
ATTTATCAAGACTCATCAATACGCTAAAGGAACTGGTAGAGAAGATGCCA
ACTTCTGAATCTTTTCTCCTTCTCGGAGATGCGTACATGAGCATCATGGA
GCTATTTCATTCAAGCGAGAGAGAAGATGGCGGAAATTTACTTGAAATAT
CGTAAGGACAAACGGCTGTATGTTAGTGTCTACAGAACAGGGTGATGATT
TCCAATGCTGACTTTTCATTGAGTCGCGGAGACATCGAACAAGCTCTTGA
AATGTTACGCAAAATTACTCCTGATCAAAGGTACTTGGTAAGCATCCCAA
TTATCCAAAAATACGTAAAGAGATTTTGGATAAAGCAAGAGCTCAGTTGC
GGACGTGAGTTATCGTTTGGGATTCAATTATTTGAAAGCTAAAAGATTCG
TAGATGCAATAGATGTATGTCACAAGAGTTGTGCCAAAGCATGGGAATAT
CTTGGTTTCATTATGGAGAAAGAACAATCATACAAAGACGCAGCATTGAA
TTATGAAAACGCATGGAAATTCACCAATGAATCCAGTCCTGCTATAGAAT
GGGAAATACGATATGGCACAAGAACAACTCAAAAAGTGTTTGACTTATAA
TAAGGATGCTGAAGACTTTGAACGAAGTTGGCTTCTCCTCGCTGATATAT
TTATTCAGAATGACTATGTACCAGCGCTTTTGGGGATGGCCACAGCTCAC
ATGATACTCAAACAAACACCAAAAGCCCGGAATCAACTCAAACGTATCTC
CAAAATGTCATGGAACTCTGAGGAGATGAAACCGAGTCGTAATCCCTTAA
AACAGAAGCTGTTTGAAAATCAACTACTCGTGACCACAAGAAACACGCAA
CTCGTACAAAAAGCTCTCAATAACTTGATGGAAATTGCTCAAGTTGAGTC
AATATGAAAAGCACGATACTGAACAAATGGCTATCAAGACGGCAGAAAAA
TTACTGAAAGGGTGAGAAAGCTTTGTTCAACATGATCGATATTTGTTTGA
ATCCTGATAGTGATATCGTTGGAGGTGAAACATTTGATGTCGCCGAAGGA
ACCAAGTACCAAAACAATGCTTCGTCTGCACTCAAATTTTTCAATCTTGC
TCGCAAAGATAGTTTATGGCTCTTGCAAGCAACCCACGTGCCCAAATGGA
AGCTGGCTACAATTATTGCAAAGGTTTATATGAATGGTTATTATGATGCA
CTTGCCAAACTTGTCGAACTTTTACGTCGTGCTGGAAAGCTGGAAGATGG
ACCAAAATACTTAGATCAGATGATGGCAGACTTGCTGTTCCGCAAGGGAG
AGTACGATTCTGCTACTTTCCATTTCCAAGAAATACTCAGTAGAAAACCA
ATACATTCTTGCATTGGCTGAGTTGTATCTTTTGAATCAAGATCTCGATG
CTTGCCAATCACAACTACAAACCATTCTCAAGAATAATAAAGATTGCGAT
CGAGCTACTCTGGGTTTCTTACAACATCGGTCAATACTATTACAATGGAA
AGGACTTCGATCGAGCCATCAAGTCGTATAAAGAAGCGACTTACTTCAAT
GAATCTGAAATAACGGGTTATCAAGAGAGTGGCCACAGAACAACCAGATG
ATTTACAAGAACACAAAGCTCTAGCAGCAAACAACTGCACTATCTCGTAG
CATCGAGGAGGCTCGTTGTCAATTCTTGTTGGCTCAGATTTATCAAAAGA
CTAAAGAGTCCGAAGAAATTCTCGAAGCTTATTTGAAAGCCAAAGAATTG
CAATCAAAATTCGACCTTGCTGAACTTCACATGAAGCTTGGAAACTTTGA
GAAGGCGGAACGAATATTGAAACAAACCTTGTTGAAAAATGAAACAAGCA
ATCAGTTACTATGAAGCAGCAGTGAGAGCTGGTAACCATGTTCTAAGCCT
GAGAAAGCAATTGAGGTTTACGAAAGCGCTTTGAAGAAGAACCCCAAGGA
CTATTCATTACAAATGAAGATCGGTCAAGCATTTATCAAGACTCATCAAT
ACGCTAAAGGAACTGGTAGAGAAGATGCCAACTTCTGAATCTTTTCTCCT
TCTCGGAGATGCGTACATGAGCATCATGGAGCTATTTCATTCAAGCGAGA
GAGAAGATGGCGGAAATTTACTTGAAATATCGTAAGGACAAACGGCTGTA
TGTTAGTGTCTACAGAACAGGGTGATGATTTCCAATGCTGACTTTTCATT
GAGTCGCGGAGACATCGAACAAGCTCTTGAAATGTTACGCAAAATTACTC
CTGATCAAAGGTACTTGGTAAGCATCCCAATTATCCAAAAATACGTAAAG
AGATTTTGGATAAAGCAAGAGCTCAGTTGCGGACGTGAGTTATCGTTTGG
GATTCAATTATTTGAAAGCTAAAAGATTCGTAGATGCAATAGATGTATGT
CACAAGAGTTGTGCCAAAGCATGGGAATATCTTGGTTTCATTATGGAGAA
AGAACAATCATACAAAGACGCAGCATTGAATTATGAAAACGCATGGAAAT
TCACCAATGAATCCAGTCCTGCTATAGAATGGGAAATACGATATGGCACA
AGAACAACTCAAAAAGTGTTTGACTTATAATAAGGATGCTGAAGACTTTG
AACGAAGTTGGCTTCTCCTCGCTGATATATTTATTCAGAATGACTATGTA
CCAGCGCTTTTGGGGATGGCCACAGCTCACATGATACTCAAACAAACACC
AAAAGCCCGGAATCAACTCAAACGTATCTCCAAAATGTCATGGAACTCTG
AGGAGATGAAACCGAGTCGTAATCCCTTAAAACAGAAGCTGTTTGAAAAT
CAACTACTCGTGACCACAAGAAACACGCAACTCGTACAAAAAGCTCTCAA
TAACTTGATGGAAATTGCTCAAGTTGAGTCAATATGAAAAGCACGATACT
GAACAAATGGCTATCAAGACGGCAGAAAAATTACTGAAAGGGTGAGAAAG
CTTTGTTCAACATGATCGATATTTGTTTGAATCCTGATAGTGATATCGTT
GGAGGTGAAACATTTGATGTCGCCGAAGGAACCAAGTACCAAAACAATGC
TTCGTCTGCACTCAAATTTTTCAATCTTGCTCGCAAAGATAGTTTATGGC
TCTTGCAAGCAACCCACGTGCCCAAATGGAAGCTGGCTACAATTATTGCA
AAGGTTTATATGAATGGTTATTATGATGCACTTGCCAAACTTGTCGAACT
TTTACGTCGTGCTGGAAAGCTGGAAGATGGACCAAAATACTTAGATCAGA
TGATGGCAGACTTGCTGTTCCGCAAGGGAGAGTACGATTCTGCTACTTTC
CATTTCCAAGAAATACTCAGTAGAAAACCAATACATTCTTGCATTGGCTG
AGTTGTATCTTTTGAATCAAGATCTCGATGCTTGCCAATCACAACTACAA
ACCATTCTCAAGAATAATAAAGATTGCGATCGAGCTACTCTGGGTTTCTT
ACAACATCGGTCAATACTATTACAATGGAAAGGACTTCGATCGAGCCATC
AAGTCGTATAAAGAAGCGACTTACTTCAATGAATCTGAAATAACGGGTTA
TCAAGAGAGTGGCCACAGAACAACCAGATGATTTACAAGAACACAAAGCT
CTAGCAGCAAACAACTGCACTATCTCGTAGCATCGAGGAGGCTCGTTGTC
AATTCTTGTTGGCTCAGATTTATCAAAAGACTAAAGAGTCCGAAGAAATT
CTCGAAGCTTATTTGAAAGCCAAAGAATTGCAATCAAAATTCGACCTTGC
TGAACTTCACATGAAGCTTGGAAACTTTGAGAAGGCGGAACGAATATTGA
AACAAACCTTGTTGAAAAATGAAACAAGCAATCAGTTACTATGAAGCAGC
AGTGAGAGCTGGTAACCATGTTCTAAGCCTGAGAAAGCAATTGAGGTTTA
CGAAAGCGCTTTGAAGAAGAACCCCAAGGACTATTCATTACAAATGAAGA
TCGGTCAAGCATTTATCAAGACTCATCAATACGCTAAAGGAACTGGTAGA
GAAGATGCCAACTTCTGAATCTTTTCTCCTTCTCGGAGATGCGTACATGA
GCATCATGGAGCTATTTCATTCAAGCGAGAGAGAAGATGGCGGAAATTTA
CTTGAAATATCGTAAGGACAAACGGCTGTATGTTAGTGTCTACAGAACAG
GGTGATGATTTCCAATGCTGACTTTTCATTGAGTCGCGGAGACATCGAAC
AAGCTCTTGAAATGTTACGCAAAATTACTCCTGATCAAAGGTACTTGGTA
AGCATCCCAATTATCCAAAAATACGTAAAGAGATTTTGGATAAAGCAAGA
GCTCAGTTGCGGACGTGAGTTATCGTTTGGGATTCAATTATTTGAAAGCT
AAAAGATTCGTAGATGCAATAGATGTATGTCACAAGAGTTGTGCCAAAGC
ATGGGAATATCTTGGTTTCATTATGGAGAAAGAACAATCATACAAAGACG
CAGCATTGAATTATGAAAACGCATGGAAATTCACCAATGAATCCAGTCCT
GCTATAGAATGGGAAATACGATATGGCACAAGAACAACTCAAAAAGTGTT
TGACTTATAATAAGGATGCTGAAGACTTTGAACGAAGTTGGCTTCTCCTC
GCTGATATATTTATTCAGAATGACTATGTACCAGCGCTTTTGGGGATGGC
CACAGCTCACATGATACTCAAACAAACACCAAAAGCCCGGAATCAACTCA
AACGTATCTCCAAAATGTCATGGAACTCTGAGGAGATGAAACCGAGTCGT
AATCCCTTAAAACAGAAGCTGTTTGAAAATCAACTACTCGTGACCACAAG
AAACACGCAACTCGTACAAAAAGCTCTCAATAACTTGATGGAAATTGCTC
AAGTTGAGTCAATATGAAAAGCACGATACTGAACAAATGGCTATCAAGAC
GGCAGAAAAATTACTGAAAGGGTGAGAAAGCTTTGTTCAACATGATCGAT
ATTTGTTTGAATCCTGATAGTGATATCGTTGGAGGTGAAACATTTGATGT
CGCCGAAGGAACCAAGTACCAAAACAATGCTTCGTCTGCACTCAAATTTT
TCAATCTTGCTCGCAAAGATAGTTTATGGCTCTTGCAAGCAACCCACGTG
CCCAAATGGAAGCTGGCTACAATTATTGCAAAGGTTTATATGAATGGTTA
TTATGATGCACTTGCCAAACTTGTCGAACTTTTACGTCGTGCTGGAAAGC
TGGAAGATGGACCAAAATACTTAGATCAGATGATGGCAGACTTGCTGTTC
CGCAAGGGAGAGTACGATTCTGCTACTTTCCATTTCCAAGAAATACTCAG
TAGAAAACCAATACATTCTTGCATTGGCTGAGTTGTATCTTTTGAATCAA
GATCTCGATGCTTGCCAATCACAACTACAAACCATTCTCAAGAATAATAA
AGATTGCGATCGAGCTACTCTGGGTTTCTTACAACATCGGTCAATACTAT
TACAATGGAAAGGACTTCGATCGAGCCATCAAGTCGTATAAAGAAGCGAC
TTACTTCAATGAATCTGAAATAACGGGTTATCAAGAGAGTGGCCACAGAA
CAACCAGATGATTTACAAGAACACAAAGCTCTAGCAGCAAACAACTGCAC
TATCTCGTAGCATCGAGGAGGCTCGTTGTCAATTCTTGTTGGCTCAGATT
TATCAAAAGACTAAAGAGTCCGAAGAAATTCTCGAAGCTTATTTGAAAGC
CAAAGAATTGCAATCAAAATTCGACCTTGCTGAACTTCACATGAAGCTTG
GAAACTTTGAGAAGGCGGAACGAATATTGAAACAAACCTTGTTGAAAAAT
GAAACAAGCAATCAGTTACTATGAAGCAGCAGTGAGAGCTGGTAACCATG
TTCTAAGCCTGAGAAAGCAATTGAGGTTTACGAAAGCGCTTTGAAGAAGA
ACCCCAAGGACTATTCATTACAAATGAAGATCGGTCAAGCATTTATCAAG
ACTCATCAATACGCTAAAGGAACTGGTAGAGAAGATGCCAACTTCTGAAT
CTTTTCTCCTTCTCGGAGATGCGTACATGAGCATCATGGAGCTATTTCAT
TCAAGCGAGAGAGAAGATGGCGGAAATTTACTTGAAATATCGTAAGGACA
AACGGCTGTATGTTAGTGTCTACAGAACAGGGTGATGATTTCCAATGCTG
ACTTTTCATTGAGTCGCGGAGACATCGAACAAGCTCTTGAAATGTTACGC
AAAATTACTCCTGATCAAAGGTACTTGGTAAGCATCCCAATTATCCAAAA
ATACGTAAAGAGATTTTGGATAAAGCAAGAGCTCAGTTGCGGACGTGAGT
TATCGTTTGGGATTCAATTATTTGAAAGCTAAAAGATTCGTAGATGCAAT
AGATGTATGTCACAAGAGTTGTGCCAAAGCATGGGAATATCTTGGTTTCA
TTATGGAGAAAGAACAATCATACAAAGACGCAGCATTGAATTATGAAAAC
GCATGGAAATTCACCAATGAATCCAGTCCTGCTATAGAATGGGAAATACG
ATATGGCACAAGAACAACTCAAAAAGTGTTTGACTTATAATAAGGATGCT
GAAGACTTTGAACGAAGTTGGCTTCTCCTCGCTGATATATTTATTCAGAA
TGACTATGTACCAGCGCTTTTGGGGATGGCCACAGCTCACATGATACTCA
AACAAACACCAAAAGCCCGGAATCAACTCAAACGTATCTCCAAAATGTCA
TGGAACTCTGAGGAGATGAAACCGAGTCGTAATCCCTTAAAACAGAAGCT
GTTTGAAAATCAACTACTCGTGACCACAAGAAACACGCAACTCGTACAAA
AAGCTCTCAATAACTTGATGGAAATTGCTCAAGTTGAGTCAATATGAAAA
GCACGATACTGAACAAATGGCTATCAAGACGGCAGAAAAATTACTGAAAG
GGTGAGAAAGCTTTGTTCAACATGATCGATATTTGTTTGAATCCTGATAG
TGATATCGTTGGAGGTGAAACATTTGATGTCGCCGAAGGAACCAAGTACC
