Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000582 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000582
Unique NameTCONS_00000582
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2365

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000582 ID=TCONS_00000582|Name=TCONS_00000582|organism=Clytia hemisphaerica|type=transcript|length=2365bp
TCCTAACAAAGATCTTGTAAATTTTAATAATGACGAAGATGATTTCAAAA
TGCCTTCCACCAAATCTTCATCAAATAAACAGTGCCAAAGTACACCTGTG
CGTAGAAGTGTAAGAAAATCTGGAAGTTGTAGCGGTAGTAAGAAGCGTAA
GCAGAATAACAGAAGGCTACGTTCTGAATCAAAAAGACAATGCCTATCTG
AGAAAGGAAGTAACACTTCAACTATGGAGCCATACACCAATGAAGACGAA
ACAAGGATTTTAGACACTCCTGATAGGGAATTAGCAAAAACTATAGATTT
CGAACAAAGTGTTGGTGAAACACCTGGAAATTCAACATCGATTTTGAACA
CGTGTTTAAGCATAGATCCTATCGATGAAAAAGATGAATCCAACAATTCc
gttgaaatttcttttcaagaccCAAATAAAACATTATCAGCACCTGAAGA
TGACTTTCTCTGTGACAGAACTATTGGAGAGAATAATGAAACAAATGTCC
TAGACCATTGTTTACCATTGGAATCATCAGGGGTAGATCTTTTTCAACCA
GACAAATCTAAAATTGATAAAACTGTTATAAAAGAATCAAATGAAACAAA
GCTATTTGACGATTTCAATTTTACAAAGAATGAAAGTGCTCTGGTGAATA
TGAATTTAACAGATATTGAATCTTCAGCGAACAGTTATCCAGAAAATACA
TTTTATGGACTACCAATGACTGTGAAAGATATGTTACTACAGATAAGGGG
AATCCCTAGCTTATATGAATGGCAAAATGATTGTTTGAATCTTTCATCAG
TTATCAATCGAAAGAATATAGTGTATTCATTACCAACAAGTGGTGGTAAA
ACATTAGTGGCTGAGATTCTGATGATGCAGGAAATCCTAGTCAAACAACG
TAATGTGATTCTGGTTCTGCCCTATGTCTCCATTGTGCAAGAAAAGGTTC
GTGATTTATCGCCCTTTGCTGTGCAGTTAGGGTTTCACATCGAAGAATAT
GCCTCCAGGAAAGGTTGTCTGCCGCCTAAGAAACgaagaagaaagaattc
tatATTCATTGCAACTATTGAAAAAGCAAATGCTATCATCAACAGTTTgg
ttgaaaatgaaagaactgagGAGCTTGGGAAAGTTGTGGTAGATGAGCTT
CATATGATTGGTGAAGGCGGAGGTCGTGCAGCTTTGTTGGAAATATTGCT
GACCAAAATCATGTTCAAATTCACACACGTTCAAATCATTGGTATGAGTG
CAACTCTTGGTAATATGGATGATTTGAAGAAGTTCCTTAACGCTCAGATC
TTCACCAATGAGTTTCGCCCTGTTGAATTGACAGAATATGTCAAACTAGA
GGACACTTTGTATAAAGTTGATTCTATGGCAAAAACAGACGAAGAGCTGT
GCGTGGTCAACCGACAAATCACACACCCTGTGAGACTTGAGGAACCATCG
GGAAGAAGAGAAATACGCCCTCCTTCAAAACATTCACAACGTAGCCAACG
GTGTCTGTAAGACCCTGGCCAGGACCATACCCTTCGGTATAGCTTACCAT
CACAGTGGGTTAACCATGGATGAGAGGAAGCTTGTAGAGGAAGCTTATTC
TTCTGGCGTTCTCTGTCTATTATGTTGTACGTCGACCTTAGCAGCAGGTG
TCAATTTACCAGCTAAAAGAGTAATACTTCGATCACCATATGTCGGAAAC
CAATGCATGTCACGTGCTCAATACAAGCAAATGATTGGACGAGCCGGAAG
GGCTGGGATTGACAGTTCAGGTGAAAGCATCCTAGTCATCGCAAAGAAAG
ACAAGAATAAACTCCACAAATTGATCAGAGGAGCTATGGGATCTTGTTCA
AGCAGTCTGATGTACGAAAAAGGGAAAGGACTCAGGCAGCTGATTCTGTC
CCTGCTCGGCTTGAAGCCTCACCATGTCCGTCAAGAGAGAACTCGCAAGA
AAGTATCACTATAGAAGGAGAATCTCAAACGAAAGATGAACAAAATAAAG
CTGACGTCAGCAATGACACCAATGATAAGAAGCGAACCACCGATGATCCA
GTGGACGGTGTCAATGTTGGATTAACTCCCAGTAAACTGGTCATCACTGA
CATCGGACGAGCTACTGTTAAAGGTTGCATCGATATAGACTTCGTACCAA
CTCTCTACAAAGACTTGAAGAAATCACTACAAGGGATCGTGTTGGCTACT
GAACTACATTTGTTATATTTGGCCACGCCGATCGACCAAACAGCTATATT
GACGGTGAAGTGGATGACTTATTATCGCCAGTTTTCCAAACTCAACGAGA
ATGAAACGAAAGCAGCGGAAATGATTGGTATTCAAGAAGGCATGTTAATG
AAGAAAGCCACCGGG
Run BLAST on NCBI

transcript from alignment at sc0000002:1132381..1165239-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000582 ID=TCONS_00000582|Name=TCONS_00000582|organism=Clytia hemisphaerica|type=transcript|length=32859bp|location=Sequence derived from alignment at sc0000002:1132381..1165239- (Clytia hemisphaerica)
TCCTAACAAAGATCTTGTAAATTTTAATAATGACGAAGATGATTTCAAAA TGCCTTCCACCAAATCTTCATCAAATAAACAGTGCCAAAGTACACCTGTG CGTAGAAGTGTAAGAAAATCTGGAAGTTGTAGCGGTAGTAAGAAGCGTAA GCAGAATAACAGAAGGCTACGTTCTGAATCAAAAAGACAATGCCTATCTG AGAAAGGAAGTAACACTTCAACTATGGAGCCATACACCAATGAAGACGAA ACAAGGATTTTAGACACTCCTGATAGGGAATTAGCAAAAACTATAGATTT CGAACAAAGTGTTGGTGAAACACCTGGAAATTCAACATCGATTTTGAACA CGTGTTTAAGCATAGATCCTATCGATGAAAAAGATGAATCCAACAATTCC GTTGAAATTTCTTTTCAAGACCCAAATAAAACATTATCAGCACCTGAAGA TGACTTTCTCTGTGACAGAACTATTGGAGAGAATAATGAAACAAATGTCC TAGACCATTGTTTACCATTGGAATCATCAGGGGTAGATCTTTTTCAACCA GACAAATCTAAAATTGATAAAACTGTTATAAAAGAATCAAATGAAACAAA GCTATTTGACGATTTCAATTTTACAAAGAATGAAAGTGCTCTGGTGAATA TGAATTTAACAGATATTGAATCTTCAGCGAACAGTTATCCAGAAAATACA TTTTATGGACTACCAATGACTGTGAAAGATATGTTACTACAGATAAGGGG AATCCCTAGCTTATATGGTAAACACATTTTGAAAGGCTTTATCAGACCTT CTCTACCAGTCTCTATACTATTTTATATGAGCTCTTTTGTTTTCAATTCT ATTGCAGGCATAGTGGAGGAGACTAATAAAGTACCAAGGGAATTCTTCTT TAGATGTAGCTCTTTGGAAATGTGACCACTGCCATTTGTTGCTCATAAAA AGTGTTCATGGTTTTCTTTTGTAATATATAATATTAGTATAATACTTTAT ATAACCTTTAACATCTTTATCTTAGAATGGCAAAATGATTGTTTGAATCT TTCATCAGTTATCAATCGAAAGAATATAGTGTATTCATTACCAACAAGTG GTGGTAAAACATTAGTGGCTGAGATTCTGATGATGCAGGAAATCCTAGTC AAACAACGTAATGTGATTCTGGTTCTGCCCTATGTCTCCATTGTGCAAGA AAAGGTACATACTCACGTTTCTTTTTGAAACTTAAAGCTATTTTGAAATC TAAGTGATATCGTAAATTTTTATTTAATGATTATGATTTCTTTTCACAAG TTCTATCATTTTTCTTGGATTATTTTTGCATTGGAAGAAAATGTTTAATT GTTGTTTATTTTTCAATGGAAACCTTTGATTTCTTAAAAAGGGACATCAG GCCAAATTTTTAACACACATTTTTTTTGCATTTAAAAAATTTAGAATGAG GCATAAGCTATATGTGTTATAATAGACGTTTGAAAATTTCGTTTTTTTTA ATCTGCGACATAACGAATGTGTTTCTAGAGATGAGACTTTTTGAACAAAA TTTGCTAAACAAGGTTTTTGGCAAAAAAAGAGAGCTTGCACAATTAATGA AAACGATGGAATCGAAAATAACCAAAATACAAGATGTTTGATGAATAAAA TGATATTTTATTAACCAACTCATTAGACATAGAATCTGACAGAGTCAGAT GAAGTAATCAGTGGGTTTTGAATTCCACATATGTCATGTAATTAACAAAA