AAAACAATGCTTCGTCTGCACTCAAATTTTTCAATCTTGCTCGCAAAGAT
AGTTTATGGCTCTTGCAAGCAACCCACGTGCCCAAATGGAAGCTGGCTAC
AATTATTGCAAAGGTTTATATGAATGGTTATTATGATGCACTTGCCAAAC
TTGTCGAACTTTTACGTCGTGCTGGAAAGCTGGAAGATGGACCAAAATAC
TTAGATCAGATGATGGCAGACTTGCTGTTCCGCAAGGGAGAGTACGATTC
TGCTACTTTCCATTTCCAAGAAATACTCAGTAGAAAACCAATACATTCTT
GCATTGGCTGAGTTGTATCTTTTGAATCAAGATCTCGATGCTTGCCAATC
ACAACTACAAACCATTCTCAAGAATAATAAAGATTGCGATCGAGCTACTC
TGGGTTTCTTACAACATCGGTCAATACTATTACAATGGAAAGGACTTCGA
TCGAGCCATCAAGTCGTATAAAGAAGCGACTTACTTCAATGAATCTGAAA
TAACGGGTTATCAAGAGAGTGGCCACAGAACAACCAGATGATTTACAAGA
ACACAAAGCTCTAGCAGCAAACAACTGCACTATCTCGTAGCATCGAGGAG
GCTCGTTGTCAATTCTTGTTGGCTCAGATTTATCAAAAGACTAAAGAGTC
CGAAGAAATTCTCGAAGCTTATTTGAAAGCCAAAGAATTGCAATCAAAAT
TCGACCTTGCTGAACTTCACATGAAGCTTGGAAACTTTGAGAAGGCGGAA
CGAATATTGAAACAAACCTTGTTGAAAAATGAAACAAGCAATCAGTTACT
ATGAAGCAGCAGTGAGAGCTGGTAACCATGTTCTAAGCCTGAGAAAGCAA
TTGAGGTTTACGAAAGCGCTTTGAAGAAGAACCCCAAGGACTATTCATTA
CAAATGAAGATCGGTCAAGCATTTATCAAGACTCATCAATACGCTAAAGG
AACTGGTAGAGAAGATGCCAACTTCTGAATCTTTTCTCCTTCTCGGAGAT
GCGTACATGAGCATCATGGAGCTATTTCATTCAAGCGAGAGAGAAGATGG
CGGAAATTTACTTGAAATATCGTAAGGACAAACGGCTGTATGTTAGTGTC
TACAGAACAGGGTGATGATTTCCAATGCTGACTTTTCATTGAGTCGCGGA
GACATCGAACAAGCTCTTGAAATGTTACGCAAAATTACTCCTGATCAAAG
GTACTTGGTAAGCATCCCAATTATCCAAAAATACGTAAAGAGATTTTGGA
TAAAGCAAGAGCTCAGTTGCGGACGTGAGTTATCGTTTGGGATTCAATTA
TTTGAAAGCTAAAAGATTCGTAGATGCAATAGATGTATGTCACAAGAGTT
GTGCCAAAGCATGGGAATATCTTGGTTTCATTATGGAGAAAGAACAATCA
TACAAAGACGCAGCATTGAATTATGAAAACGCATGGAAATTCACCAATGA
ATCCAGTCCTGCTATAGAATGGGAAATACGATATGGCACAAGAACAACTC
AAAAAGTGTTTGACTTATAATAAGGATGCTGAAGACTTTGAACGAAGTTG
GCTTCTCCTCGCTGATATATTTATTCAGAATGACTATGTACCAGCGCTTT
TGGGGATGGCCACAGCTCACATGATACTCAAACAAACACCAAAAGCCCGG
AATCAACTCAAACGTATCTCCAAAATGTCATGGAACTCTGAGGAGATGAA
ACCGAGTCGTAATCCCTTAAAACAGAAGCTGTTTGAAAATCAACTACTCG
TGACCACAAGAAACACGCAACTCGTACAAAAAGCTCTCAATAACTTGATG
GAAATTGCTCAAGTTGAGTCAATATGAAAAGCACGATACTGAACAAATGG
CTATCAAGACGGCAGAAAAATTACTGAAAGGGTGAGAAAGCTTTGTTCAA
CATGATCGATATTTGTTTGAATCCTGATAGTGATATCGTTGGAGGTGAAA
CATTTGATGTCGCCGAAGGAACCAAGTACCAAAACAATGCTTCGTCTGCA
CTCAAATTTTTCAATCTTGCTCGCAAAGATAGTTTATGGCTCTTGCAAGC
AACCCACGTGCCCAAATGGAAGCTGGCTACAATTATTGCAAAGGTTTATA
TGAATGGTTATTATGATGCACTTGCCAAACTTGTCGAACTTTTACGTCGT
GCTGGAAAGCTGGAAGATGGACCAAAATACTTAGATCAGATGATGGCAGA
CTTGCTGTTCCGCAAGGGAGAGTACGATTCTGCTACTTTCCATTTCCAAG
AAATACTCAGTAGAAAACCAATACATTCTTGCATTGGCTGAGTTGTATCT
TTTGAATCAAGATCTCGATGCTTGCCAATCACAACTACAAACCATTCTCA
AGAATAATAAAGATTGCGATCGAGCTACTCTGGGTTTCTTACAACATCGG
TCAATACTATTACAATGGAAAGGACTTCGATCGAGCCATCAAGTCGTATA
AAGAAGCGACTTACTTCAATGAATCTGAAATAACGGGTTATCAAGAGAGT
GGCCACAGAACAACCAGATGATTTACAAGAACACAAAGCTCTAGCAGCAA
ACAACTGCACTATCTCGTAGCATCGAGGAGGCTCGTTGTCAATTCTTGTT
GGCTCAGATTTATCAAAAGACTAAAGAGTCCGAAGAAATTCTCGAAGCTT
ATTTGAAAGCCAAAGAATTGCAATCAAAATTCGACCTTGCTGAACTTCAC
ATGAAGCTTGGAAACTTTGAGAAGGCGGAACGAATATTGAAACAAACCTT
GTTGAAAAATGAAACAAGCAATCAGTTACTATGAAGCAGCAGTGAGAGCT
GGTAACCATGTTCTAAGCCTGAGAAAGCAATTGAGGTTTACGAAAGCGCT
TTGAAGAAGAACCCCAAGGACTATTCATTACAAATGAAGATCGGTCAAGC
ATTTATCAAGACTCATCAATACGCTAAAGGAACTGGTAGAGAAGATGCCA
ACTTCTGAATCTTTTCTCCTTCTCGGAGATGCGTACATGAGCATCATGGA
GCTATTTCATTCAAGCGAGAGAGAAGATGGCGGAAATTTACTTGAAATAT
CGTAAGGACAAACGGCTGTATGTTAGTGTCTACAGAACAGGGTGATGATT
TCCAATGCTGACTTTTCATTGAGTCGCGGAGACATCGAACAAGCTCTTGA
AATGTTACGCAAAATTACTCCTGATCAAAGGTACTTGGTAAGCATCCCAA
TTATCCAAAAATACGTAAAGAGATTTTGGATAAAGCAAGAGCTCAGTTGC
GGACGTGAGTTATCGTTTGGGATTCAATTATTTGAAAGCTAAAAGATTCG
TAGATGCAATAGATGTATGTCACAAGAGTTGTGCCAAAGCATGGGAATAT
CTTGGTTTCATTATGGAGAAAGAACAATCATACAAAGACGCAGCATTGAA
TTATGAAAACGCATGGAAATTCACCAATGAATCCAGTCCTGCTATAGAAT
GGGAAATACGATATGGCACAAGAACAACTCAAAAAGTGTTTGACTTATAA
TAAGGATGCTGAAGACTTTGAACGAAGTTGGCTTCTCCTCGCTGATATAT
TTATTCAGAATGACTATGTACCAGCGCTTTTGGGGATGGCCACAGCTCAC
ATGATACTCAAACAAACACCAAAAGCCCGGAATCAACTCAAACGTATCTC
CAAAATGTCATGGAACTCTGAGGAGATGAAACCGAGTCGTAATCCCTTAA
AACAGAAGCTGTTTGAAAATCAACTACTCGTGACCACAAGAAACACGCAA
CTCGTACAAAAAGCTCTCAATAACTTGATGGAAATTGCTCAAGTTGAGTC
AATATGAAAAGCACGATACTGAACAAATGGCTATCAAGACGGCAGAAAAA
TTACTGAAAGGGTGAGAAAGCTTTGTTCAACATGATCGATATTTGTTTGA
ATCCTGATAGTGATATCGTTGGAGGTGAAACATTTGATGTCGCCGAAGGA
ACCAAGTACCAAAACAATGCTTCGTCTGCACTCAAATTTTTCAATCTTGC
TCGCAAAGATAGTTTATGGCTCTTGCAAGCAACCCACGTGCCCAAATGGA
AGCTGGCTACAATTATTGCAAAGGTTTATATGAATGGTTATTATGATGCA
CTTGCCAAACTTGTCGAACTTTTACGTCGTGCTGGAAAGCTGGAAGATGG
ACCAAAATACTTAGATCAGATGATGGCAGACTTGCTGTTCCGCAAGGGAG
AGTACGATTCTGCTACTTTCCATTTCCAAGAAATACTCAGTAGAAAACCA
ATACATTCTTGCATTGGCTGAGTTGTATCTTTTGAATCAAGATCTCGATG
CTTGCCAATCACAACTACAAACCATTCTCAAGAATAATAAAGATTGCGAT
CGAGCTACTCTGGGTTTCTTACAACATCGGTCAATACTATTACAATGGAA
AGGACTTCGATCGAGCCATCAAGTCGTATAAAGAAGCGACTTACTTCAAT
GAATCTGAAATAACGGGTTATCAAGAGAGTGGCCACAGAACAACCAGATG
ATTTACAAGAACACAAAGCTCTAGCAGCAAACAACTGCACTATCTCGTAG
CATCGAGGAGGCTCGTTGTCAATTCTTGTTGGCTCAGATTTATCAAAAGA
CTAAAGAGTCCGAAGAAATTCTCGAAGCTTATTTGAAAGCCAAAGAATTG
CAATCAAAATTCGACCTTGCTGAACTTCACATGAAGCTTGGAAACTTTGA
GAAGGCGGAACGAATATTGAAACAAACCTTGTTGAAAAATGAAACAAGCA
ATCAGTTACTATGAAGCAGCAGTGAGAGCTGGTAACCATGTTCTAAGCCT
GAGAAAGCAATTGAGGTTTACGAAAGCGCTTTGAAGAAGAACCCCAAGGA
CTATTCATTACAAATGAAGATCGGTCAAGCATTTATCAAGACTCATCAAT
ACGCTAAAGGAACTGGTAGAGAAGATGCCAACTTCTGAATCTTTTCTCCT
TCTCGGAGATGCGTACATGAGCATCATGGAGCTATTTCATTCAAGCGAGA
GAGAAGATGGCGGAAATTTACTTGAAATATCGTAAGGACAAACGGCTGTA
TGTTAGTGTCTACAGAACAGGGTGATGATTTCCAATGCTGACTTTTCATT
GAGTCGCGGAGACATCGAACAAGCTCTTGAAATGTTACGCAAAATTACTC
CTGATCAAAGGTACTTGGTAAGCATCCCAATTATCCAAAAATACGTAAAG
AGATTTTGGATAAAGCAAGAGCTCAGTTGCGGACGTGAGTTATCGTTTGG
GATTCAATTATTTGAAAGCTAAAAGATTCGTAGATGCAATAGATGTATGT
CACAAGAGTTGTGCCAAAGCATGGGAATATCTTGGTTTCATTATGGAGAA
AGAACAATCATACAAAGACGCAGCATTGAATTATGAAAACGCATGGAAAT
TCACCAATGAATCCAGTCCTGCTATAGAATGGGAAATACGATATGGCACA
AGAACAACTCAAAAAGTGTTTGACTTATAATAAGGATGCTGAAGACTTTG
AACGAAGTTGGCTTCTCCTCGCTGATATATTTATTCAGAATGACTATGTA
CCAGCGCTTTTGGGGATGGCCACAGCTCACATGATACTCAAACAAACACC
AAAAGCCCGGAATCAACTCAAACGTATCTCCAAAATGTCATGGAACTCTG
AGGAGATGAAACCGAGTCGTAATCCCTTAAAACAGAAGCTGTTTGAAAAT
CAACTACTCGTGACCACAAGAAACACGCAACTCGTACAAAAAGCTCTCAA
TAACTTGATGGAAATTGCTCAAGTTGAGTCAATATGAAAAGCACGATACT
GAACAAATGGCTATCAAGACGGCAGAAAAATTACTGAAAGGGTGAGAAAG
CTTTGTTCAACATGATCGATATTTGTTTGAATCCTGATAGTGATATCGTT
GGAGGTGAAACATTTGATGTCGCCGAAGGAACCAAGTACCAAAACAATGC
TTCGTCTGCACTCAAATTTTTCAATCTTGCTCGCAAAGATAGTTTATGGC
TCTTGCAAGCAACCCACGTGCCCAAATGGAAGCTGGCTACAATTATTGCA
AAGGTTTATATGAATGGTTATTATGATGCACTTGCCAAACTTGTCGAACT
TTTACGTCGTGCTGGAAAGCTGGAAGATGGACCAAAATACTTAGATCAGA
TGATGGCAGACTTGCTGTTCCGCAAGGGAGAGTACGATTCTGCTACTTTC
CATTTCCAAGAAATACTCAGTAGAAAACCAATACATTCTTGCATTGGCTG
AGTTGTATCTTTTGAATCAAGATCTCGATGCTTGCCAATCACAACTACAA
ACCATTCTCAAGAATAATAAAGATTGCGATCGAGCTACTCTGGGTTTCTT
ACAACATCGGTCAATACTATTACAATGGAAAGGACTTCGATCGAGCCATC
AAGTCGTATAAAGAAGCGACTTACTTCAATGAATCTGAAATAACGGGTTA
TCAAGAGAGTGGCCACAGAACAACCAGATGATTTACAAGAACACAAAGCT
CTAGCAGCAAACAACTGCACTATCTCGTAGCATCGAGGAGGCTCGTTGTC
AATTCTTGTTGGCTCAGATTTATCAAAAGACTAAAGAGTCCGAAGAAATT
CTCGAAGCTTATTTGAAAGCCAAAGAATTGCAATCAAAATTCGACCTTGC
TGAACTTCACATGAAGCTTGGAAACTTTGAGAAGGCGGAACGAATATTGA
AACAAACCTTGTTGAAAAATGAAACAAGCAATCAGTTACTATGAAGCAGC
AGTGAGAGCTGGTAACCATGTTCTAAGCCTGAGAAAGCAATTGAGGTTTA
CGAAAGCGCTTTGAAGAAGAACCCCAAGGACTATTCATTACAAATGAAGA
TCGGTCAAGCATTTATCAAGACTCATCAATACGCTAAAGGAACTGGTAGA
GAAGATGCCAACTTCTGAATCTTTTCTCCTTCTCGGAGATGCGTACATGA