ACCTTTTTCATTTTTTTCCAGCAGGAAAAGTGTCATCATCTGCTCTATGA AGTGTCTTTGTAGTTAAAGTAGCTTTATTTAAAAATAAAACCCTGTTTCC AGCTTGAAATCTAATATACGTTCTTTGTTTCGTAATTCGAGCTGTTCTGA GTATGAAATTGGTGGCCTGAAAATTGGGGGATCTGTTCAAAAAATCGCAA ATCCTTCCAAGCTGGCAAAAAAGAGCAGATATTTTTGTAGGCTATGTCAT ATTTTCCTGCGTTTCGAGCGTAAAACTCCTAATTTTCGGGATATGCACAC TGCTCTTGTTTTGAAAATTGAAATCCTCCGGATGCATTGCATGCGCACTG AGGTTTTAATGAAACAATAGAGAGTTTCAAAACCTAAGACAATCAGCTCT GTTTTAAAAATTCTTTTATTTTAAATTGTACGCTCCCTATCACATCACAG ATTGTTGATATGTGAGAAATGTGAAGTGTCATAATTTGAAAAGAAAACTT TAAAGATAAAATAGTCATCACTAAAAAATTGATTAGCATGTTTTCCACAA AGATATAAAAATCAAAACAACTTTTTGCACGCAAGAAATCCTTTAGTAGC CGGTTTCCTTTTGAATTTAATAAGACCAAAATACCTGATTGTTATGTATT TTTCAAAGAAAATCCTTTAATTGTTGTATATTCTTCAAGGAAAATTCTTT TGTCGTTGTGTATTCTTCAAGGAAAATGCTTTGTCGTTGTGTATTCTTCA AGGAAAATGCTTTGTCGTTGTGTATTCTTCAAGGAAAATCTTCGATAGTT GTGTATTCTTCAAGGAAAGTCCTTGCTTGTTGTGTATTCCTACAGGAAAA TCCTTGATTGTGGTGTATTCTTCAAGGAAAATCTTCAATTAATGTGTATT CTTCAAGGAAAATCCTTGATTGTTGTGTATTCTTCAAGTAAAATCCTTGA CTATTGTATGTTTCTCAAGGAAAATCTTTGATAATTTTCTATTTTTCTAT TTTTTCTAGGAAAGTTTTATCATTATAAAGGATTATTTTTCGAATGTTGT GTATTCTTCAAGGAAAATAAATCTGTGATTATTTTTTATTCTTTAAGAAA TTGATAAATTTTATCTTATAGTATTATATGTTCTTCAAGGATAATCTTTG ATGGTTGGTTCATTGCTCAAGGAAAATTTTTCATTTTGATAAGGAAAATC CTTTTTTGTTGTTGTATTTCTGAAGTACTTTGATTATTGCGTTTGCAGAA AAATCTTTGATTATTGTGTTTAAGGAAATTCTTTGATGATTGGGTATCCT TCTAGCTCTAGGCAAATCTTACTTGACAATAGTGAGGTCGTGTTTCTGTT TTTTATATGTTTTCCTGTTTTTAGGTTCGTGATTTATCGCCCTTTGCTGT GCAGTTAGGGTTTCACATCGAAGAATATGCCTCCAGGAAAGGTTGTCTGC CGCCTAAGAAACGAAGAAGAAAGAATTCTATATTCATTGCAACTATTGAA AAAGTATGCTTTTTTTTTACTCTGCCAAAAAAATCAACCTTTGGTATTTT AATTAGTCTCATTAACNATATTTTTCTTTTACTCTGCCAAAAAAATCAAC CTTTTGTATTTGAATTAGTCTCATTAACAATCTTCGGATTCTTTTGATTC ACCACCAGCCTCGTGCTCGAACGATTTTGGGCGAGATAATCCTCTTTAGA TTGCAAGCTACTTTCAGCTACTTGGAAAACCTATAGTAAAACAACGACAA ATCATCATTTGTTTCAATTCAAGCATAATAAATTATTTTATTCACTTCAT TATTGGGAAAAACTTTTGACGAAGTTTTTCTCGACAATAACTTGCCTGAT TTAAGGTTTTCTCCTTTACGATATATAGAATTCCTTTCTCCTCATCAGGC AAATGCTATCATCAACAGTTTGGTTGAAAATGAAAGAACTGAGGAGCTTG GGAAAGTTGTGGTAGATGAGGTATGCTTTCTCTTGTGTTTTCTAAACTGA GAGGTCTTTGAAAACGAAAAACCTCACAAACGTCGGATTCTGCAAAATAA TACTCCGCTTTTCACTAACGAATCATAATCTTAAATAATTATACATTTTG TTATTATGCCACCTTTTGCATATTTGGGCTCTTCCAGAAAATTTTTGTAC ATGGGGGATGGAGGATATAGTGTCCGCTGCGGGTAGTGAAAAATCTAGAA AATTTGCCTTGTCCGGGGGGGGGGGGNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAAGTGG GGGGGGGGGGGGGGGGGGAAGAAAAAAAATTAAAATTTTTGCGTGGGGGG GGGGGGGGGTAAAGTTGCTCTGTTTGGGGGTAATTTTGCTCTGTTTGAGG ATAATTTTGAATGTCCAGGGGGTCAACTGATGCTTGTCAGGAGAGTCAAC TGATGCTTGTCCGGAGAGTCAGACCTGCTGTCTGGGGGTCAAAATAATTT TCCCAGTTAGAACAGTCTAGTATGCTAGACGTTTAATCTAGACAGTAGAA AATAAGCAAGAAATAATGGAAATAAAGAATTTTAGTTTTTAGAAACTGAA GTTATCCCATGACAATTATTGTATTGTCGTGGAACACCAAATACCACTGT ATTACATGGATCATAAACGATTCCATTCTACTGCCAGAAGTATTTCAAAT TATCTGGACAGCTATCATTTTCATCTTGTTTTATAGAAGTTGTGAAAAAG GAGTCTGTATTTGAATTACGATTCTAGTCTAGAACCTGATTGTTAAATTG AATTTTGTTTTTTAAAAGAGGGGAGGTGTTAATTTTGTAACATGATTTTT TTTTTTCCGTTTTTGTCTGGGTTTGAACTGTATGTACGAACGGAATTGAA TGTCTTTTCGTCGAATCTAGTTTTTCTTTTAATTTTTGAAAACTAAACTT TTACTTATAAAACTGGTAGATATCGATAAAGCTCTAATCAGGCATTCCAG AGAATAACGTATAAAGAACAAGAAGTTTTATTTCGTTTCAGCCAAAAGCT TTCCGGTAAAAAAATCATCATCTTCAGTGCTATTTTAATGTATTGCACTG AAGATTTTTTTTTTACCAAAAGATTTTGCCAAAATAAAACTTCTTTCTAC ATCATATCGATGAAGGGATCACTGGTTGTATGTTAGACTTTCTCTCTCGA AATGTCTTGTAAAAAACAAAGAGGCTTTAACAGGGGCGGGGCTGTTTCTG TTCGGGGGTTAAACTAATGTTAATAGCTCCTGATGAGCTTTTGGCATGAA ATTTTCTGTAAATTATTAACTGTTAGCTTTAAAATAGAAAAAATTTACAC CTAAAAATTTTCACACAATTGACACATTTCCAATACAAATTTATTCTTTA TGTCAAATATATCGTTTAAACCGTAAATTTATTTAATATTTAGGATAAAA TAAGCATTTTGGACCAAGGGCATTTTGTTCTTAAGCCTTTTTTAGAATAC AATAGCTATTTTTAACAACGAAGTAAATTTTCGGATTTTACTCATTTTGA GCATGATGAGTGAATTCAACAAAAAAACATGACAAGGATCTTGTGTGCCA AATTTCATCCAAAAAAAGACCCACTAGATCAAAAGTTTAGGGATGGTACA GGAACAGCTCCCCCTAGTTTTGAACCGCCTCTAAAAGCCTAGTATGAATA GGGTTAAAGAGAGATGTCTTATTGATTTTTTATCGGCTTTATCTGAATTC AAATTTGAAATTTTGTTTGATAATTTTCATTAAGTTTGTCAAATGATCAA GGAAAACGTATGTAATCAGAGTTTAATTTAATCAGCGGGACAACTTTACA ATAAAACTGTTCATTTTTATCATGTTCTTTCTGCCCTCTCACTTTTAAAT ATTTAACTTTCTTTTTGTCTCCAGTAGATGTTTAATCCAATATGTTATTT AATAAAGACTATGTTCCCTGCAGGTGTATTTCGCGAATACTGTTGATTTG AAGTGAACACAAGAAATAAACTGTGAAATTCGAGACTACATTGACTCTAG CTTAGAACGAGTTCAAAGTCACATAGATCGAGCTTTTCGCTTTTGATACA ACAATTACGTTCTACTCAAATATCACCTCGAATCAACCAAAATTTCAAAC TGAACTCTATAATATACTGTTACCGAACAATTTGAAGAATACCCGTTCAA TTAATTTGAAGATGTAAAGCCGATTCTCGAACAGATATGGTCAGACATCT CCAGCTCTGTCTGGCAATACTGCTTTATTTGATGAACAAAAAATGTCACG GGGTTGTTGGTCGATATTTATCTCCAATCGGTGATCCATACAACGTCCTT GGGATTGGTCAATCTTGTTATAATTTACCAATAAACCAAACTTCAACATT GAATTTGAAATCCAGATATCACAACAAAGCTGTGGATTTCTTCTTCAAGA AAAATGACTACATACACCCATTATTCAGGAATAAAAGACTTTTCTTTTAT CGATACTTTGATATATGTGGTGGCACTGATACAAATAATGCTGAGCAACT GGTGACTTTACTGGTTGATTTGCTGTTGAATCCAACATTCACCATAACCA AGGATCCTTCCAAGAAAGCTAGACGTAAAATCACCAACTGGAAATACAGA CCTAACATCCTTATCATGTTTACATATCTAGAGGACCACCTTTTTAAACT CCTCGCTGAAATGTTAAGTAAAACAGATATTCTGGTTTTAAATTTACGAA GTGACATTAGATTTCAACAAAACGCGTTTATTCTACCCTCACTAACGCTA GGCGCTGTCGATAAGGTGAAATCAAGTTTTCAAAACTTGACCAAAACGAT GAATTGGAAATACGNCAACTGGAAATACAGACCTAACATCCTTATCATGT TTACATATCTAGAGGACCACCTTTTTAAACTCCTCGCTGAATTGTTAAGT AAAACAGATATTCTGGTTTTAAATTTACGAAGTGACATTAAATTTCACCA AAACGTGTTTATTCTACCCTCACTAACGCTAGGCGCTGTCGATAAGGTGA AATCGAGTTTTCAAAACTTGACCAAAGCGATGAATTGGAAATACGTCACT ATTGTGTTTCTCCAAGACCAATATTCGAATTCTGAATTTTATTTCAAAAA TTACCGAGATCTATTTATCAAATCTACATCATGTTTCAACATTGAAATTG TCAATGTGTTTCACTTTACGCCTACAGTAGCAAAGCTAAAGAATGACAGT AGCAATACTATAGTTTTAATCGGCTCTTCCATTCAACAACAACTGTTTTT AAGGGACTATGGACGTTCCAATAAAACATGGTTCGTCAACGAGAACTACA GGCCGTTATCTACGGGCCCCGGGTTTATAATATCGTTACGTGATAGCCGC TATGAACGAAAGACAAGGTCGTTATCCATTGTTAATGGACACGCTGGACT TTTCCACTATAGAATGTTGGATAATGTTTTGAAAGGTGTTTTTTCTTTGG AATACATTGTTAAACTTTACGAGGACTTGAATTTCTTTATACAACAGTAC AAAGAAAAAGCTCGCTACTTAACTGATCTTTTCATTTTGAAATGGTATGT TCGCCAGAGTTTTTATTATAGAGATTTCAAAGTTTATGTTAACAACAAAC AGATTCAAAGCTCCTTAGATATTGGTGTTCTCTCTCTCATGTTAGCGCCC TATAAAACACCAACCGCCTGTCCACCAGTCGATTGTACACCTGGCACAGA ATACATGTATACCAAGTTAGCCGCTAATCAGACATACTGGAATGAATCGT ACCGGTGGACGTGTCAACCCTGTGCGAACGGCTTTTATAAAGGCTCTTAC GGAAACACCACGTGTCGGCAATGTCCCATAATGCACCTTCCGAATAAACG AAGAAACTCTTGCTATGATCCTTATAGTAAACCAAGCATCTCTTCTCAAA AAACGTTCGCAATATTCGCTTTTCTCTTGACTTGTATTGGCTTACTATTT TGCCTTCTANAATTGTCAATGTGTTTCACTTTACGCCTACAGTAGCAAAG CTAAAGAATGACAGTAGCAATACTATAGTTTTAATCGGCTCTTCCATTCA ACAACAACTGTTTTTAAGGGACTATGGACGTTCCAATAAAACATGGTTCG TCAACGAGAACTACAGGCCGTTATCTACGGGCCCCGGGTTTATAATATCG TTACGTGATAGCCGCTATGAACGAAAGACAAGGTCGTTATCCATTGTTAA TGGACACGCTGGACTTTTCCACTATAGAATGTTGGATAATGTTTTGAAAG GTGTTTTTTCTTTGGAATACATTGTTAAACTTTACGAGGACTTGAATTTC TTTATACAACAGTACAAAGAAAAAGCTCGCTACTTAACTGATCTTTTCAT TTTGAAATGGTATGTTCGCCAGAGTTTTTATTATAGAGATTTCAAAGTTT ATGTTAACAACAAACAGATTCAAAGCTCCTTAGATATTGGTGTTCTCTCT CTCATGTTAGCGCCCTATAAAACACCAACCGCCTGTCCACCAGTCGATTG TACACCTGGCACAGAATACATGTATACCAAGTTAGCCGCTAATCAGACAT ACTGGAATGAATCGTACCGGTGGACGTGTCAACCCTGTGCGAACGGCTTT TATAAAGGCTCTTACGGAAACACCACGTGTCGGCAATGTCCCATAATGCA CCTTCCGAATAAACGAAGAAACTCTTGCTATGATCCTTATAGTAAACTAA GCATCTCTTCTCAAAAAACGTTCGCAATATTCGCTTTTCTCTTGACTTGT ATTGGCTTACTATTTTGCCTTCTTGTTTTTATTGCTTTCGTGAGATATCG AACTACTCCTGTGATGAAAGCTGCTCATATTCCTATGACGTATGCCCACT TGCTTATGATTTGTACAGGATTAATTGTCCAGCTATTCGCTTACTTTGGT GAGCCTTCTATTGGTAAATGCTTTCTTCGATTGATAACATTTACGTTGTT TTACACACTCATGATTGGTATGATACTCATCAGATCGCAAAAAGTATTAA GAGCATTTACAATGCGAGTGAAAATGACTCGAACAGACTTACGAAAATCA AAAGCTGGTGAAATCTTTTTCATTTTGGTCCTTGTCTTGGCTTTCAACTT GATATTATTCGTGCTGGCTTACACGGATCCTGTCCAAATTCATATTTGGG TCGACCAAGAAAAATTGACGAGGACATCTTATTGTGGTGTCGAATCAAAA CTCAATTTTGTTATTGGATTTACCATATTACTACAGTTCATTTGTTTCAT CCAAGCATTCCGTGGTCGGCGATTACCGGGTGCTTTTAAGGAAACCATGT CAATCGTTTATGGTAGTTTTATTAACATACTGGTTCTCACCGTTTCTTAC CCTATATCTATTTTCCAGAAAGATATTTTGAATCGTGAAATTGTGTATTG GATTGTTGGTGTATTATGTATGAATATTTTAGTGATTTTTTGTTATTTTC AACGCGTTTATGTAGCCATTTTTCGACCTGAGTTGAATACAGTTTCATAT TCGAGGAATTTGTTGATGAACAAAATGAGTAAGGATTCTTCAAGAGCAAG TGAAAGAACGATGTCAACGGCCATAAGTTGTCAATGAACGACAACTGTAT ACTTTCTCGGATTTATATATTACTTAGGTGTACAAACCTTCGCGAGCAGA GGTAAAAATTTGCGAAATTTATGGCATTTGCTTTAGCGAATTTAACGAAA AAAGATGTAAAAATGAATATTTTCACACGAAAAAATTACTTTGGGTGACA AATACTTCTTTGAATCGGGTTAAAAGGGTTTTTTCGCAAATGGCCCTTTC AAGAATAAAAAAATGGACTAAAAAGGATTAAAATTCGCGCAAATCGCGAA AAAATTCCTGCTCGCGAAAGTTTGTACGTTTGTACCCAAAGTATTATATG TTTGTAATTAATTATTTTATGAAGATTGTTTTTATTTGATCTTTAGAATA GGAATCTAAAAACTCAAATCCTGATGCAGTGGAGTCTCGATAGCTCAAGC CTCTATCACTCCAAACAGTTAGCTGTTTCCTTCAGTTAGCAACGCGTTAT AAACTATACTCCATAAATCCAAATCTCCTTAACTCGAACAAATTTGCTCT TCTCATGCGTGATCGAGTTAAAGAGATTCCATTGTATTCTAGGAGGGTGT GTTGAACGGTGATTAAGAATACGGCTATCATTATTTGATTAATCCGATCC AATTCGGTTCTCAAGGAATACCGAGTTTATGTCTCGGAGGATATCGAAGG CGGCTGTAAGTGAAATTGATACAAAACAAAGTCGATAGTTGATGTACGAC TCTATATCGCCTTTGCTCACCTAAAAAACACGGTATTTTGGTGTTTTTAC CGTCGTCGAGCAAAGTGGACGGTGATTTTGGAGACATGTCAACTTTGCTT TATACCGTCCCCCTCGATTTTTCTCGAATACATAAACTCGCTAATGCAGA GTACAAGGAGGAAATTCGAAAAATTAATCGATTCGTAGGCTGAATCATAA AAATCTGCTAAAAACCGCTTGCTTTATGCCACACGGTAATTACGGTAATT TATAAACCCCTGAAATATGATCCTAAAAGCTCCCTGGTCGTGGTCCTGCA CAACAGGGAAATTCAAACGAAGGAGAAACCAAAAAGGCAAGAATTTAAAG CCTATTCAAGATCATCAAAACAAAAGATCAAATTCATGTTTTGATATGAA TAAGTAATTGATTGTGATATTCCTTTAAATCCCAAATAGCAGTTCTGAGC ACTAGAAAGTTATGCAAGGTTTAGGGTTATCTAAATTTCCTTTTGTCTCA AGAATGCATATAAGAANCTAGAAAGTTATGCACGGTTTAGTGTTATCTAA ATTTCCTTTTGTCTCAAGAGTGCTTCTTATATACTAGCTTCATCCGTTAA TCTGTATTTGTTCATTTCTTAGCTTCATATGATTGGTGAAGGCGGAGGTC GTGCAGCTTTGTTGGAAATATTGCTGACCAAAATCATGTTCAAATTCAGT AAGTTGTTACTGCGCATGTCACAGTTTGAAATGAAGATGGAGGGAATTCT TTTTCTCCAATAAGTTTTAGATAATCTTCATAGTGTTCTTCTTATCGAGA GTTTATTATTATTGTATTTTCTTTTAATATTTTATTTTTTTGCTCGAGAC TTTTTTAATGACGTGATCTTTTCTAAAGGCAAAAGCGATTGATAAAGGGT TTTCGCACATTTCGCGATAAAGTGGAGTCCGGCCTTTAATAGCGTAAAAG TCGATCAATTTTGAAATTTTCAGGTTTTCGTTTATGTTTTGATCCTCATT TTCTCTCAAAATTATTCTTAAAGATATGTAGTCGATTTATTTGCTAGCCT AGTAATTCCTTAAGGGAGAAAAAAAGTCGGGGATGTTTCTTGCAGAAAAT CTTAAAAGGAAATAAAAATAGATTCAAACTGAAGTACGGACATAATCTGC AATAATAATCTTCTAAATCAGAAAAGTAAAAGCTATCGAAATTCTGCAAC AAAAACTCAAAAAAACATGTATCTTAATTTGTTTAGAAAATTACAAAATT