GCATCATGGAGCTATTTCATTCAAGCGAGAGAGAAGATGGCGGAAATTTA
CTTGAAATATCGTAAGGACAAACGGCTGTATGTTAGTGTCTACAGAACAG
GGTGATGATTTCCAATGCTGACTTTTCATTGAGTCGCGGAGACATCGAAC
AAGCTCTTGAAATGTTACGCAAAATTACTCCTGATCAAAGGTACTTGGTA
AGCATCCCAATTATCCAAAAATACGTAAAGAGATTTTGGATAAAGCAAGA
GCTCAGTTGCGGACGTGAGTTATCGTTTGGGATTCAATTATTTGAAAGCT
AAAAGATTCGTAGATGCAATAGATGTATGTCACAAGAGTTGTGCCAAAGC
ATGGGAATATCTTGGTTTCATTATGGAGAAAGAACAATCATACAAAGACG
CAGCATTGAATTATGAAAACGCATGGAAATTCACCAATGAATCCAGTCCT
GCTATAGAATGGGAAATACGATATGGCACAAGAACAACTCAAAAAGTGTT
TGACTTATAATAAGGATGCTGAAGACTTTGAACGAAGTTGGCTTCTCCTC
GCTGATATATTTATTCAGAATGACTATGTACCAGCGCTTTTGGGGATGGC
CACAGCTCACATGATACTCAAACAAACACCAAAAGCCCGGAATCAACTCA
AACGTATCTCCAAAATGTCATGGAACTCTGAGGAGATGAAACCGAGTCGT
AATCCCTTAAAACAGAAGCTGTTTGAAAATCAACTACTCGTGACCACAAG
AAACACGCAACTCGTACAAAAAGCTCTCAATAACTTGATGGAAATTGCTC
AAGTTGAGTCAATATGAAAAGCACGATACTGAACAAATGGCTATCAAGAC
GGCAGAAAAATTACTGAAAGGGTGAGAAAGCTTTGTTCAACATGATCGAT
ATTTGTTTGAATCCTGATAGTGATATCGTTGGAGGTGAAACATTTGATGT
CGCCGAAGGAACCAAGTACCAAAACAATGCTTCGTCTGCACTCAAATTTT
TCAATCTTGCTCGCAAAGATAGTTTATGGCTCTTGCAAGCAACCCACGTG
CCCAAATGGAAGCTGGCTACAATTATTGCAAAGGTTTATATGAATGGTTA
TTATGATGCACTTGCCAAACTTGTCGAACTTTTACGTCGTGCTGGAAAGC
TGGAAGATGGACCAAAATACTTAGATCAGATGATGGCAGACTTGCTGTTC
CGCAAGGGAGAGTACGATTCTGCTACTTTCCATTTCCAAGAAATACTCAG
TAGAAAACCAATACATTCTTGCATTGGCTGAGTTGTATCTTTTGAATCAA
GATCTCGATGCTTGCCAATCACAACTACAAACCATTCTCAAGAATAATAA
AGATTGCGATCGAGCTACTCTGGGTTTCTTACAACATCGGTCAATACTAT
TACAATGGAAAGGACTTCGATCGAGCCATCAAGTCGTATAAAGAAGCGAC
TTACTTCAATGAATCTGAAATAACGGGTTATCAAGAGAGTGGCCACAGAA
CAACCAGATGATTTACAAGAACACAAAGCTCTAGCAGCAAACAACTGCAC
TATCTCGTAGCATCGAGGAGGCTCGTTGTCAATTCTTGTTGGCTCAGATT
TATCAAAAGACTAAAGAGTCCGAAGAAATTCTCGAAGCTTATTTGAAAGC
CAAAGAATTGCAATCAAAATTCGACCTTGCTGAACTTCACATGAAGCTTG
GAAACTTTGAGAAGGCGGAACGAATATTGAAACAAACCTTGTTGAAAAAT
GAAACAAGCAATCAGTTACTATGAAGCAGCAGTGAGAGCTGGTAACCATG
TTCTAAGCCTGAGAAAGCAATTGAGGTTTACGAAAGCGCTTTGAAGAAGA
ACCCCAAGGACTATTCATTACAAATGAAGATCGGTCAAGCATTTATCAAG
ACTCATCAATACGCTAAAGGAACTGGTAGAGAAGATGCCAACTTCTGAAT
CTTTTCTCCTTCTCGGAGATGCGTACATGAGCATCATGGAGCTATTTCAT
TCAAGCGAGAGAGAAGATGGCGGAAATTTACTTGAAATATCGTAAGGACA
AACGGCTGTATGTTAGTGTCTACAGAACAGGGTGATGATTTCCAATGCTG
ACTTTTCATTGAGTCGCGGAGACATCGAACAAGCTCTTGAAATGTTACGC
AAAATTACTCCTGATCAAAGGTACTTGGTAAGCATCCCAATTATCCAAAA
ATACGTAAAGAGATTTTGGATAAAGCAAGAGCTCAGTTGCGGACGTGAGT
TATCGTTTGGGATTCAATTATTTGAAAGCTAAAAGATTCGTAGATGCAAT
AGATGTATGTCACAAGAGTTGTGCCAAAGCATGGGAATATCTTGGTTTCA
TTATGGAGAAAGAACAATCATACAAAGACGCAGCATTGAATTATGAAAAC
GCATGGAAATTCACCAATGAATCCAGTCCTGCTATAGAATGGGAAATACG
ATATGGCACAAGAACAACTCAAAAAGTGTTTGACTTATAATAAGGATGCT
GAAGACTTTGAACGAAGTTGGCTTCTCCTCGCTGATATATTTATTCAGAA
TGACTATGTACCAGCGCTTTTGGGGATGGCCACAGCTCACATGATACTCA
AACAAACACCAAAAGCCCGGAATCAACTCAAACGTATCTCCAAAATGTCA
TGGAACTCTGAGGAGATGAAACCGAGTCGTAATCCCTTAAAACAGAAGCT
GTTTGAAAATCAACTACTCGTGACCACAAGAAACACGCAACTCGTACAAA
AAGCTCTCAATAACTTGATGGAAATTGCTCAAGTTGAGTCAATATGAAAA
GCACGATACTGAACAAATGGCTATCAAGACGGCAGAAAAATTACTGAAAG
GGTGAGAAAGCTTTGTTCAACATGATCGATATTTGTTTGAATCCTGATAG
TGATATCGTTGGAGGTGAAACATTTGATGTCGCCGAAGGAACCAAGTACC
AAAACAATGCTTCGTCTGCACTCAAATTTTTCAATCTTGCTCGCAAAGAT
AGTTTATGGCTCTTGCAAGCAACCCACGTGCCCAAATGGAAGCTGGCTAC
AATTATTGCAAAGGTTTATATGAATGGTTATTATGATGCACTTGCCAAAC
TTGTCGAACTTTTACGTCGTGCTGGAAAGCTGGAAGATGGACCAAAATAC
TTAGATCAGATGATGGCAGACTTGCTGTTCCGCAAGGGAGAGTACGATTC
TGCTACTTTCCATTTCCAAGAAATACTCAGTAGAAAACCAATACATTCTT
GCATTGGCTGAGTTGTATCTTTTGAATCAAGATCTCGATGCTTGCCAATC
ACAACTACAAACCATTCTCAAGAATAATAAAGATTGCGATCGAGCTACTC
TGGGTTTCTTACAACATCGGTCAATACTATTACAATGGAAAGGACTTCGA
TCGAGCCATCAAGTCGTATAAAGAAGCGACTTACTTCAATGAATCTGAAA
TAACGGGTTATCAAGAGAGTGGCCACAGAACAACCAGATGATTTACAAGA
ACACAAAGCTCTAGCAGCAAACAACTGCACTATCTCGTAGCATCGAGGAG
GCTCGTTGTCAATTCTTGTTGGCTCAGATTTATCAAAAGACTAAAGAGTC
CGAAGAAATTCTCGAAGCTTATTTGAAAGCCAAAGAATTGCAATCAAAAT
TCGACCTTGCTGAACTTCACATGAAGCTTGGAAACTTTGAGAAGGCGGAA
CGAATATTGAAACAAACCTTGTTGAAAAATGAAACAAGCAATCAGTTACT
ATGAAGCAGCAGTGAGAGCTGGTAACCATGTTCTAAGCCTGAGAAAGCAA
TTGAGGTTTACGAAAGCGCTTTGAAGAAGAACCCCAAGGACTATTCATTA
CAAATGAAGATCGGTCAAGCATTTATCAAGACTCATCAATACGCTAAAGG
AACTGGTAGAGAAGATGCCAACTTCTGAATCTTTTCTCCTTCTCGGAGAT
GCGTACATGAGCATCATGGAGCTATTTCATTCAAGCGAGAGAGAAGATGG
CGGAAATTTACTTGAAATATCGTAAGGACAAACGGCTGTATGTTAGTGTC
TACAGAACAGGGTGATGATTTCCAATGCTGACTTTTCATTGAGTCGCGGA
GACATCGAACAAGCTCTTGAAATGTTACGCAAAATTACTCCTGATCAAAG
GTACTTGGTAAGCATCCCAATTATCCAAAAATACGTAAAGAGATTTTGGA
TAAAGCAAGAGCTCAGTTGCGGACGTGAGTTATCGTTTGGGATTCAATTA
TTTGAAAGCTAAAAGATTCGTAGATGCAATAGATGTATGTCACAAGAGTT
GTGCCAAAGCATGGGAATATCTTGGTTTCATTATGGAGAAAGAACAATCA
TACAAAGACGCAGCATTGAATTATGAAAACGCATGGAAATTCACCAATGA
ATCCAGTCCTGCTATAGAATGGGAAATACGATATGGCACAAGAACAACTC
AAAAAGTGTTTGACTTATAATAAGGATGCTGAAGACTTTGAACGAAGTTG
GCTTCTCCTCGCTGATATATTTATTCAGAATGACTATGTACCAGCGCTTT
TGGGGATGGCCACAGCTCACATGATACTCAAACAAACACCAAAAGCCCGG
AATCAACTCAAACGTATCTCCAAAATGTCATGGAACTCTGAGGAGATGAA
ACCGAGTCGTAATCCCTTAAAACAGAAGCTGTTTGAAAATCAACTACTCG
TGACCACAAGAAACACGCAACTCGTACAAAAAGCTCTCAATAACTTGATG
GAAATTGCTCAAGTTGAGTCAATATGAAAAGCACGATACTGAACAAATGG
CTATCAAGACGGCAGAAAAATTACTGAAAGGGTGAGAAAGCTTTGTTCAA
CATGATCGATATTTGTTTGAATCCTGATAGTGATATCGTTGGAGGTGAAA
CATTTGATGTCGCCGAAGGAACCAAGTACCAAAACAATGCTTCGTCTGCA
CTCAAATTTTTCAATCTTGCTCGCAAAGATAGTTTATGGCTCTTGCAAGC
AACCCACGTGCCCAAATGGAAGCTGGCTACAATTATTGCAAAGGTTTATA
TGAATGGTTATTATGATGCACTTGCCAAACTTGTCGAACTTTTACGTCGT
GCTGGAAAGCTGGAAGATGGACCAAAATACTTAGATCAGATGATGGCAGA
CTTGCTGTTCCGCAAGGGAGAGTACGATTCTGCTACTTTCCATTTCCAAG
AAATACTCAGTAGAAAACCAATACATTCTTGCATTGGCTGAGTTGTATCT
TTTGAATCAAGATCTCGATGCTTGCCAATCACAACTACAAACCATTCTCA
AGAATAATAAAGATTGCGATCGAGCTACTCTGGGTTTCTTACAACATCGG
TCAATACTATTACAATGGAAAGGACTTCGATCGAGCCATCAAGTCGTATA
AAGAAGCGACTTACTTCAATGAATCTGAAATAACGGGTTATCAAGAGAGT
GGCCACAGAACAACCAGATGATTTACAAGAACACAAAGCTCTAGCAGCAA
ACAACTGCACTATCTCGTAGCATCGAGGAGGCTCGTTGTCAATTCTTGTT
GGCTCAGATTTATCAAAAGACTAAAGAGTCCGAAGAAATTCTCGAAGCTT
ATTTGAAAGCCAAAGAATTGCAATCAAAATTCGACCTTGCTGAACTTCAC
ATGAAGCTTGGAAACTTTGAGAAGGCGGAACGAATATTGAAACAAACCTT
GTTGAAAAATGAAACAAGCAATCAGTTACTATGAAGCAGCAGTGAGAGCT
GGTAACCATGTTCTAAGCCTGAGAAAGCAATTGAGGTTTACGAAAGCGCT
TTGAAGAAGAACCCCAAGGACTATTCATTACAAATGAAGATCGGTCAAGC
ATTTATCAAGACTCATCAATACGCTAAAGGAACTGGTAGAGAAGATGCCA
ACTTCTGAATCTTTTCTCCTTCTCGGAGATGCGTACATGAGCATCATGGA
GCTATTTCATTCAAGCGAGAGAGAAGATGGCGGAAATTTACTTGAAATAT
CGTAAGGACAAACGGCTGTATGTTAGTGTCTACAGAACAGGGTGATGATT
TCCAATGCTGACTTTTCATTGAGTCGCGGAGACATCGAACAAGCTCTTGA
AATGTTACGCAAAATTACTCCTGATCAAAGGTACTTGGTAAGCATCCCAA
TTATCCAAAAATACGTAAAGAGATTTTGGATAAAGCAAGAGCTCAGTTGC
GGACGTGAGTTATCGTTTGGGATTCAATTATTTGAAAGCTAAAAGATTCG
TAGATGCAATAGATGTATGTCACAAGAGTTGTGCCAAAGCATGGGAATAT
CTTGGTTTCATTATGGAGAAAGAACAATCATACAAAGACGCAGCATTGAA
TTATGAAAACGCATGGAAATTCACCAATGAATCCAGTCCTGCTATAGAAT
GGGAAATACGATATGGCACAAGAACAACTCAAAAAGTGTTTGACTTATAA
TAAGGATGCTGAAGACTTTGAACGAAGTTGGCTTCTCCTCGCTGATATAT
TTATTCAGAATGACTATGTACCAGCGCTTTTGGGGATGGCCACAGCTCAC
ATGATACTCAAACAAACACCAAAAGCCCGGAATCAACTCAAACGTATCTC
CAAAATGTCATGGAACTCTGAGGAGATGAAACCGAGTCGTAATCCCTTAA
AACAGAAGCTGTTTGAAAATCAACTACTCGTGACCACAAGAAACACGCAA
CTCGTACAAAAAGCTCTCAATAACTTGATGGAAATTGCTCAAGTTGAGTC
AATATGAAAAGCACGATACTGAACAAATGGCTATCAAGACGGCAGAAAAA
TTACTGAAAGGGTGAGAAAGCTTTGTTCAACATGATCGATATTTGTTTGA
ATCCTGATAGTGATATCGTTGGAGGTGAAACATTTGATGTCGCCGAAGGA
ACCAAGTACCAAAACAATGCTTCGTCTGCACTCAAATTTTTCAATCTTGC
TCGCAAAGATAGTTTATGGCTCTTGCAAGCAACCCACGTGCCCAAATGGA