ACAAAAACTAAGTAAAATGCTAAATAGAAAAAAAGTATCGGATACTAAAA CAAGTACGGACTGCTTAAGAAAATGATCAAAATGCTTATAAAAAAATACT ACAGTATCAAAAAATTGTTGATACTGCTTGTTAGATCGTTGAATTATGTT TAATTAGCGGGGTCAGGTTTTGCTGTGTGATTGTTAGGGTCAACGCATGC TTTGCATGAGTCATCGTATTCCAATCCAGCTTGGCATTGTTTGCAATAGG TGATTTTGTTACTGCAATGGTAGAATTTGGTTTTGTCGTTAAGTACGGCA AACATTCCGTCAGTTTGGGTTGTACAGAACGTAGTATCGCATGTGACGGG AGCAACCGTATCTGTTACTGTGGCAACGACCGTTGGACACGTGACTTTGG TTTCTGTGGAGATGAAAGAGCAAGATATCGAAAATGTTACTGTTGTCACT AAGCTCGAAAACAAAAACTGACCTCGCCATACTTTTTGCACTTTTAGTTT TTGGAGCAACCCTGTGTAGGAGAATAGATCTTATCGGAGTTATTGATTTT TCTAAAAAAGCGATGCATTGTGGGACTGTTTCGGGGGGATTACAATAGAA ATCTCTTAGGAATTCCTCGAGGGAATTCTATTGTAATACCCCCGAAACAA TCCCACAATGCATCGCTGTTTTAAAAAAATCAAAAACTCCGATAAGGTCT ATTATCGACGTATAAAGAACTAGCTTACAATTGCGACACATTTTTTCATG CTGGCACAAACTTAACTTATATTATTATTATTACAGTCATTTCTCTCTAG TTCGAACCTCTGTTATTCGAATCTTTTTGTAATTCGAACTAAAACATTGG TCCCCTCAGCTGGAGAGTGGTATAAATCACTCTCTGTAATTTGAATCTTT CTTTAATTCGAATGAAATTTTTGGTCCCTCTTGAAGATCGAATTAGAGGG AGTCAACTGTACTCTGCCTGCAGATTGCACTAGCATGGAACACCGTTTCA CTGTATGTAGACGGTGTCAATAAAAGGTTCAACCCACAGTTCATTTCTNT TGGTCCCCTCACCTGGAGAGTGGTATAAATCACTCTCTGTAATTTGAATC TTTCTTTAATTCGAATGAAATTTTTGGTCCCTCTTGAAGATCGAATTAGA GGGAGTCAACTGTACTCTGCCTGAAGATTGCGCTAGCATGGAACACCGTT TCCAGTATGTAGATGGTGTCAATAAAAGGTTCACCCCACAATTCATTTAA ACTAAGTTTAAACTAAGAGTTCTTACCGTCGCTTTCTCTTAAGCACATGT TACATTTGTTGATAAAGTGAAGGTTGGGTGCACTGCATTGTTGGCATTCC GGTTGTCTGTTATCCTCAAAACATGTGTAAAACCAATTGCTGTTGTCAGG ATGACGAAAGTTACCGACTTTGGTTCCACCAAAAACACCGCACTCATCCA ATGAAACACCTGTAAAGGATTTTTAAGTTTTTTTTTACATTAGGCCAAAT ACGTTAGGAGTTTTTTTCCCATATTACAGTGCAAACCCGGGGGGGGGGGC AGTCAGGCAAATTGACCGACGGGTATTTGCGGCGGTTAAGAGTATGTTTT TCATAAATGCACTGTAAGGGTGGAAATTTCAGCAAATTTGGGAAAAATTG CAAACTTTTGCTCGAAAGTGTTGATTTTTTTTATCTAAAAGAGTTTAAAA TTTGAAAAAATGCACTGTAAGGGTATAAATTTCACCGATTTTTTTCTGCA CTGTAATGATGCCATTCTAAAAGCCAATTTTTTCGCCACACATACCATCA GTTGGTAAACCGAACCCACTGCCTCCCCGGGAGCGCAGACCAAACGTGCT AGCCTGAAACTTAGAGTGATTACGTTGGACAGATTGTTTTGGTAGCTGTC ATCATTCTTGTGTTGATACAGATAGGGGGAGGTCTGTAGAGGTTCCGTTT TCCCGTCAAAAGTTTTGCTGAATCCCGGAATCCCGAAAATTGAAAAAAAT AATAACACCGTCACACCGGTTTGTAGAGGTTACAATACCGGTATGATGAC AGAAAATAAGGCTAAATACCGTCACTGTCTGATTTTAAAATACCGTTTTC CCGTCACTTTTTTCGTCAAATCCCGTAATATCGTACTAAAAAAGGGGCAA TCCCGTCACACCGTAAAAGTACAACATCCCATACTTACATGCTTCTGTGA CACGAGCTCGAGTTGGTTGGGTTGTGAAAGCAGGTTTTCCTATGAAGGAA GTTAGAAATAATTATGTAGACTTAGTTAAGATAAAAATTAAACTAACTAA GGTTTAAAATCTCTGGTCAAAAAGAAGTCCAAAGTAGAAAATATTCAAAT CCGTTTTGATTCCTACTGATTTTCAAATTTCCAGCCTGGAGAGTATTTAG AGTTAAGATAGTATACCTTCTGTGAGGACGATCGCCAGAGCGAAGAATGC CATTAATTTCAATGCCTCCATTTTTTAAATATTTCAAGTCGACTTCAATC GTCAATTAGCTGAAACTTCTGCTGGATTTGCTTTGGTTGCTTTGCGTTGT CGTTTGTATGATTTTCAAACCAAAATCTTCCATCTTTTATACAGCTTCGT TGTCAATTAGTTACATAAGAAAAGGTCAAACCTCAAAAATTAAAGATAGT ATAATGACATAGTACTATTTCTTATTATTTTCTCACTTTACTGTAAAACC CTTTTATTACTTTGGGAAATCAGAATCACGATTTTCCTATCATTTAAAAT ACCCCAATTTTTTTAGTTACAGTAATCATTCAATTTGAGTAATACAGGTA TTTTAATGATTTTAATTGCCAATTAAACTCAGGTAGATCTCAATCATTTT TTTCTTTGATTGACATGGAATGAGATTAAATGTTATCAATTCAGGTCGTA GATATTGCAGGAAAATTAATGGTTCTATCCAAAAAAAACTTACATCGACA TACACAGTTTCTAAAATTTTAGAGTCAAGTGCAACTAAAAAAGTCTGGTA CAGTTTGTACAGTTTGATACTCTCTTTGAGTGAACCATTGTTAACAAATT CTTAATAAAACCTCTTTACAAACTAAAAGAACTTTCCAAACTACTTTAAA CAACATCAAAACATCAGTCACATTTATAAAGGTTCCTTTCCATCAATCGG CCATTTTTTTAAAAATTAACATGCAGTTTTCATTTTTGATTTGTTTATCT TTTTTGTCAGCTTTTCCCATAAATTATGCGCGCGCATAAAAAAAATCGAA AACATCGTAAATGATGCACTCGAAAATGCAGGGACAAATGCAAATATCCC TGCAGACGAGTTAGTTGTACCAGACCGTAAACCAGAGACAAGATTATAAA AAAAAACTAGACGGTGAAATAGTTTACTGTCTGGATATCCAGGCTAGTTT TTCTCCTGTAAAATCTGAAAGGGAAATAAGACTCAGAAAGACATAAGTGA GGGCCAACTATGGTTTGGCCCGAGGGGGAAATTTTGAAATTTAGAGCTCT AAATTGGCTAAAAACACACTCAAAAAACAAAAATAAAATTTAAAGGTAAA ATACTCCATTTTATGAAAAAATCACTCTTAAAAAATAATCCCCCCGTAGC TACGGCACTGTTTTCTTTTCTATTGGTGGTACTCAGGTTTGTGCTCAACA TTTATAATTATAGTTTTTGAAGGTCGAGCTCATAGTAAAAATATACTTTT GATTAAAAGTATCTCTATGTCTTTCGACCCCCATGAAATTGAACAGTTTA CCGGGATAGAATCGTCATCGATTAATGCTAAATGCTAAAATCTTCTTAGC CGCAACTTTTTACAAGATAAGTCTATAAAAGTCTTACTCGTCATAATGTG GAAGCTTCAATAAGACCTTTAAAATTTTTATTAAATGTCACAGAAGAAAA CCCTTTTTCTAGAAGCACCTTTTCTACACCGATGGAGCTTAAGCGTAAGG TTTATGCATGCCACAAAACAACTCCACCTTCATTTTTACTGGCTTTAGCC TAAGAACTCTTCTACTGAGTATCCAGTGTTCAAACTTCCCCCGTCTCAGA CGGATTTCCGTCTTAGTGAAGTTAATAAAGAGGGATTTCGGTCTCAAAAT TGAACATAATTTGCCGAAATTTCAAGCTGAAATTGCTATTTGAAATTCTT TTTCCGTCCCGGACAAAAAATCTTGGTTTGACCACTGAGTATCTAACTAA ATTGAATCAAACATTTTTCTCTGAGGCACATGCTTTAAGAAATCAGAATA CAATTTCTGCTCAATTGCATATACAATGATTGATTGAATTATATAGATTA CTTAAAATGTTAATTTTCCATTGACAACCTCCTTTCGAAATAATATCACG AACCAACACTGTCTCAACCATCAATTTTCCTGTAACTTTTCATCACGAGC ATGATATACCACACCTAACATCCGTAGCTCCTCTTATATTAACATTCTCA CGATTTCAAAATACACGTTTTATAAACATTTTAATGCTTTGTAGGCTAAA ACACCCAATTTCTTAGGAAATTATTACACAAAAACACTCACAACATGGCG AAATTAAGAACATATTTAAGCTTTATAAACTAAATAAATAAAAAACAACT AAAGGCTTAAAAAATGTAGATCTTCTCATAAAAAACATGTACGTGATTCA AAATCAAAAGGTAATTCTTGAAAGACAATCGATGTGTAAAACACCTTTTG ATTTTTAAAAATGGAAGGTCAACATTATCTGCAATATACATTGGGGGAAA TCACGATTTCTGTCCATTTTCCTCGTTTATTATCTTTTACTGACTCAATC TGACATTTTATATAGGATCTACTTACCTTAACACTGCCATAATAACAATG ACAATGGAATAACGGGGCAGAGGGGGAGCTGATTTTAAAATATTCTTCTT TCAAAATTTTGGCATTTTAGCGGGAATTCGTGTAGCCAGTATCATCATAG AAACCTTTTGCTTATAAAAAGCTTGCATGTTTGATGCAGGATTACGCATT TGTCTGTAAGCAATCCCAATTTTCGGATCAGGTCTGGAGTTACTAAAGAT TTTCCGGATTTCAGCCAAAAAGCTGCTTATGGATTTTGACCCAAAAATGC CTAGCAACTTCAAAAACTTTGACTTTCCATCTCATTTTTTGTCTAAAACA CCTTAAATTTGGTATTAAAATACCATCCATACACATTTAAATGCCAAATA ATGCAGAAAATGCCTTTTTTAAGGTATTTTTTGGTTCCTTTCCCGGTTAA TGCTCAGTATGCAATCTAGATTGCTAAGACAAAGTTGCTCTTTTTTTTGG CCATTCTCAGGGCTGGACCCTTATAAAAAAATATGTTTAATCCCAATCGG GTACTTTGCCATACTGGTACACTTTTTCCCGATTATACCAATGAAAAAAC ACCTTCCACTACCCGCTCCTGAAGACTAAGCACTAATATGATATAATGAC AGAGTAAATGAACTCTTTAAATGCTTTAAAGTGCTATAGAGCAGGCAGAC CTCAAGATACTGAGCATGATATCTTTTCTTTGATGTAAACAAATGCACTT TCGAAAAATTTATCCAATGGCAAAGATTGATACTGAGTGGCCTACCTATA GACGTTATCGGAGTTTTTGATTTTTCTAAAAAAGCGATGCATTGTGGGAT TGTTTCGAGTGTATTACAATAGAAATCTCTTAGGAATTCCTCGAGGGAAT TCTATTGTAATACACTCAAGGCAATCCCACAATGCATCACTTTTTTTAGA AAAATCAAAAACTCCGATAAGGTCTATTCTCTAAGACTTGTTTTTCGAAA ACCCAACTGAATTTAAAATCTTTTTTTTTTGGTCGTTCATGTATTATTTC ATGAATGTCACTGGCTCTTAATTCGTCTACTATCTTTCTTTTAGCACACG TTCAAATCATTGGTATGAGTGCAACTCTTGGTAATATGGATGATTTGAAG AAGTTCCTTAACGCTCAGATCTTCACCAATGAGTTTCGCCCTGTAAGTTG TTTTTGAGGTTAAAGTGGTCATAATTTTTGTCAGGTAAAGTTAAAGTATT TTTTACCTTCATTTTTTTTTGTCTAAAATAATATACCAGAACCTTTGGCT TAATTTTGGCCTTAACCTTAGAACGAAGGAAAGACTAATCCTGGCCTAAC ATTTCACGAATTATCAAGAAAATGGTTTTTTACCCCTTTTAAGTCGATAA ATGAATAAAGTAGACATGATAAAATATAATAAGCCTTGTGAAAACGTGAA AGCAACCAAGCCTCAACCAAAATGTGCTGGTTTCAATTAAAAGTAGCGTG TTAGATTGCAAAAAACGATTCATTCCATTTAGTCTAGCATGCTAGACGAA TAGTTGAAACATAGTAAAGATAAGCAAAAATAAGAATATGTCAAACTAGA GGACACTTTGTATAAAGTCGATCCTATATGACTACTTAGGACTATTTCGC TCTTTTCAGGTTGAATTGACAGAATATGTCAAACTAGAGGACACTTTGTA TAAAGTTGATTCTATGGCAAAAACAGACGAAGAGCTGTGCGTGGTCAACC GACAAATCACACACCCTGTGGTAAGTCAAAATGCATTCTCTTTGTATTGT AAGAACACGAAGCTGATAAGGGCCTAAAATCTTAATAAAGTCTTAGTTGA AACTCCTTGAATTTTTACTGAAGTCTGTTTCAGTATAATCTGCAAGGGAG CCAAAAAAGGCAGTAAATTTTTGTATTATTAATAAATATTTATATTTTCA AAGAGCAAAAAAAACCGCCATCTACAATCAAAGTCATAATATTTGAGAAA AAAGGGAAATTCCCACGAAATCTGACAACCATAAACGATTTGGAAGCGCT CTAAATTAGATTCGACTGGTAGAGTTTTAACGCTAGAATTAATACTTAGG ACCTTATTAGGATCTGAGGATAACTAAAAGTCCAAGAATGGTTCAATAGG GCTCGAATATAGCCTAGAAGTCTATAAACCCCTCCCAAATTGAAATATTC GAATAAATTTATCAATTTGCCCAAAAGTGACTTTTTCGCCCGAACTTTAA ATTGTCGAAAACAGCAACGACCGAGATTTTAATTCGAATTCTATAAAAAA TTACAAGCCTTTTTTGTTGTCTCCGCAGTAGATGGAGAATTTTATTTTAA AATTTACATTTGATGATAAACTGGTGTCAAGCTCTCACGTGGTTTTCATT TAACGTTGCAACCTATTTTATTTTAAGAACTCTTCTTTTTTTTTCTATAC TTGCTGCTGGGCAGTAGAATCAATGTTTTATCATGCATTACAAATATTAT CGCATTTGTCTTGAAATAAATATATGCATATTTATCTCAAACTTGTTTAC CTTTGACAATTTTTTTTTGTTGTACTATCAACTTCAAGTTTTGTCCGGCT AAAGTCCGACTTAATTCAGAGCACTCTGACCTCAATGTCTGAAACGAATT TTTTGTAAAGTTATGAGGTTTTCTAAAAACGAGGTCAAAATTGACTTGTA GAAAACTGACGTCGATTAGAATTCTCTCGTGTTCGTCAACTCAAGGGTTT GTATAATCATTCAAAATCATCGATAAAGTTTACGTTATAAAACAATTTAG TTTCTTACATCAATCAGTACTTCCAGCTAAAGGCCTGAAGAAATGCTCAA ACCTTTACCGCCCCCCCAAAATAAAAATAAATTATCGATAAAGTTTACGT TAAAACAATTTAGTCTCTTACATCAATCAGTACTTCCAGCTGAAAGCCCT GAAGAAATGCTCAAACTTTTACCAGCCCCCCACTCCCACTCAGTGGCATA ACCAATAGGAAATGGAGAAAATAAAAATAAATCAGAAGTCCTGTACTCTT AGGTTCCAAACAAAATGTATTCGGTGGGTTCGAATAAACGGGGGGGTTGG AAAATTTTCGAAATTTTAATAAATGGGGGGGGGCTAATTGCCGGGGGTGG GTTGGAAATTGTACTTCTGAAACCCAAAAATAAGGTAAATATAGGCTATA ATCAGGCTATTTAGAGCCAAAAAAGGGGCCTTCTCCTTGACAGCTGAAAA TATTCTTAAGAATCAATAAACGGGGGGGTGGAAAATTTTCGAAAAATTAA CAAGTGAGGGGGACGTTTATTTGGAACCTAAGAGTAGGTAAAGATTTCAT TCACTTTTTCACCTTTCTCTGGCTACATTTGACCTTTTTAAGGCCTTTTC CAGCTGTTTTTTGACCAACGTTTTTCATTGCAGCTCCCAAATTACAAGAA TTACCTTCCGAAAAAAGAATTTAAACTCTTCTTTTATTTTGTGTGACCTA TTCCTTGATGGCCTTGACCTTCTGAGGCCTTTTAGGGTGTTCTAACATTT TTCCATCAAAAAAGGTCTCAACACTTTTTTTTCAATCATGTGTCTTCCTA ACCGAAAATGCAAGCAATATCAGCAGCAATATATTTCGGAAATTTATTGT GCTTTTCTCTGGCCTCAGAAAAATGACGAAAGGTTTTAAACAACGACGAT ATAAGGAATGTGTGAAAGAATTACAGTTGACGCTCTCTAATTCGATCTTC AGGGGGAATTGGATTTTCATCGAATAAAGGAGCTTATCGAATAAGGGAGC GACCTTTATGAGAATTTCTTGTTGACGGGGACTTCAAATTTCATCGAATA AGGAAGCCTATCGAATAAGGGAGCCTATCGAAAAGTATAACGTCGAATTA GAGAGCGTCAACTGTATAACCAAATTAGTTGTGTTTTCTTTCACTCTTGC GTCTGCTCCTGCAGATATAACTTTTTAGATATTTCAACACTTTACTTAAG TTTTTTAGCCGCGATGACCTAGGATTTTATCGTCTTCTTGAAGCTGTTTG AATTTGAATGCAAGGCGTTTTGATAGATTTTTTTGGAACTATTTTATTTT TTGAAAGTGTTCCTTCAGATGACCTAGAATCTTATGCTGCATGCATCCCC TCTGATATGTTTTGATATAGGTGATACCCAAATTTGGGGTAACCTGTTTC GATTTCCTTTAAATAGATTTAAAATTCCAATGATTGTATTAATCTCTGGC CATTCAAATTTTAAATTCAAATTTAATGAAATCTAAAGATCTAGCTAATC AAGTTTATAACTCGAGAACACTAAGGTGGGGGTAATTCTCGAGCGGGAAT TTTATTCACGATATACGCATTCTCTATATCAAAACATATTAGAGGGGATG TGTGCAGCCTACTAGAATCGGGGAATGCCTTTTTGTGTGTTCGTGTCTGT GTGTATATCCCAAATACTTTGGAGCAGCCTGGAGACTTCAAAGATGGTCG GATTTGGCACACCTTGGTTGAATATCTAATGACTTTTTTTTTCATATTTC AAAAATGTAGAATTTTTGGGACCTGGGCACTAGTCTTCCAAAACGAGGTT AAATCTTTTTGGACTGCCTAAAGACTCCCCAAATGGTGGGATTCGACTGA AATTTGGCACATTTATTCCTTGTTCGTTTGTTTTCCTACAATCTGGCCTT AAAAATCTTGAATAATTTGAAGGTCAAGAAATTGAGCCCGGTGCGTTGCG CACTACTCTTTAATAAAGATAATATTTATTAGAAATGGATGGTGGATCTT