AGCTGGCTACAATTATTGCAAAGGTTTATATGAATGGTTATTATGATGCA
CTTGCCAAACTTGTCGAACTTTTACGTCGTGCTGGAAAGCTGGAAGATGG
ACCAAAATACTTAGATCAGATGATGGCAGACTTGCTGTTCCGCAAGGGAG
AGTACGATTCTGCTACTTTCCATTTCCAAGAAATACTCAGTAGAAAACCA
ATACATTCTTGCATTGGCTGAGTTGTATCTTTTGAATCAAGATCTCGATG
CTTGCCAATCACAACTACAAACCATTCTCAAGAATAATAAAGATTGCGAT
CGAGCTACTCTGGGTTTCTTACAACATCGGTCAATACTATTACAATGGAA
AGGACTTCGATCGAGCCATCAAGTCGTATAAAGAAGCGACTTACTTCAAT
GAATCTGAAATAACGGGTTATCAAGAGAGTGGCCACAGAACAACCAGATG
ATTTACAAGAACACAAAGCTCTAGCAGCAAACAACTGCACTATCTCGTAG
CATCGAGGAGGCTCGTTGTCAATTCTTGTTGGCTCAGATTTATCAAAAGA
CTAAAGAGTCCGAAGAAATTCTCGAAGCTTATTTGAAAGCCAAAGAATTG
CAATCAAAATTCGACCTTGCTGAACTTCACATGAAGCTTGGAAACTTTGA
GAAGGCGGAACGAATATTGAAACAAACCTTGTTGAAAAATGAAACAAGCA
ATCAGTTACTATGAAGCAGCAGTGAGAGCTGGTAACCATGTTCTAAGCCT
GAGAAAGCAATTGAGGTTTACGAAAGCGCTTTGAAGAAGAACCCCAAGGA
CTATTCATTACAAATGAAGATCGGTCAAGCATTTATCAAGACTCATCAAT
ACGCTAAAGGAACTGGTAGAGAAGATGCCAACTTCTGAATCTTTTCTCCT
TCTCGGAGATGCGTACATGAGCATCATGGAGCTATTTCATTCAAGCGAGA
GAGAAGATGGCGGAAATTTACTTGAAATATCGTAAGGACAAACGGCTGTA
TGTTAGTGTCTACAGAACAGGGTGATGATTTCCAATGCTGACTTTTCATT
GAGTCGCGGAGACATCGAACAAGCTCTTGAAATGTTACGCAAAATTACTC
CTGATCAAAGGTACTTGGTAAGCATCCCAATTATCCAAAAATACGTAAAG
AGATTTTGGATAAAGCAAGAGCTCAGTTGCGGACGTGAGTTATCGTTTGG
GATTCAATTATTTGAAAGCTAAAAGATTCGTAGATGCAATAGATGTATGT
CACAAGAGTTGTGCCAAAGCATGGGAATATCTTGGTTTCATTATGGAGAA
AGAACAATCATACAAAGACGCAGCATTGAATTATGAAAACGCATGGAAAT
TCACCAATGAATCCAGTCCTGCTATAGAATGGGAAATACGATATGGCACA
AGAACAACTCAAAAAGTGTTTGACTTATAATAAGGATGCTGAAGACTTTG
AACGAAGTTGGCTTCTCCTCGCTGATATATTTATTCAGAATGACTATGTA
CCAGCGCTTTTGGGGATGGCCACAGCTCACATGATACTCAAACAAACACC
AAAAGCCCGGAATCAACTCAAACGTATCTCCAAAATGTCATGGAACTCTG
AGGAGATGAAACCGAGTCGTAATCCCTTAAAACAGAAGCTGTTTGAAAAT
CAACTACTCGTGACCACAAGAAACACGCAACTCGTACAAAAAGCTCTCAA
TAACTTGATGGAAATTGCTCAAGTTGAGTCAATATGAAAAGCACGATACT
GAACAAATGGCTATCAAGACGGCAGAAAAATTACTGAAAGGGTGAGAAAG
CTTTGTTCAACATGATCGATATTTGTTTGAATCCTGATAGTGATATCGTT
GGAGGTGAAACATTTGATGTCGCCGAAGGAACCAAGTACCAAAACAATGC
TTCGTCTGCACTCAAATTTTTCAATCTTGCTCGCAAAGATAGTTTATGGC
TCTTGCAAGCAACCCACGTGCCCAAATGGAAGCTGGCTACAATTATTGCA
AAGGTTTATATGAATGGTTATTATGATGCACTTGCCAAACTTGTCGAACT
TTTACGTCGTGCTGGAAAGCTGGAAGATGGACCAAAATACTTAGATCAGA
TGATGGCAGACTTGCTGTTCCGCAAGGGAGAGTACGATTCTGCTACTTTC
CATTTCCAAGAAATACTCAGTAGAAAACCAATACATTCTTGCATTGGCTG
AGTTGTATCTTTTGAATCAAGATCTCGATGCTTGCCAATCACAACTACAA
ACCATTCTCAAGAATAATAAAGATTGCGATCGAGCTACTCTGGGTTTCTT
ACAACATCGGTCAATACTATTACAATGGAAAGGACTTCGATCGAGCCATC
AAGTCGTATAAAGAAGCGACTTACTTCAATGAATCTGAAATAACGGGTTA
TCAAGAGAGTGGCCACAGAACAACCAGATGATTTACAAGAACACAAAGCT
CTAGCAGCAAACAACTGCACTATCTCGTAGCATCGAGGAGGCTCGTTGTC
AATTCTTGTTGGCTCAGATTTATCAAAAGACTAAAGAGTCCGAAGAAATT
CTCGAAGCTTATTTGAAAGCCAAAGAATTGCAATCAAAATTCGACCTTGC
TGAACTTCACATGAAGCTTGGAAACTTTGAGAAGGCGGAACGAATATTGA
AACAAACCTTGTTGAAAAATGAAACAAGCAATCAGTTACTATGAAGCAGC
AGTGAGAGCTGGTAACCATGTTCTAAGCCTGAGAAAGCAATTGAGGTTTA
CGAAAGCGCTTTGAAGAAGAACCCCAAGGACTATTCATTACAAATGAAGA
TCGGTCAAGCATTTATCAAGACTCATCAATACGCTAAAGGAACTGGTAGA
GAAGATGCCAACTTCTGAATCTTTTCTCCTTCTCGGAGATGCGTACATGA
GCATCATGGAGCTATTTCATTCAAGCGAGAGAGAAGATGGCGGAAATTTA
CTTGAAATATCGTAAGGACAAACGGCTGTATGTTAGTGTCTACAGAACAG
GGTGATGATTTCCAATGCTGACTTTTCATTGAGTCGCGGAGACATCGAAC
AAGCTCTTGAAATGTTACGCAAAATTACTCCTGATCAAAGGTACTTGGTA
AGCATCCCAATTATCCAAAAATACGTAAAGAGATTTTGGATAAAGCAAGA
GCTCAGTTGCGGACGTGAGTTATCGTTTGGGATTCAATTATTTGAAAGCT
AAAAGATTCGTAGATGCAATAGATGTATGTCACAAGAGTTGTGCCAAAGC
ATGGGAATATCTTGGTTTCATTATGGAGAAAGAACAATCATACAAAGACG
CAGCATTGAATTATGAAAACGCATGGAAATTCACCAATGAATCCAGTCCT
GCTATAGAATGGGAAATACGATATGGCACAAGAACAACTCAAAAAGTGTT
TGACTTATAATAAGGATGCTGAAGACTTTGAACGAAGTTGGCTTCTCCTC
GCTGATATATTTATTCAGAATGACTATGTACCAGCGCTTTTGGGGATGGC
CACAGCTCACATGATACTCAAACAAACACCAAAAGCCCGGAATCAACTCA
AACGTATCTCCAAAATGTCATGGAACTCTGAGGAGATGAAACCGAGTCGT
AATCCCTTAAAACAGAAGCTGTTTGAAAATCAACTACTCGTGACCACAAG
AAACACGCAACTCGTACAAAAAGCTCTCAATAACTTGATGGAAATTGCTC
AAGTTGAGTCAATATGAAAAGCACGATACTGAACAAATGGCTATCAAGAC
GGCAGAAAAATTACTGAAAGGGTGAGAAAGCTTTGTTCAACATGATCGAT
ATTTGTTTGAATCCTGATAGTGATATCGTTGGAGGTGAAACATTTGATGT
CGCCGAAGGAACCAAGTACCAAAACAATGCTTCGTCTGCACTCAAATTTT
TCAATCTTGCTCGCAAAGATAGTTTATGGCTCTTGCAAGCAACCCACGTG
CCCAAATGGAAGCTGGCTACAATTATTGCAAAGGTTTATATGAATGGTTA
TTATGATGCACTTGCCAAACTTGTCGAACTTTTACGTCGTGCTGGAAAGC
TGGAAGATGGACCAAAATACTTAGATCAGATGATGGCAGACTTGCTGTTC
CGCAAGGGAGAGTACGATTCTGCTACTTTCCATTTCCAAGAAATACTCAG
TAGAAAACCAATACATTCTTGCATTGGCTGAGTTGTATCTTTTGAATCAA
GATCTCGATGCTTGCCAATCACAACTACAAACCATTCTCAAGAATAATAA
AGATTGCGATCGAGCTACTCTGGGTTTCTTACAACATCGGTCAATACTAT
TACAATGGAAAGGACTTCGATCGAGCCATCAAGTCGTATAAAGAAGCGAC
TTACTTCAATGAATCTGAAATAACGGGTTATCAAGAGAGTGGCCACAGAA
CAACCAGATGATTTACAAGAACACAAAGCTCTAGCAGCAAACAACTGCAC
TATCTCGTAGCATCGAGGAGGCTCGTTGTCAATTCTTGTTGGCTCAGATT
TATCAAAAGACTAAAGAGTCCGAAGAAATTCTCGAAGCTTATTTGAAAGC
CAAAGAATTGCAATCAAAATTCGACCTTGCTGAACTTCACATGAAGCTTG
GAAACTTTGAGAAGGCGGAACGAATATTGAAACAAACCTTGTTGAAAAAT
GAAACAAGCAATCAGTTACTATGAAGCAGCAGTGAGAGCTGGTAACCATG
TTCTAAGCCTGAGAAAGCAATTGAGGTTTACGAAAGCGCTTTGAAGAAGA
ACCCCAAGGACTATTCATTACAAATGAAGATCGGTCAAGCATTTATCAAG
ACTCATCAATACGCTAAAGGAACTGGTAGAGAAGATGCCAACTTCTGAAT
CTTTTCTCCTTCTCGGAGATGCGTACATGAGCATCATGGAGCTATTTCAT
TCAAGCGAGAGAGAAGATGGCGGAAATTTACTTGAAATATCGTAAGGACA
AACGGCTGTATGTTAGTGTCTACAGAACAGGGTGATGATTTCCAATGCTG
ACTTTTCATTGAGTCGCGGAGACATCGAACAAGCTCTTGAAATGTTACGC
AAAATTACTCCTGATCAAAGGTACTTGGTAAGCATCCCAATTATCCAAAA
ATACGTAAAGAGATTTTGGATAAAGCAAGAGCTCAGTTGCGGACGTGAGT
TATCGTTTGGGATTCAATTATTTGAAAGCTAAAAGATTCGTAGATGCAAT
AGATGTATGTCACAAGAGTTGTGCCAAAGCATGGGAATATCTTGGTTTCA
TTATGGAGAAAGAACAATCATACAAAGACGCAGCATTGAATTATGAAAAC
GCATGGAAATTCACCAATGAATCCAGTCCTGCTATAGAATGGGAAATACG
ATATGGCACAAGAACAACTCAAAAAGTGTTTGACTTATAATAAGGATGCT
GAAGACTTTGAACGAAGTTGGCTTCTCCTCGCTGATATATTTATTCAGAA
TGACTATGTACCAGCGCTTTTGGGGATGGCCACAGCTCACATGATACTCA
AACAAACACCAAAAGCCCGGAATCAACTCAAACGTATCTCCAAAATGTCA
TGGAACTCTGAGGAGATGAAACCGAGTCGTAATCCCTTAAAACAGAAGCT
GTTTGAAAATCAACTACTCGTGACCACAAGAAACACGCAACTCGTACAAA
AAGCTCTCAATAACTTGATGGAAATTGCTCAAGTTGAGTCAATATGAAAA
GCACGATACTGAACAAATGGCTATCAAGACGGCAGAAAAATTACTGAAAG
GGTGAGAAAGCTTTGTTCAACATGATCGATATTTGTTTGAATCCTGATAG
TGATATCGTTGGAGGTGAAACATTTGATGTCGCCGAAGGAACCAAGTACC
AAAACAATGCTTCGTCTGCACTCAAATTTTTCAATCTTGCTCGCAAAGAT
AGTTTATGGCTCTTGCAAGCAACCCACGTGCCCAAATGGAAGCTGGCTAC
AATTATTGCAAAGGTTTATATGAATGGTTATTATGATGCACTTGCCAAAC
TTGTCGAACTTTTACGTCGTGCTGGAAAGCTGGAAGATGGACCAAAATAC
TTAGATCAGATGATGGCAGACTTGCTGTTCCGCAAGGGAGAGTACGATTC
TGCTACTTTCCATTTCCAAGAAATACTCAGTAGAAAACCAATACATTCTT
GCATTGGCTGAGTTGTATCTTTTGAATCAAGATCTCGATGCTTGCCAATC
ACAACTACAAACCATTCTCAAGAATAATAAAGATTGCGATCGAGCTACTC
TGGGTTTCTTACAACATCGGTCAATACTATTACAATGGAAAGGACTTCGA
TCGAGCCATCAAGTCGTATAAAGAAGCGACTTACTTCAATGAATCTGAAA
TAACGGGTTATCAAGAGAGTGGCCACAGAACAACCAGATGATTTACAAGA
ACACAAAGCTCTAGCAGCAAACAACTGCACTATCTCGTAGCATCGAGGAG
GCTCGTTGTCAATTCTTGTTGGCTCAGATTTATCAAAAGACTAAAGAGTC
CGAAGAAATTCTCGAAGCTTATTTGAAAGCCAAAGAATTGCAATCAAAAT
TCGACCTTGCTGAACTTCACATGAAGCTTGGAAACTTTGAGAAGGCGGAA
CGAATATTGAAACAAACCTTGTTGAAAAATGAAACAAGCAATCAGTTACT
ATGAAGCAGCAGTGAGAGCTGGTAACCATGTTCTAAGCCTGAGAAAGCAA
TTGAGGTTTACGAAAGCGCTTTGAAGAAGAACCCCAAGGACTATTCATTA
CAAATGAAGATCGGTCAAGCATTTATCAAGACTCATCAATACGCTAAAGG
AACTGGTAGAGAAGATGCCAACTTCTGAATCTTTTCTCCTTCTCGGAGAT
GCGTACATGAGCATCATGGAGCTATTTCATTCAAGCGAGAGAGAAGATGG
CGGAAATTTACTTGAAATATCGTAAGGACAAACGGCTGTATGTTAGTGTC
TACAGAACAGGGTGATGATTTCCAATGCTGACTTTTCATTGAGTCGCGGA