GGAAAAGGTCCTACTAACGAAGGAGATAAATGGTCGAGAAGGAAAGAATA TTTGGTGGTTGGTGGGTGTTTAAATGAGATCAGTTGCGGGATTCTATTTT ATTAAAAACACAAATGGTCAGGGAGGTGTCAGAAAANTGGGGGGTGTTTT AATGAGATCAGTTGTGGGATTCTATTTTATAAAAAACACAAATGGTCAGG GAGGTGTCAGAAAATCGTACATTGAAGTTTTCATTTAATCCCTTCCAAAT TTTTCTATTAAATGATCTAAGTGAAATTGAAATTACTACAATAAAGTTAA AGTTAAAGTAAATTTTTCAAATAGTCACTACGACAAGGCTTCAGATGGCT TCAGGTGTGTCTTCATCGTTTGATTTTTCATCTTCCATTTCGTCTCCACC TTTGGGGCAGTTTCGGATGAAACAGGGTGTCATATCGTAGACTGTATCTG ACAAGGACTTAGATGGTTCCATTTCGTCTCCACCTTTGGGGCAGTTTCGG ATGAAACAGGGTGTCATATCGTAGACTGTATCTGACCAGGACTTAGATGG TTCCATTTCGTCTCCACCTTTGGGGCAGTTTCGGATGAAACAGGGTGTCA TATCGTAGACTGTATCTGACCAGGACTTAGATGGTTCCATTTCGTCTCCA CCTTTGGGGCAGTTTCGGATGAAACAGGGTGTCATATCGTAGACTGTATC TGACCAGGACTTAGATGGTTCCATTTCGTCTCCACCTTTGGGGCAGTTTC GGATGAAACAGGGTGTCATATCGTAGACTGTATCTGACCAGGACTTAGAT GGTTCCATTTCGTCTCCACCTTTGGGGCAGTTTCGGATGAAACAGGGTGT CATATCGTAGACTGTATCTGACCAGGACTTAGATGGTTCCATTTCGTCTC CACCTTTGGGGCAGTTTCGGATGAAACAGGGTGTCATATCGTAGACTGTA TCTGACCAGGACTTAGATGGTTCCATTTCGTCTCCACCTTTGGGGCAGTT TCGGATGAAACAGGGTGTCATATCGTAGACTGTATCTGACCAGGACTTAG ATGGTTCCATTTCGTCTCCACCTTTGGGGCAGTTTCGGATGAAACAGGGT GTCATATCGTAGACTGTATCTGACCAGGACTTAGATGGTTCCATTTCGTC TCCACCTTTGGGGCAGTTTCGGATGAAACAGGGTGTCATATCGTAGACTG TATCTGACCAGGACTTAGATGGTTCCATTTCGTCTCCACCTTTGGGGCAG TTTCGGATGAAACAGGGTGTCATATCGTAGACTGTATCTGACCAGGACTT AGATGGTTCCATTTCGTCTCCACCTTTGGGGCAGTTTCGGATGAAACAGG GTGTCATATCGTAGACTGTATCTGACCAGGACTTAGATGGTTCCATTTCG TCTCCACCTTTGGGGCAGTTTCGGATGAAACAGGGTGTCATATCGTAGAC TGTATCTGACCAGGACTTAGATGGTTCCATTTCGTCTCCACCTTTGGGGC AGTTTCGGATGAAACAGGGTGTCATATCGTAGACTGTATCTGACCAGGAC TTAGATGGTTCCATTTCGTCTCCACCTTTGGGGCAGTTTCGGATGAAACA GGGTGTCATATCGTAGACTGTATCTGACCAGGACTTAGATGGTTCCATTT CGTCTCCACCTTTGGGGCAGTTTCGGATGAAACAGGGTGTCATATCGTAG ACTGTATCTGACCAGGACTTAGATGGTTCCATTTCGTCTCCACCTTTGGG GCAGTTTCGGATGAAACAGGGTGTCATATCGTAGACTGTATCTGACCAGG ACTTAGATGGTTCCATTTCGTCTCCACCTTTGGGGCAGTTTCGGATGAAA CAGGGTGTCATATCGTAGACTGTATCTGACCAGGACTTAGATGGTTCCAT TTCGTCTCCACCTTTGGGGCAGTTTCGGATGAAACAGGGCGCCGCATTGT AGACTGTATCACCCCAGCCCATTTCGTCACCCCAGCCCATTGGATTTGCC AAGGTAGTAGTGGTCAGTGCAAGGACCAAAGCGAAGATAGTCAAGCCTTC CATTGTTTCTAAAAAATCACAAGACTATATAATATTAATATCTTAAAGTA GTGAGACTGTGAAATGTGTTGCCCTGAACTGGGAATTTTCGGGCTAAGAA TCTTCGAACAAGAAAGAAACCTAATACTTTGATGTTTTTTTCTTTCAAAG AAAACGTTGTTTTGCCTAGCCTGGTGGCCATTGACTAGTGAACCTGGACG CTACCTATCTATTTCGGACAAGAGAAAACAGGGCCTCAGAAACCGACAAT GAAATTTCCCATACATAATTTTGCCCAATTCATCTAGTCTTCCTTTTGAA AGAGAATTTACAAAAGAAGACTCTTACCTTATTTCGTCGTTTTTCAAACC AAAAATGATGAGAATTGTAAAAAATGGATGCCCATTTATGCATATAACTT ATTTGAATTTTAGATAAAGAGTTCTATTGTTTTATTGCGTTGCCTAACAA AACTAGCCTTAAATGTCTCTTTGTTTGGACATGCTGGCCTAGTATGTTGC TATGAGAATTATTTTTCGAATCTCGCATATCAAAGCAATTCGCTTTATTT TTAGAATTAATTTTTTTTGAAAATTTTCCGCGTTCTCTATCTTTTGCACG TTACTTGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNAGGCTGAGAATGAGAAAATAACATTGTTTATT TAGTTTTTTTTAAGAACCTTCCAATCAAAACAAATGCTTTTTTTTCTTTG CATGAAAAATAGGCTTGATTATGTCAAAAAGTTTAGAAACATGTAAGAAA CGTTTTTAAAGGCTCAAAAGGCCGATTTCTTAAGAAACATTGAGGCTGCT TGGTAAAACTAGTTTCTTANAGGCTCAAAAGGCCGATTTCTTAAGAAACA TCGAGGCTGCTTGGTAAGACTAGTTTCTTAAAAAAAAACGTGTATACTCT AATTTTTCTCATAGGGTTTTAAAGAAGAGAACAAACGTTCCGATCCTGAC CATTTGTGTTCGTTAGCCTTGGAAGTGATTCCCCAACATTCTTGTATGGT GTTTTGTGCTACTAAGAAAAATTGTGAAAATGTTGCCTTGTTGATCGCAC AAGGTCTACCAAGGTATTAATGAACGTGGCATCGGAATTCCATGCTCTTT TCGCTGAATTTCTTTTTTGCCAAAACACCTGGTGAAGGCATTATTGCATT TGTCAAGGTGATAAAACTAGGTGTTACTGTTTAAATTAAGTTCTACAACC CTTACGGAACATCTGGGACAAATTTCAAGCTTTTGTAACAAACTGAAGTC TTTTTTGTGTTACCAGACTCCCCTTTTGAGTTTTCCGTTAAAAGGTCACG ATGAATTTTTGTCATTCTTCCTGTGAGATTCTTTACAGACAGTGCCAGGC TTATAAGAACTTATAATTTCTGTATGGAGGAGATGGGACATAGTCCCACT ATGGGTTACATCTCATGTTATCTATCATAATTTTTATTTTTGTCACCTAT TTAAGAGACTTGAGGAACCATCGGGAAGAAGAGAAATACGCCCTCCTTCA AAACATTCACAACGTAGCCAACGGTGTCTGTAAGACCCTGGCCAGGACCA TACCCTTCGGTATAGCTTACCATCACAGTGGGTTAACCATGGATGAGAGG AAGCTTGTAGAGGAAGCTTATTCTTCTGGCGTTCTCTGTCTATTATGTTG TACGTCGACCTTAGCAGCAGGTGTCAATTTACCAGCTAAAAGGTATTATT GAGTGATCATTTTCAAGAATGTTTTGATTTCGGATTCGATAAGAATTCCA TAGCCCACTATATCTTTTTTGTTTTATTTTACGATTTACCAAACTAAATT GCGCCATCATTGTTTTGAATTCAATAATGCCGGTGACGAACATTATATAG CCAAGTTATTTACGTCAAATGTTTGTTTGTATAGACCTTCACTAAGTCGT TCGAAATCTTTGTTGTAAATTTAAAACACAATAAAGAACGACTATGAAAA TTTAATGTTCAATCTTATGTTAAGTATGGCACTTACAAGACAATAACGTT AAAATATCTACTGTAATTATTTCAAATTGAAATTCTTTTAACCCTATTTG GGCCGGGCCTTTTTTGAGGTTAAATAATTCGGAGGGGGGAAAAAACATCC CCCCCCCCCTTCCATAAAATCCACAAAAAGGGTTGAAAAAGCTTGAAAAT TCTATCATGTAAGTTTATGTTTATACCAAGAAAAGTTTGATGTTACTCAT AGTTTGATGACGTCAGCACTTTTTTGTAAGAACTTCATGATTTAAACAGC TCCTGTTTTGATATTCTGGATAGCTAGATAAATTGTCTTTCGACAATATC TAATAAGATATTCGAAATTGTCAAATTCTGGGTCTGTATAAGGCGCCAAA ATCGAAAATATTATTTTTTTCGAAAATCGCGCGCCATTCTGAAAAAAATG ACGTCATCCAAAAATTCAATTCTTTCTTGCATTACAACATCTAGTTAAAG TCCATACGTTAACTGGTTCCCAAACTATCAGAGTTTGCATTTTCAAAAAA AATCGAGCCTTTTACCTGTAAAATTTGGGTCACTTTTTTAAAATGCTGAC GTCATCAAATTTTGCGGGTTTGAATTTCAAAAATTTTTTGTTGGATAATG GNGTTTTAACATTCTGAAAGCTAGATAAATTGTCTTTCGACAATATCTAA TAAGATATTCGAAATTGTCAAATTCTTGGTCTGTATAAGGCGCCAAAATC GCAAAAATTATTTTTTTTGAAAATCGCGCTCCATTCTGAAAAAATGACGT CATCCAAAAATTCAATTCTTTCTTTCATTACAACATCCAGTTAAAGTCCA TACGTTAACTGGTTCCCAAACTATCAGAGTTTGCTTTTTTTTTTTAAATC GAGCCTTTTACCTGTAAAATTTGGGTCACTTTTTTAAAATGCTGACGTCA TCAAATTTTGCGGGTTTGAATTTCAAAAATTTTTTTTTGGATAATGAGGT AAAATAAAAGCTAGGAAAACTTTTGAAATTTCAAGGCAATAGCTCTAATT TTAAAAGTGTAACGACAAAATCTTTGTCAGGAATTATTTTGTCTCACCTG GTCCAAGTAGGGTTAAGAGTTAATATTTTAATCTTTTCTTGTTTGTAAGA GTAATACTTCGATCACCATATGTCGGAAACCAATGCATGTCACGTGCTCA ATACAAGCAAATGATTGGACGAGCCGGAAGGGCTGGGATTGACAGTTCAG GTGAAAGCATCCTAGTCATCGCAAAGAAAGACAAGAATAAACTCCACAAA TTGATCAGAGGAGCTATGGGATCTTGTTCAAGCAGTCTGATGTACGAAAA AGGGAAAGGACTCAGGCAGCTGATTCTGTCCCTGCTCGGCTTGAAGGTTA GTTGTTTTTGCACACTTTCAAACTGGGTTGATACCGCACCCTCTAAAGTT GAACCCCATTCTTTGTCAACCTACCCCAACCTTATCAAGAAATTCCTCTG AACCCTATTACTTTCGGAGTAACTCCAAATCAAAATCATTTCACCCTTAG GCTCTGAGGGACGCGATTTTACATCTTGAAATAGTCGCAAAATACAAAAT CCCATACTTTAGGTCCCAGCTCCTTACGACTCGATTTAAAGGGGCATTGA CCGTATGGTTTTTGAAAGAATATCAAATTACCTTTCAAATGGTACCAAAA GGATTGTTTAACTTCCAGATTACAAGCTTTAATATCATTATGAAGTATTA AGTTTATTATAGATATAGAAATTATATAATTTTTTCTAGATTTTCAAAAA TGTATTCAAAGGGTTAAAACAAAACAGAAAACGTACTCTCTAAAAACGTA CACCAAACTTTTTCTCCTACTCCTACGAGTTTAACCAAGAAATCGAGGTT AGAAGATTAGAAAACGCATGTGTTGTCCATTGCATGGTGGTATCAAAGTG TACAGAGGACCCTCTACTCTACTTTATAAATCTACCTTTCCCTTAAGGAC GACCTTTCGGAAGAATCTCTACCTACCGAGAATACTGCTATTTTCCAGTG TTTTTATGATAAGACAAATTTTGAATAATGTTGGCAAACCTAAATGCTAA TTGTAATAATCCCGCCTTTAACCGAAACAAAAATTTGAAATAAATCTATA TTTCCTTAACTCGCACAAATTTGCATTCCCCGTGTGCATTTAAGTTACGG AGACTTCACTGTATTAAGAAATTCTCTCTTCGTCTTAGATTTGCGATTCT GTATCCGAGTTAGAAAATCTCCTCCGAACCACGCTATACCATGTGCAAGA GACGAGCACTAATGCAGCAACATATGATAAAGAAAACCAAAAACCCAAGA GAGAAGACAGCGAGTCTCTCTTCCAAATGATCAACAAACAAATCGAAGCT TTAATGTCTATGTCGATGATATCAAGAAAATGTATGAATAAGGGAGGGCA AGCTTTGGTCCAACCACATTTTTCTAAAAAAAAACACAACTTTAGACCTT AAAGGGATAATCAGATGGTCTGAGACATTTTGCCTGCAGATAGCTTCTAG GATGTTAGGAAAAACCTCTAAATTTTTCGGTGTACTTATTTTCCTAACTC AACTTATGCCAATTTGAAATTTTGAACTTTTTCTTGAAAACAATAGAAAA AAGTGTGAAAAGTCCCTGAAAAGTCCCATTTTTCGAGATTTCAAAGTGGC ATAACTTGAGCTAGAAAAATAAGTACACCGAAAAATTTAGAGGTTTTTCC TAACATCCTAGATGCTATCTGCAGACAAAATATCTCAGACCATCTGATTA TCCCTTTAAAAATACCGCTTTAGGGAATCTGGAAGGTTTGAAATTAGAAA AATATTTTTCGCTAACCATGATGTCATATACTTTTGTTACTAACTCCCTG CCGTTCTTTTCTTGAAGCCAATCCTGCTCATAGATAATTGAATTCGATTA CACACTGAATAATGTTGGAAATTCCTTGAAAATTTTGATAACTGAACAAA AGGCAGAGTATCAGCCAGGCAAAACTAGCTGTTCAAAAAAGTAAAAAAAA TAATGATCTTGAGAAATATCTAGCTACAGTTGACGCTCTCTAATTTGACG TTCTACTATTCAATATACGTTCCATTATTCGATAATATTGAAAGTCACCA TCAACAAGAAACTCTTATAACCAATGCTCTACTATTCGATAATCCAATTG CCCTTAAAAATCGAATTGGAGAGCGCCAACTGTAAATCTTTTCATTATAG CCTCACCATGTCCGTCAAGAGAGAACTCGCAAGAAAGTATCACTATAGAA GGAGAATCTCAAACGAAAGATGAACAAAATAAAGCTGACGTCAGCAATGA CACCAATGATAAGAAGCGAACCACCGATGATCCAGTGGACGGTGTCAATG TTGGATTAACTCCCAGTAAACTGGTCATCACTGACATCGGACGAGCTACT GTTAAAGGTTATAGTCAACTATCTTTAATTCGAACTTCTACAATCCGATT ATTTCTGTAATTTGGACTAAAACATTGGTCCCCTCAGTGTAAAACGCTCA CTATGATTCGAAGAAACATATAGTCCCATGGAGATCGAATAAGAAAGAGG CAACTGTATATTTAAGGCATTATTTAACGTATCTCAATACCATTTGCTTA CACTGAATTTTCAGAACAAAATAAAAAAGGACTTTCTCGCGAGCACAAAT TTTCTAAAATTCCTTCAATAACTTTACTTTATCAACATAAGATGCTTTAT CCCGGCACGCCGGAAGCTTTTTAAATCTGGTACGGCGAATGAGGAAATTT AGGCGATTTTACCGACGTTTTTTGGTCAATAATTAGCTTTGCTACGAGTG TTCTAATGTCACCTTTTTCTAAGAATATGTTTTTTTATATTTTGCTATTT CTTTTGGAAGTTTTTTTTTTGGTTTTGGTCAGAAATTAGTGCATGTTCTT TTGAAATTGTTATTTAAGAAACGTGTAATGAAATATTCATTATCTCCCTA GGTTGCATCGATATAGACTTCGTACCAACTCTCTACAAAGACTTGAAGAA ATCACTACAAGGGATCGTGTTGGCTACTGAACTACATTTGTTATATTTGG CCACGCCGATCGACCAAACAGCTATATTGACGGTGAAGTGGATGACTTAT TATCGCCAGGTTGGTTTTCACGCTTAGTAAAGACCAAAGAGATTCTACCC ACACTCAAGATATTGCATTTTTGCTATTTTGGTGACGTCATCGTGCCTAA AGTGTGAAAATGTTTGCTTGCCTAAAGTCAATTAAAGCCTCATAGCTTCT CTCGTTGTATTCTCCATCAAATTTCTGATCCAACGATGGGTCAAGGCTCT CTTAAGAGAGTTTGCAATGTAAATATGGTGCAGTAATATGAGGAGTCATG GGGCATACATACTCGCGAGGGGGGTTGGAAAATTTTTGAGATTTCAATAA ACGGGGGGGGGGGACCTAATTGCCGGGGGGCTGGAAATTGTATTTCTGAA AACCCAAAGATAAGGTAGATATAGGCTAAAACCATGCTATTTAGAGAAAA ATAGGGGGTCTTCTCTTTGACAGCTGAAAATATTCTTAAAAATTAATAAA CAAGGGGGTCCTAATAAGGTCCGGGGGGTTGAAAAAATTTTCGAAAATTA ATAAGCGTGGGGGGGGGGGGGGGGTTATTTGGAACCTAAGAGTAACCCCT TTTATATTAAACTTTTCATTAAGGGCACGGGTCACTTACTTGACTTGGCT TGCTTACCACATTAATTAAAATGCCTAAGGAAATATACCGTTATTTGTTT TAAATATGAATATATGCTATACCGGGTGGCCCACTGAAGGGTATAATCGC TAACTGTGTCCGTTATAATGCGAATCTTTAGAGAGAAAAAACTTAAAATT AGGTACATACATTTCATTTGACGCTTTCAAGCTGCATTTCGGATGCTCTT AACTTTTTGAGTTTTAAGCCTAAAATGTTCTTAACGTGTTCCTATTTTAA ACATCTTGTTAGTACTTTTGTTCGCACTTTTCAAAGAAATCGGGTGTTTT AGATTCCGATGAATGTCTTATGTTCTTAACAAAAACCTGTTATCAACCTG TTCGTGTATGTCTTTTTCACTTTAGTTTTCCAAACTCAACGAGAATGAAA CGAAAGCAGCGGAAATGATTGGTATTCAAGAAGGCATGTTAATGAAGAAA