GACATCGAACAAGCTCTTGAAATGTTACGCAAAATTACTCCTGATCAAAG
GTACTTGGTAAGCATCCCAATTATCCAAAAATACGTAAAGAGATTTTGGA
TAAAGCAAGAGCTCAGTTGCGGACGTGAGTTATCGTTTGGGATTCAATTA
TTTGAAAGCTAAAAGATTCGTAGATGCAATAGATGTATGTCACAAGAGTT
GTGCCAAAGCATGGGAATATCTTGGTTTCATTATGGAGAAAGAACAATCA
TACAAAGACGCAGCATTGAATTATGAAAACGCATGGAAATTCACCAATGA
ATCCAGTCCTGCTATAGAATGGGAAATACGATATGGCACAAGAACAACTC
AAAAAGTGTTTGACTTATAATAAGGATGCTGAAGACTTTGAACGAAGTTG
GCTTCTCCTCGCTGATATATTTATTCAGAATGACTATGTACCAGCGCTTT
TGGGGATGGCCACAGCTCACATGATACTCAAACAAACACCAAAAGCCCGG
AATCAACTCAAACGTATCTCCAAAATGTCATGGAACTCTGAGGAGATGAA
ACCGAGTCGTAATCCCTTAAAACAGAAGCTGTTTGAAAATCAACTACTCG
TGACCACAAGAAACACGCAACTCGTACAAAAAGCTCTCAATAACTTGATG
GAAATTGCTCAAGTTGAGTCAATATGAAAAGCACGATACTGAACAAATGG
CTATCAAGACGGCAGAAAAATTACTGAAAGGGTGAGAAAGCTTTGTTCAA
CATGATCGATATTTGTTTGAATCCTGATAGTGATATCGTTGGAGGTGAAA
CATTTGATGTCGCCGAAGGAACCAAGTACCAAAACAATGCTTCGTCTGCA
CTCAAATTTTTCAATCTTGCTCGCAAAGATAGTTTATGGCTCTTGCAAGC
AACCCACGTGCCCAAATGGAAGCTGGCTACAATTATTGCAAAGGTTTATA
TGAATGGTTATTATGATGCACTTGCCAAACTTGTCGAACTTTTACGTCGT
GCTGGAAAGCTGGAAGATGGACCAAAATACTTAGATCAGATGATGGCAGA
CTTGCTGTTCCGCAAGGGAGAGTACGATTCTGCTACTTTCCATTTCCAAG
AAATACTCAGTAGAAAACCAATACATTCTTGCATTGGCTGAGTTGTATCT
TTTGAATCAAGATCTCGATGCTTGCCAATCACAACTACAAACCATTCTCA
AGAATAATAAAGATTGCGATCGAGCTACTCTGGGTTTCTTACAACATCGG
TCAATACTATTACAATGGAAAGGACTTCGATCGAGCCATCAAGTCGTATA
AAGAAGCGACTTACTTCAATGAATCTGAAATAACGGGTTATCAAGAGAGT
GGCCACAGAACAACCAGATGATTTACAAGAACACAAAGCTCTAGCAGCAA
ACAACTGCACTATCTCGTAGCATCGAGGAGGCTCGTTGTCAATTCTTGTT
GGCTCAGATTTATCAAAAGACTAAAGAGTCCGAAGAAATTCTCGAAGCTT
ATTTGAAAGCCAAAGAATTGCAATCAAAATTCGACCTTGCTGAACTTCAC
ATGAAGCTTGGAAACTTTGAGAAGGCGGAACGAATATTGAAACAAACCTT
GTTGAAAAATGAAACAAGCAATCAGTTACTATGAAGCAGCAGTGAGAGCT
GGTAACCATGTTCTAAGCCTGAGAAAGCAATTGAGGTTTACGAAAGCGCT
TTGAAGAAGAACCCCAAGGACTATTCATTACAAATGAAGATCGGTCAAGC
ATTTATCAAGACTCATCAATACGCTAAAGGAACTGGTAGAGAAGATGCCA
ACTTCTGAATCTTTTCTCCTTCTCGGAGATGCGTACATGAGCATCATGGA
GCTATTTCATTCAAGCGAGAGAGAAGATGGCGGAAATTTACTTGAAATAT
CGTAAGGACAAACGGCTGTATGTTAGTGTCTACAGAACAGGGTGATGATT
TCCAATGCTGACTTTTCATTGAGTCGCGGAGACATCGAACAAGCTCTTGA
AATGTTACGCAAAATTACTCCTGATCAAAGGTACTTGGTAAGCATCCCAA
TTATCCAAAAATACGTAAAGAGATTTTGGATAAAGCAAGAGCTCAGTTGC
GGACGTGAGTTATCGTTTGGGATTCAATTATTTGAAAGCTAAAAGATTCG
TAGATGCAATAGATGTATGTCACAAGAGTTGTGCCAAAGCATGGGAATAT
CTTGGTTTCATTATGGAGAAAGAACAATCATACAAAGACGCAGCATTGAA
TTATGAAAACGCATGGAAATTCACCAATGAATCCAGTCCTGCTATAGAAT
GGGAAATACGATATGGCACAAGAACAACTCAAAAAGTGTTTGACTTATAA
TAAGGATGCTGAAGACTTTGAACGAAGTTGGCTTCTCCTCGCTGATATAT
TTATTCAGAATGACTATGTACCAGCGCTTTTGGGGATGGCCACAGCTCAC
ATGATACTCAAACAAACACCAAAAGCCCGGAATCAACTCAAACGTATCTC
CAAAATGTCATGGAACTCTGAGGAGATGAAACCGAGTCGTAATCCCTTAA
AACAGAAGCTGTTTGAAAATCAACTACTCGTGACCACAAGAAACACGCAA
CTCGTACAAAAAGCTCTCAATAACTTGATGGAAATTGCTCAAGTTGAGTC
AATATGAAAAGCACGATACTGAACAAATGGCTATCAAGACGGCAGAAAAA
TTACTGAAAGGGTGAGAAAGCTTTGTTCAACATGATCGATATTTGTTTGA
ATCCTGATAGTGATATCGTTGGAGGTGAAACATTTGATGTCGCCGAAGGA
ACCAAGTACCAAAACAATGCTTCGTCTGCACTCAAATTTTTCAATCTTGC
TCGCAAAGATAGTTTATGGCTCTTGCAAGCAACCCACGTGCCCAAATGGA
AGCTGGCTACAATTATTGCAAAGGTTTATATGAATGGTTATTATGATGCA
CTTGCCAAACTTGTCGAACTTTTACGTCGTGCTGGAAAGCTGGAAGATGG
ACCAAAATACTTAGATCAGATGATGGCAGACTTGCTGTTCCGCAAGGGAG
AGTACGATTCTGCTACTTTCCATTTCCAAGAAATACTCAGTAGAAAACCA
ATACATTCTTGCATTGGCTGAGTTGTATCTTTTGAATCAAGATCTCGATG
CTTGCCAATCACAACTACAAACCATTCTCAAGAATAATAAAGATTGCGAT
CGAGCTACTCTGGGTTTCTTACAACATCGGTCAATACTATTACAATGGAA
AGGACTTCGATCGAGCCATCAAGTCGTATAAAGAAGCGACTTACTTCAAT
GAATCTGAAATAACGGGTTATCAAGAGAGTGGCCACAGAACAACCAGATG
ATTTACAAGAACACAAAGCTCTAGCAGCAAACAACTGCACTATCTCGTAG
CATCGAGGAGGCTCGTTGTCAATTCTTGTTGGCTCAGATTTATCAAAAGA
CTAAAGAGTCCGAAGAAATTCTCGAAGCTTATTTGAAAGCCAAAGAATTG
CAATCAAAATTCGACCTTGCTGAACTTCACATGAAGCTTGGAAACTTTGA
GAAGGCGGAACGAATATTGAAACAAACCTTGTTGAAAAATGAAACAAGCA
ATCAGTTACTATGAAGCAGCAGTGAGAGCTGGTAACCATGTTCTAAGCCT
GAGAAAGCAATTGAGGTTTACGAAAGCGCTTTGAAGAAGAACCCCAAGGA
CTATTCATTACAAATGAAGATCGGTCAAGCATTTATCAAGACTCATCAAT
ACGCTAAAGGAACTGGTAGAGAAGATGCCAACTTCTGAATCTTTTCTCCT
TCTCGGAGATGCGTACATGAGCATCATGGAGCTATTTCATTCAAGCGAGA
GAGAAGATGGCGGAAATTTACTTGAAATATCGTAAGGACAAACGGCTGTA
TGTTAGTGTCTACAGAACAGGGTGATGATTTCCAATGCTGACTTTTCATT
GAGTCGCGGAGACATCGAACAAGCTCTTGAAATGTTACGCAAAATTACTC
CTGATCAAAGGTACTTGGTAAGCATCCCAATTATCCAAAAATACGTAAAG
AGATTTTGGATAAAGCAAGAGCTCAGTTGCGGACGTGAGTTATCGTTTGG
GATTCAATTATTTGAAAGCTAAAAGATTCGTAGATGCAATAGATGTATGT
CACAAGAGTTGTGCCAAAGCATGGGAATATCTTGGTTTCATTATGGAGAA
AGAACAATCATACAAAGACGCAGCATTGAATTATGAAAACGCATGGAAAT
TCACCAATGAATCCAGTCCTGCTATAGAATGGGAAATACGATATGGCACA
AGAACAACTCAAAAAGTGTTTGACTTATAATAAGGATGCTGAAGACTTTG
AACGAAGTTGGCTTCTCCTCGCTGATATATTTATTCAGAATGACTATGTA
CCAGCGCTTTTGGGGATGGCCACAGCTCACATGATACTCAAACAAACACC
AAAAGCCCGGAATCAACTCAAACGTATCTCCAAAATGTCATGGAACTCTG
AGGAGATGAAACCGAGTCGTAATCCCTTAAAACAGAAGCTGTTTGAAAAT
CAACTACTCGTGACCACAAGAAACACGCAACTCGTACAAAAAGCTCTCAA
TAACTTGATGGAAATTGCTCAAGTTGAGTCAATATGAAAAGCACGATACT
GAACAAATGGCTATCAAGACGGCAGAAAAATTACTGAAAGGGTGAGAAAG
CTTTGTTCAACATGATCGATATTTGTTTGAATCCTGATAGTGATATCGTT
GGAGGTGAAACATTTGATGTCGCCGAAGGAACCAAGTACCAAAACAATGC
TTCGTCTGCACTCAAATTTTTCAATCTTGCTCGCAAAGATAGTTTATGGC
TCTTGCAAGCAACCCACGTGCCCAAATGGAAGCTGGCTACAATTATTGCA
AAGGTTTATATGAATGGTTATTATGATGCACTTGCCAAACTTGTCGAACT
TTTACGTCGTGCTGGAAAGCTGGAAGATGGACCAAAATACTTAGATCAGA
TGATGGCAGACTTGCTGTTCCGCAAGGGAGAGTACGATTCTGCTACTTTC
CATTTCCAAGAAATACTCAGTAGAAAACCAATACATTCTTGCATTGGCTG
AGTTGTATCTTTTGAATCAAGATCTCGATGCTTGCCAATCACAACTACAA
ACCATTCTCAAGAATAATAAAGATTGCGATCGAGCTACTCTGGGTTTCTT
ACAACATCGGTCAATACTATTACAATGGAAAGGACTTCGATCGAGCCATC
AAGTCGTATAAAGAAGCGACTTACTTCAATGAATCTGAAATAACGGGTTA
TCAAGAGAGTGGCCACAGAACAACCAGATGATTTACAAGAACACAAAGCT
CTAGCAGCAAACAACTGCACTATCTCGTAGCATCGAGGAGGCTCGTTGTC
AATTCTTGTTGGCTCAGATTTATCAAAAGACTAAAGAGTCCGAAGAAATT
CTCGAAGCTTATTTGAAAGCCAAAGAATTGCAATCAAAATTCGACCTTGC
TGAACTTCACATGAAGCTTGGAAACTTTGAGAAGGCGGAACGAATATTGA
AACAAACCTTGTTGAAAAATGAAACAAGCAATCAGTTACTATGAAGCAGC
AGTGAGAGCTGGTAACCATGTTCTAAGCCTGAGAAAGCAATTGAGGTTTA
CGAAAGCGCTTTGAAGAAGAACCCCAAGGACTATTCATTACAAATGAAGA
TCGGTCAAGCATTTATCAAGACTCATCAATACGCTAAAGGAACTGGTAGA
GAAGATGCCAACTTCTGAATCTTTTCTCCTTCTCGGAGATGCGTACATGA
GCATCATGGAGCTATTTCATTCAAGCGAGAGAGAAGATGGCGGAAATTTA
CTTGAAATATCGTAAGGACAAACGGCTGTATGTTAGTGTCTACAGAACAG
GGTGATGATTTCCAATGCTGACTTTTCATTGAGTCGCGGAGACATCGAAC
AAGCTCTTGAAATGTTACGCAAAATTACTCCTGATCAAAGGTACTTGGTA
AGCATCCCAATTATCCAAAAATACGTAAAGAGATTTTGGATAAAGCAAGA
GCTCAGTTGCGGACGTGAGTTATCGTTTGGGATTCAATTATTTGAAAGCT
AAAAGATTCGTAGATGCAATAGATGTATGTCACAAGAGTTGTGCCAAAGC
ATGGGAATATCTTGGTTTCATTATGGAGAAAGAACAATCATACAAAGACG
CAGCATTGAATTATGAAAACGCATGGAAATTCACCAATGAATCCAGTCCT
GCTATAGAATGGGAAATACGATATGGCACAAGAACAACTCAAAAAGTGTT
TGACTTATAATAAGGATGCTGAAGACTTTGAACGAAGTTGGCTTCTCCTC
GCTGATATATTTATTCAGAATGACTATGTACCAGCGCTTTTGGGGATGGC
CACAGCTCACATGATACTCAAACAAACACCAAAAGCCCGGAATCAACTCA
AACGTATCTCCAAAATGTCATGGAACTCTGAGGAGATGAAACCGAGTCGT
AATCCCTTAAAACAGAAGCTGTTTGAAAATCAACTACTCGTGACCACAAG
AAACACGCAACTCGTACAAAAAGCTCTCAATAACTTGATGGAAATTGCTC
AAGTTGAGTCAATATGAAAAGCACGATACTGAACAAATGGCTATCAAGAC
GGCAGAAAAATTACTGAAAGGGTGAGAAAGCTTTGTTCAACATGATCGAT
ATTTGTTTGAATCCTGATAGTGATATCGTTGGAGGTGAAACATTTGATGT
CGCCGAAGGAACCAAGTACCAAAACAATGCTTCGTCTGCACTCAAATTTT
TCAATCTTGCTCGCAAAGATAGTTTATGGCTCTTGCAAGCAACCCACGTG
CCCAAATGGAAGCTGGCTACAATTATTGCAAAGGTTTATATGAATGGTTA
TTATGATGCACTTGCCAAACTTGTCGAACTTTTACGTCGTGCTGGAAAGC
TGGAAGATGGACCAAAATACTTAGATCAGATGATGGCAGACTTGCTGTTC
CGCAAGGGAGAGTACGATTCTGCTACTTTCCATTTCCAAGAAATACTCAG
TAGAAAACCAATACATTCTTGCATTGGCTGAGTTGTATCTTTTGAATCAA
GATCTCGATGCTTGCCAATCACAACTACAAACCATTCTCAAGAATAATAA
AGATTGCGATCGAGCTACTCTGGGTTTCTTACAACATCGGTCAATACTAT
TACAATGGAAAGGACTTCGATCGAGCCATCAAGTCGTATAAAGAAGCGAC
TTACTTCAATGAATCTGAAATAACGGGTTATCAAGAGAGTGGCCACAGAA
CAACCAGATGATTTACAAGAACACAAAGCTCTAGCAGCAAACAACTGCAC
TATCTCGTAGCATCGAGGAGGCTCGTTGTCAATTCTTGTTGGCTCAGATT
TATCAAAAGACTAAAGAGTCCGAAGAAATTCTCGAAGCTTATTTGAAAGC
CAAAGAATTGCAATCAAAATTCGACCTTGCTGAACTTCACATGAAGCTTG
GAAACTTTGAGAAGGCGGAACGAATATTGAAACAAACCTTGTTGAAAAAT
GAAACAAGCAATCAGTTACTATGAAGCAGCAGTGAGAGCTGGTAACCATG
TTCTAAGCCTGAGAAAGCAATTGAGGTTTACGAAAGCGCTTTGAAGAAGA
ACCCCAAGGACTATTCATTACAAATGAAGATCGGTCAAGCATTTATCAAG
ACTCATCAATACGCTAAAGGAACTGGTAGAGAAGATGCCAACTTCTGAAT
CTTTTCTCCTTCTCGGAGATGCGTACATGAGCATCATGGAGCTATTTCAT
TCAAGCGAGAGAGAAGATGGCGGAAATTTACTTGAAATATCGTAAGGACA
AACGGCTGTATGTTAGTGTCTACAGAACAGGGTGATGATTTCCAATGCTG
ACTTTTCATTGAGTCGCGGAGACATCGAACAAGCTCTTGAAATGTTACGC
AAAATTACTCCTGATCAAAGGTACTTGGTAAGCATCCCAATTATCCAAAA
ATACGTAAAGAGATTTTGGATAAAGCAAGAGCTCAGTTGCGGACGTGAGT
TATCGTTTGGGATTCAATTATTTGAAAGCTAAAAGATTCGTAGATGCAAT
AGATGTATGTCACAAGAGTTGTGCCAAAGCATGGGAATATCTTGGTTTCA
TTATGGAGAAAGAACAATCATACAAAGACGCAGCATTGAATTATGAAAAC
GCATGGAAATTCACCAATGAATCCAGTCCTGCTATAGAATGGGAAATACG
ATATGGCACAAGAACAACTCAAAAAGTGTTTGACTTATAATAAGGATGCT
GAAGACTTTGAACGAAGTTGGCTTCTCCTCGCTGATATATTTATTCAGAA
TGACTATGTACCAGCGCTTTTGGGGATGGCCACAGCTCACATGATACTCA
AACAAACACCAAAAGCCCGGAATCAACTCAAACGTATCTCCAAAATGTCA
TGGAACTCTGAGGAGATGAAACCGAGTCGTAATCCCTTAAAACAGAAGCT
GTTTGAAAATCAACTACTCGTGACCACAAGAAACACGCAACTCGTACAAA
AAGCTCTCAATAACTTGATGGAAATTGCTCAAGTTGAGTCAATATGAAAA
GCACGATACTGAACAAATGGCTATCAAGACGGCAGAAAAATTACTGAAAG
GGTGAGAAAGCTTTGTTCAACATGATCGATATTTGTTTGAATCCTGATAG
TGATATCGTTGGAGGTGAAACATTTGATGTCGCCGAAGGAACCAAGTACC
AAAACAATGCTTCGTCTGCACTCAAATTTTTCAATCTTGCTCGCAAAGAT
AGTTTATGGCTCTTGCAAGCAACCCACGTGCCCAAATGGAAGCTGGCTAC
AATTATTGCAAAGGTTTATATGAATGGTTATTATGATGCACTTGCCAAAC
TTGTCGAACTTTTACGTCGTGCTGGAAAGCTGGAAGATGGACCAAAATAC
TTAGATCAGATGATGGCAGACTTGCTGTTCCGCAAGGGAGAGTACGATTC
TGCTACTTTCCATTTCCAAGAAATACTCAGTAGAAAACCAATACATTCTT
GCATTGGCTGAGTTGTATCTTTTGAATCAAGATCTCGATGCTTGCCAATC
ACAACTACAAACCATTCTCAAGAATAATAAAGATTGCGATCGAGCTACTC
TGGGTTTCTTACAACATCGGTCAATACTATTACAATGGAAAGGACTTCGA
TCGAGCCATCAAGTCGTATAAAGAAGCGACTTACTTCAATGAATCTGAAA
TAACGGGTTATCAAGAGAGTGGCCACAGAACAACCAGATGATTTACAAGA
ACACAAAGCTCTAGCAGCAAACAACTGCACTATCTCGTAGCATCGAGGAG
GCTCGTTGTCAATTCTTGTTGGCTCAGATTTATCAAAAGACTAAAGAGTC
CGAAGAAATTCTCGAAGCTTATTTGAAAGCCAAAGAATTGCAATCAAAAT
TCGACCTTGCTGAACTTCACATGAAGCTTGGAAACTTTGAGAAGGCGGAA
CGAATATTGAAACAAACCTTGTTGAAAAATGAAACAAGCAATCAGTTACT
ATGAAGCAGCAGTGAGAGCTGGTAACCATGTTCTAAGCCTGAGAAAGCAA
TTGAGGTTTACGAAAGCGCTTTGAAGAAGAACCCCAAGGACTATTCATTA
CAAATGAAGATCGGTCAAGCATTTATCAAGACTCATCAATACGCTAAAGG
AACTGGTAGAGAAGATGCCAACTTCTGAATCTTTTCTCCTTCTCGGAGAT
GCGTACATGAGCATCATGGAGCTATTTCATTCAAGCGAGAGAGAAGATGG
CGGAAATTTACTTGAAATATCGTAAGGACAAACGGCTGTATGTTAGTGTC
TACAGAACAGGGTGATGATTTCCAATGCTGACTTTTCATTGAGTCGCGGA
GACATCGAACAAGCTCTTGAAATGTTACGCAAAATTACTCCTGATCAAAG
GTACTTGGTAAGCATCCCAATTATCCAAAAATACGTAAAGAGATTTTGGA
TAAAGCAAGAGCTCAGTTGCGGACGTGAGTTATCGTTTGGGATTCAATTA
TTTGAAAGCTAAAAGATTCGTAGATGCAATAGATGTATGTCACAAGAGTT
GTGCCAAAGCATGGGAATATCTTGGTTTCATTATGGAGAAAGAACAATCA
TACAAAGACGCAGCATTGAATTATGAAAACGCATGGAAATTCACCAATGA
ATCCAGTCCTGCTATAGAATGGGAAATACGATATGGCACAAGAACAACTC
AAAAAGTGTTTGACTTATAATAAGGATGCTGAAGACTTTGAACGAAGTTG
GCTTCTCCTCGCTGATATATTTATTCAGAATGACTATGTACCAGCGCTTT
TGGGGATGGCCACAGCTCACATGATACTCAAACAAACACCAAAAGCCCGG
AATCAACTCAAACGTATCTCCAAAATGTCATGGAACTCTGAGGAGATGAA
ACCGAGTCGTAATCCCTTAAAACAGAAGCTGTTTGAAAATCAACTACTCG
TGACCACAAGAAACACGCAACTCGTACAAAAAGCTCTCAATAACTTGATG
GAAATTGCTCAAGTTGAGTCAATATGAAAAGCACGATACTGAACAAATGG
CTATCAAGACGGCAGAAAAATTACTGAAAGGGTGAGAAAGCTTTGTTCAA
CATGATCGATATTTGTTTGAATCCTGATAGTGATATCGTTGGAGGTGAAA
CATTTGATGTCGCCGAAGGAACCAAGTACCAAAACAATGCTTCGTCTGCA
CTCAAATTTTTCAATCTTGCTCGCAAAGATAGTTTATGGCTCTTGCAAGC
AACCCACGTGCCCAAATGGAAGCTGGCTACAATTATTGCAAAGGTTTATA
TGAATGGTTATTATGATGCACTTGCCAAACTTGTCGAACTTTTACGTCGT
GCTGGAAAGCTGGAAGATGGACCAAAATACTTAGATCAGATGATGGCAGA
CTTGCTGTTCCGCAAGGGAGAGTACGATTCTGCTACTTTCCATTTCCAAG
AAATACTCAGTAGAAAACCAATACATTCTTGCATTGGCTGAGTTGTATCT
TTTGAATCAAGATCTCGATGCTTGCCAATCACAACTACAAACCATTCTCA
AGAATAATAAAGATTGCGATCGAGCTACTCTGGGTTTCTTACAACATCGG
TCAATACTATTACAATGGAAAGGACTTCGATCGAGCCATCAAGTCGTATA
AAGAAGCGACTTACTTCAATGAATCTGAAATAACGGGTTATCAAGAGAGT
GGCCACAGAACAACCAGATGATTTACAAGAACACAAAGCTCTAGCAGCAA
ACAACTGCACTATCTCGTAGCATCGAGGAGGCTCGTTGTCAATTCTTGTT
GGCTCAGATTTATCAAAAGACTAAAGAGTCCGAAGAAATTCTCGAAGCTT
ATTTGAAAGCCAAAGAATTGCAATCAAAATTCGACCTTGCTGAACTTCAC
ATGAAGCTTGGAAACTTTGAGAAGGCGGAACGAATATTGAAACAAACCTT
GTTGAAAAATGAAACAAGCAATCAGTTACTATGAAGCAGCAGTGAGAGCT
GGTAACCATGTTCTAAGCCTGAGAAAGCAATTGAGGTTTACGAAAGCGCT
TTGAAGAAGAACCCCAAGGACTATTCATTACAAATGAAGATCGGTCAAGC
ATTTATCAAGACTCATCAATACGCTAAAGGAACTGGTAGAGAAGATGCCA
ACTTCTGAATCTTTTCTCCTTCTCGGAGATGCGTACATGAGCATCATGGA
GCTATTTCATTCAAGCGAGAGAGAAGATGGCGGAAATTTACTTGAAATAT
CGTAAGGACAAACGGCTGTATGTTAGTGTCTACAGAACAGGGTGATGATT
TCCAATGCTGACTTTTCATTGAGTCGCGGAGACATCGAACAAGCTCTTGA
AATGTTACGCAAAATTACTCCTGATCAAAGGTACTTGGTAAGCATCCCAA
TTATCCAAAAATACGTAAAGAGATTTTGGATAAAGCAAGAGCTCAGTTGC
GGACGTGAGTTATCGTTTGGGATTCAATTATTTGAAAGCTAAAAGATTCG
TAGATGCAATAGATGTATGTCACAAGAGTTGTGCCAAAGCATGGGAATAT
CTTGGTTTCATTATGGAGAAAGAACAATCATACAAAGACGCAGCATTGAA
TTATGAAAACGCATGGAAATTCACCAATGAATCCAGTCCTGCTATAGAAT
GGGAAATACGATATGGCACAAGAACAACTCAAAAAGTGTTTGACTTATAA
TAAGGATGCTGAAGACTTTGAACGAAGTTGGCTTCTCCTCGCTGATATAT
TTATTCAGAATGACTATGTACCAGCGCTTTTGGGGATGGCCACAGCTCAC
ATGATACTCAAACAAACACCAAAAGCCCGGAATCAACTCAAACGTATCTC
CAAAATGTCATGGAACTCTGAGGAGATGAAACCGAGTCGTAATCCCTTAA
AACAGAAGCTGTTTGAAAATCAACTACTCGTGACCACAAGAAACACGCAA
CTCGTACAAAAAGCTCTCAATAACTTGATGGAAATTGCTCAAGTTGAGTC
AATATGAAAAGCACGATACTGAACAAATGGCTATCAAGACGGCAGAAAAA
TTACTGAAAGGGTGAGAAAGCTTTGTTCAACATGATCGATATTTGTTTGA
ATCCTGATAGTGATATCGTTGGAGGTGAAACATTTGATGTCGCCGAAGGA
ACCAAGTACCAAAACAATGCTTCGTCTGCACTCAAATTTTTCAATCTTGC
TCGCAAAGATAGTTTATGGCTCTTGCAAGCAACCCACGTGCCCAAATGGA
AGCTGGCTACAATTATTGCAAAGGTTTATATGAATGGTTATTATGATGCA
CTTGCCAAACTTGTCGAACTTTTACGTCGTGCTGGAAAGCTGGAAGATGG
ACCAAAATACTTAGATCAGATGATGGCAGACTTGCTGTTCCGCAAGGGAG
AGTACGATTCTGCTACTTTCCATTTCCAAGAAATACTCAGTAGAAAACCA
ATACATTCTTGCATTGGCTGAGTTGTATCTTTTGAATCAAGATCTCGATG
CTTGCCAATCACAACTACAAACCATTCTCAAGAATAATAAAGATTGCGAT
CGAGCTACTCTGGGTTTCTTACAACATCGGTCAATACTATTACAATGGAA
AGGACTTCGATCGAGCCATCAAGTCGTATAAAGAAGCGACTTACTTCAAT
GAATCTGAAATAACGGGTTATCAAGAGAGTGGCCACAGAACAACCAGATG
ATTTACAAGAACACAAAGCTCTAGCAGCAAACAACTGCACTATCTCGTAG
CATCGAGGAGGCTCGTTGTCAATTCTTGTTGGCTCAGATTTATCAAAAGA
CTAAAGAGTCCGAAGAAATTCTCGAAGCTTATTTGAAAGCCAAAGAATTG
CAATCAAAATTCGACCTTGCTGAACTTCACATGAAGCTTGGAAACTTTGA
GAAGGCGGAACGAATATTGAAACAAACCTTGTTGAAAAATGAAACAAGCA
ATCAGTTACTATGAAGCAGCAGTGAGAGCTGGTAACCATGTTCTAAGCCT
GAGAAAGCAATTGAGGTTTACGAAAGCGCTTTGAAGAAGAACCCCAAGGA
CTATTCATTACAAATGAAGATCGGTCAAGCATTTATCAAGACTCATCAAT
ACGCTAAAGGAACTGGTAGAGAAGATGCCAACTTCTGAATCTTTTCTCCT
TCTCGGAGATGCGTACATGAGCATCATGGAGCTATTTCATTCAAGCGAGA
GAGAAGATGGCGGAAATTTACTTGAAATATCGTAAGGACAAACGGCTGTA
TGTTAGTGTCTACAGAACAGGGTGATGATTTCCAATGCTGACTTTTCATT
GAGTCGCGGAGACATCGAACAAGCTCTTGAAATGTTACGCAAAATTACTC
CTGATCAAAGGTACTTGGTAAGCATCCCAATTATCCAAAAATACGTAAAG
AGATTTTGGATAAAGCAAGAGCTCAGTTGCGGACGTGAGTTATCGTTTGG
GATTCAATTATTTGAAAGCTAAAAGATTCGTAGATGCAATAGATGTATGT
CACAAGAGTTGTGCCAAAGCATGGGAATATCTTGGTTTCATTATGGAGAA
AGAACAATCATACAAAGACGCAGCATTGAATTATGAAAACGCATGGAAAT
TCACCAATGAATCCAGTCCTGCTATAGAATGGGAAATACGATATGGCACA
AGAACAACTCAAAAAGTGTTTGACTTATAATAAGGATGCTGAAGACTTTG
AACGAAGTTGGCTTCTCCTCGCTGATATATTTATTCAGAATGACTATGTA
CCAGCGCTTTTGGGGATGGCCACAGCTCACATGATACTCAAACAAACACC
AAAAGCCCGGAATCAACTCAAACGTATCTCCAAAATGTCATGGAACTCTG
AGGAGATGAAACCGAGTCGTAATCCCTTAAAACAGAAGCTGTTTGAAAAT
CAACTACTCGTGACCACAAGAAACACGCAACTCGTACAAAAAGCTCTCAA
TAACTTGATGGAAATTGCTCAAGTTGAGTCAATATGAAAAGCACGATACT
GAACAAATGGCTATCAAGACGGCAGAAAAATTACTGAAAGGGTGAGAAAG
CTTTGTTCAACATGATCGATATTTGTTTGAATCCTGATAGTGATATCGTT
GGAGGTGAAACATTTGATGTCGCCGAAGGAACCAAGTACCAAAACAATGC
TTCGTCTGCACTCAAATTTTTCAATCTTGCTCGCAAAGATAGTTTATGGC
TCTTGCAAGCAACCCACGTGCCCAAATGGAAGCTGGCTACAATTATTGCA
AAGGTTTATATGAATGGTTATTATGATGCACTTGCCAAACTTGTCGAACT
TTTACGTCGTGCTGGAAAGCTGGAAGATGGACCAAAATACTTAGATCAGA
TGATGGCAGACTTGCTGTTCCGCAAGGGAGAGTACGATTCTGCTACTTTC
CATTTCCAAGAAATACTCAGTAGAAAACCAATACATTCTTGCATTGGCTG
AGTTGTATCTTTTGAATCAAGATCTCGATGCTTGCCAATCACAACTACAA
ACCATTCTCAAGAATAATAAAGATTGCGATCGAGCTACTCTGGGTTTCTT
ACAACATCGGTCAATACTATTACAATGGAAAGGACTTCGATCGAGCCATC
AAGTCGTATAAAGAAGCGACTTACTTCAATGAATCTGAAATAACGGGTTA
TCAAGAGAGTGGCCACAGAACAACCAGATGATTTACAAGAACACAAAGCT
CTAGCAGCAAACAACTGCACTATCTCGTAGCATCGAGGAGGCTCGTTGTC
AATTCTTGTTGGCTCAGATTTATCAAAAGACTAAAGAGTCCGAAGAAATT
CTCGAAGCTTATTTGAAAGCCAAAGAATTGCAATCAAAATTCGACCTTGC
TGAACTTCACATGAAGCTTGGAAACTTTGAGAAGGCGGAACGAATATTGA
AACAAACCTTGTTGAAAAATGAAACAAGCAATCAGTTACTATGAAGCAGC
AGTGAGAGCTGGTAACCATGTTCTAAGCCTGAGAAAGCAATTGAGGTTTA
CGAAAGCGCTTTGAAGAAGAACCCCAAGGACTATTCATTACAAATGAAGA
TCGGTCAAGCATTTATCAAGACTCATCAATACGCTAAAGGAACTGGTAGA
GAAGATGCCAACTTCTGAATCTTTTCTCCTTCTCGGAGATGCGTACATGA
GCATCATGGAGCTATTTCATTCAAGCGAGAGAGAAGATGGCGGAAATTTA
CTTGAAATATCGTAAGGACAAACGGCTGTATGTTAGTGTCTACAGAACAG
GGTGATGATTTCCAATGCTGACTTTTCATTGAGTCGCGGAGACATCGAAC
AAGCTCTTGAAATGTTACGCAAAATTACTCCTGATCAAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000351XLOC_000351Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000597-proteinTCONS_00000597-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000597-exon-sc0000002-1575043694:1361390..1361485TCONS_00000597-exon-sc0000002-1575043694:1361390..1361485Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1360860..1360943TCONS_00000597-exon-sc0000002-1575043694:1360860..1360943Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1360521..1360593TCONS_00000597-exon-sc0000002-1575043694:1360521..1360593Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1359768..1359878TCONS_00000597-exon-sc0000002-1575043694:1359768..1359878Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1359340..1359389TCONS_00000597-exon-sc0000002-1575043694:1359340..1359389Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1355590..1355678TCONS_00000597-exon-sc0000002-1575043694:1355590..1355678Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1355189..1355315TCONS_00000597-exon-sc0000002-1575043694:1355189..1355315Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1354834..1354899TCONS_00000597-exon-sc0000002-1575043694:1354834..1354899Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1354236..1354338TCONS_00000597-exon-sc0000002-1575043694:1354236..1354338Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1353711..1353821TCONS_00000597-exon-sc0000002-1575043694:1353711..1353821Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1353192..1353273TCONS_00000597-exon-sc0000002-1575043694:1353192..1353273Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1352894..1352976TCONS_00000597-exon-sc0000002-1575043694:1352894..1352976Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1351551..1351618TCONS_00000597-exon-sc0000002-1575043694:1351551..1351618Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1351374..1351436TCONS_00000597-exon-sc0000002-1575043694:1351374..1351436Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1350486..1350581TCONS_00000597-exon-sc0000002-1575043694:1350486..1350581Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1349527..1349587TCONS_00000597-exon-sc0000002-1575043694:1349527..1349587Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1348675..1348800TCONS_00000597-exon-sc0000002-1575043694:1348675..1348800Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1348140..1348253TCONS_00000597-exon-sc0000002-1575043694:1348140..1348253Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1347534..1347587TCONS_00000597-exon-sc0000002-1575043694:1347534..1347587Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1347178..1347234TCONS_00000597-exon-sc0000002-1575043694:1347178..1347234Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1346784..1346904TCONS_00000597-exon-sc0000002-1575043694:1346784..1346904Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1346555..1346622TCONS_00000597-exon-sc0000002-1575043694:1346555..1346622Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1345241..1345767TCONS_00000597-exon-sc0000002-1575043694:1345241..1345767Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1575043694:1345044..1345187TCONS_00000597-exon-sc0000002-1575043694:1345044..1345187Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1361390..1361485TCONS_00000597-exon-sc0000002-1510915933:1361390..1361485Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1360860..1360943TCONS_00000597-exon-sc0000002-1510915933:1360860..1360943Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1360521..1360593TCONS_00000597-exon-sc0000002-1510915933:1360521..1360593Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1359768..1359878TCONS_00000597-exon-sc0000002-1510915933:1359768..1359878Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1359340..1359389TCONS_00000597-exon-sc0000002-1510915933:1359340..1359389Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1355590..1355678TCONS_00000597-exon-sc0000002-1510915933:1355590..1355678Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1355189..1355315TCONS_00000597-exon-sc0000002-1510915933:1355189..1355315Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1354834..1354899TCONS_00000597-exon-sc0000002-1510915933:1354834..1354899Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1354236..1354338TCONS_00000597-exon-sc0000002-1510915933:1354236..1354338Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1353711..1353821TCONS_00000597-exon-sc0000002-1510915933:1353711..1353821Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1353192..1353273TCONS_00000597-exon-sc0000002-1510915933:1353192..1353273Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1352894..1352976TCONS_00000597-exon-sc0000002-1510915933:1352894..1352976Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1351551..1351618TCONS_00000597-exon-sc0000002-1510915933:1351551..1351618Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1351374..1351436TCONS_00000597-exon-sc0000002-1510915933:1351374..1351436Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1350486..1350581TCONS_00000597-exon-sc0000002-1510915933:1350486..1350581Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1349527..1349587TCONS_00000597-exon-sc0000002-1510915933:1349527..1349587Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1348675..1348800TCONS_00000597-exon-sc0000002-1510915933:1348675..1348800Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1348140..1348253TCONS_00000597-exon-sc0000002-1510915933:1348140..1348253Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1347534..1347587TCONS_00000597-exon-sc0000002-1510915933:1347534..1347587Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1347178..1347234TCONS_00000597-exon-sc0000002-1510915933:1347178..1347234Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1346784..1346904TCONS_00000597-exon-sc0000002-1510915933:1346784..1346904Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1346555..1346622TCONS_00000597-exon-sc0000002-1510915933:1346555..1346622Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1345241..1345767TCONS_00000597-exon-sc0000002-1510915933:1345241..1345767Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1510915933:1345044..1345187TCONS_00000597-exon-sc0000002-1510915933:1345044..1345187Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1361390..1361485TCONS_00000597-exon-sc0000002-1491911889:1361390..1361485Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1360860..1360943TCONS_00000597-exon-sc0000002-1491911889:1360860..1360943Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1360521..1360593TCONS_00000597-exon-sc0000002-1491911889:1360521..1360593Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1359768..1359878TCONS_00000597-exon-sc0000002-1491911889:1359768..1359878Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1359340..1359389TCONS_00000597-exon-sc0000002-1491911889:1359340..1359389Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1355590..1355678TCONS_00000597-exon-sc0000002-1491911889:1355590..1355678Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1355189..1355315TCONS_00000597-exon-sc0000002-1491911889:1355189..1355315Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1354834..1354899TCONS_00000597-exon-sc0000002-1491911889:1354834..1354899Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1354236..1354338TCONS_00000597-exon-sc0000002-1491911889:1354236..1354338Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1353711..1353821TCONS_00000597-exon-sc0000002-1491911889:1353711..1353821Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1353192..1353273TCONS_00000597-exon-sc0000002-1491911889:1353192..1353273Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1352894..1352976TCONS_00000597-exon-sc0000002-1491911889:1352894..1352976Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1351551..1351618TCONS_00000597-exon-sc0000002-1491911889:1351551..1351618Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1351374..1351436TCONS_00000597-exon-sc0000002-1491911889:1351374..1351436Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1350486..1350581TCONS_00000597-exon-sc0000002-1491911889:1350486..1350581Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1349527..1349587TCONS_00000597-exon-sc0000002-1491911889:1349527..1349587Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1348675..1348800TCONS_00000597-exon-sc0000002-1491911889:1348675..1348800Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1348140..1348253TCONS_00000597-exon-sc0000002-1491911889:1348140..1348253Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1347534..1347587TCONS_00000597-exon-sc0000002-1491911889:1347534..1347587Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1347178..1347234TCONS_00000597-exon-sc0000002-1491911889:1347178..1347234Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1346784..1346904TCONS_00000597-exon-sc0000002-1491911889:1346784..1346904Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1346555..1346622TCONS_00000597-exon-sc0000002-1491911889:1346555..1346622Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1345241..1345767TCONS_00000597-exon-sc0000002-1491911889:1345241..1345767Clytia hemisphaericaexon
TCONS_00000597-exon-sc0000002-1491911889:1345044..1345187TCONS_00000597-exon-sc0000002-1491911889:1345044..1345187Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1345044..1361485 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
10.5158 9.33298 52.9765 58.2268 34.1076 25.6414 23.8765 24.9168 24.6882 23.221 19.5905 23.3183 11.9622 11.2106 9.4296 9.47951 10.0901 10.9538 10.4609 13.7167 11.9368 12.2672 7.89482 9.35112 22.629 23.0276 9.89396 7.83701 4.82853 3.74901
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom
IPR013026TPR-contain_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00000597 vs. Swiss-Prot (Human)
Match: TT21B (Tetratricopeptide repeat protein 21B OS=Homo sapiens GN=TTC21B PE=1 SV=2)

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 360/662 (54.38%), Postives = 500/662 (75.53%), Query Frame = 2
Query:    5 RVMISNADFSLSRGDIEQALEMLRKITPDQSYFIQAREKMAEIYLKYRKDKRLYVSVYRELVEKMPTSESFLLLGDAYMSIMEPEKAIEVYESALKKNPKDYSLQMKIGQAFIKTHQYAKAISYYEAAVRAGN-HVLRFDLAELHMKLGNFEKAERILKQTLLKNETTTALSRSIEEARCQFLLAQIYQKTKESEEILEAYLKAKELQSKVIKRVATEQPDDLQEHKALAAKVSYNIGQYYYNGKDFDRAIKSYKEATYFNESEITYILALAELYLLNQDLDACQSQLQTILKNNKDCDRATLMMADLLFRKGEYDSATFHFQEILSRKPSYYDALAKLVELLRRAGKLEDGPKYLDQALASNPRAQMEAGYNYCKGLYEWYQNNASSALKFFNLARKDSLWGEKALFNMIDICLNPDSDIVGGETFDVAEG--TNQYEKHDTEQMAIKTAEKLLKEMKPS--RNPLKQKLFENQLLVTTRNTQLVQKALNNLMEIAQVENDYVPALLGMATAHMILKQTPKARNQLKRISKMSWNSEDAEDFERSWLLLADIFIQNGKYDMAQEQLKKCLTYNKSCAKAWEYLGFIMEKEQSYKDAALNYENAWKFTNESSPAIGYRLGFNYLKAKRFVDAIDVCHKVLGKHPNYPKIRKEILDKARAQLR 1975
            RV I+NAD +L++GDIE+AL +L+ +T +Q YFI+AREKMA+IYLK+RKDK LY++ +RE+ E+M    SFLLLGDAYM+I+EPE+AI  YE AL +NPKD +L  K+G+A IKTH Y+ AI+YYEAA++ G  + L +DLAEL +KL  ++KAE++L Q  L +E    LS  +E+ RCQ LLA++Y K ++  + + A  +A+ELQ++V+KRV  EQPD +   K LAA++   I ++    +D+++AIK Y+EA    E++   +L LA LYL   D D+C  Q   +L++++D + AT+MMADL+FRK +Y+ A FH Q++L RKP  Y  L++L++LLRR GKLED P++   A   N RA++E G+ YCKGLY WY    + AL+ FN ARKD  WG+ AL+NMI+ICLNPD++ VGGE F+  +G   N  EK ++ Q+A++TAEKLLKE+KP   +  ++ ++ EN  L+ T+    V++ALN   EIA  E +++PALLGMATA+MILKQTP+ARNQLKRI+KM+WN+ DAE+FE+SWLLLADI+IQ+ KYDMA++ LK+CL +N+SC KA+EY+G+IMEKEQ+Y DAALNYE AWK++N ++PA+GY+L FNYLKAKR+VD+ID+CH+VL  HP YPKIRK+ILDKARA LR
Sbjct:  655 RVTIANADLALAQGDIERALSILQNVTAEQPYFIEAREKMADIYLKHRKDKMLYITCFREIAERMANPRSFLLLGDAYMNILEPEEAIVAYEQALNQNPKDGTLASKMGKALIKTHNYSMAITYYEAALKTGQKNYLCYDLAELLLKLKWYDKAEKVL-QHALAHEPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYEKAIKFYREALVHCETDNKIMLELARLYLAQDDPDSCLRQCALLLQSDQDNEAATMMMADLMFRKQDYEQAVFHLQQLLERKPDNYMTLSRLIDLLRRCGKLEDVPRFFSMAEKRNSRAKLEPGFQYCKGLYLWYTGEPNDALRHFNKARKDRDWGQNALYNMIEICLNPDNETVGGEVFENLDGDLGNSTEKQESVQLAVRTAEKLLKELKPQTVQGHVQLRIMENYCLMATKQKSNVEQALNTFTEIAASEKEHIPALLGMATAYMILKQTPRARNQLKRIAKMNWNAIDAEEFEKSWLLLADIYIQSAKYDMAEDLLKRCLRHNRSCCKAYEYMGYIMEKEQAYTDAALNYEMAWKYSNRTNPAVGYKLAFNYLKAKRYVDSIDICHQVLEAHPTYPKIRKDILDKARASLR 1315          
The following BLAST results are available for this feature:
BLAST of TCONS_00000597 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TT21B0.000e+054.38Tetratricopeptide repeat protein 21B OS=Homo sapie... [more]
back to top