GCCACCGGG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000344XLOC_000344Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000582-exon-sc0000002-1575043694:1164473..1165239TCONS_00000582-exon-sc0000002-1575043694:1164473..1165239Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1575043694:1164036..1164214TCONS_00000582-exon-sc0000002-1575043694:1164036..1164214Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1575043694:1161987..1162115TCONS_00000582-exon-sc0000002-1575043694:1161987..1162115Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1575043694:1161520..1161591TCONS_00000582-exon-sc0000002-1575043694:1161520..1161591Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1575043694:1154392..1154467TCONS_00000582-exon-sc0000002-1575043694:1154392..1154467Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1575043694:1147848..1147945TCONS_00000582-exon-sc0000002-1575043694:1147848..1147945Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1575043694:1147270..1147380TCONS_00000582-exon-sc0000002-1575043694:1147270..1147380Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1575043694:1137848..1138084TCONS_00000582-exon-sc0000002-1575043694:1137848..1138084Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1575043694:1136194..1136440TCONS_00000582-exon-sc0000002-1575043694:1136194..1136440Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1575043694:1134133..1134339TCONS_00000582-exon-sc0000002-1575043694:1134133..1134339Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1575043694:1133431..1133588TCONS_00000582-exon-sc0000002-1575043694:1133431..1133588Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1575043694:1132381..1132464TCONS_00000582-exon-sc0000002-1575043694:1132381..1132464Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1510915933:1164473..1165239TCONS_00000582-exon-sc0000002-1510915933:1164473..1165239Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1510915933:1164036..1164214TCONS_00000582-exon-sc0000002-1510915933:1164036..1164214Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1510915933:1161987..1162115TCONS_00000582-exon-sc0000002-1510915933:1161987..1162115Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1510915933:1161520..1161591TCONS_00000582-exon-sc0000002-1510915933:1161520..1161591Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1510915933:1154392..1154467TCONS_00000582-exon-sc0000002-1510915933:1154392..1154467Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1510915933:1147848..1147945TCONS_00000582-exon-sc0000002-1510915933:1147848..1147945Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1510915933:1147270..1147380TCONS_00000582-exon-sc0000002-1510915933:1147270..1147380Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1510915933:1137848..1138084TCONS_00000582-exon-sc0000002-1510915933:1137848..1138084Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1510915933:1136194..1136440TCONS_00000582-exon-sc0000002-1510915933:1136194..1136440Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1510915933:1134133..1134339TCONS_00000582-exon-sc0000002-1510915933:1134133..1134339Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1510915933:1133431..1133588TCONS_00000582-exon-sc0000002-1510915933:1133431..1133588Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1510915933:1132381..1132464TCONS_00000582-exon-sc0000002-1510915933:1132381..1132464Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1491911889:1164473..1165239TCONS_00000582-exon-sc0000002-1491911889:1164473..1165239Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1491911889:1164036..1164214TCONS_00000582-exon-sc0000002-1491911889:1164036..1164214Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1491911889:1161987..1162115TCONS_00000582-exon-sc0000002-1491911889:1161987..1162115Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1491911889:1161520..1161591TCONS_00000582-exon-sc0000002-1491911889:1161520..1161591Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1491911889:1154392..1154467TCONS_00000582-exon-sc0000002-1491911889:1154392..1154467Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1491911889:1147848..1147945TCONS_00000582-exon-sc0000002-1491911889:1147848..1147945Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1491911889:1147270..1147380TCONS_00000582-exon-sc0000002-1491911889:1147270..1147380Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1491911889:1137848..1138084TCONS_00000582-exon-sc0000002-1491911889:1137848..1138084Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1491911889:1136194..1136440TCONS_00000582-exon-sc0000002-1491911889:1136194..1136440Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1491911889:1134133..1134339TCONS_00000582-exon-sc0000002-1491911889:1134133..1134339Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1491911889:1133431..1133588TCONS_00000582-exon-sc0000002-1491911889:1133431..1133588Clytia hemisphaericaexon
TCONS_00000582-exon-sc0000002-1491911889:1132381..1132464TCONS_00000582-exon-sc0000002-1491911889:1132381..1132464Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1132381..1165239 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.280212 0.447858 0 0 0.842283 0.245595 0.517444 0.192588 0 0 0.303261 0.11117 0.0581862 0.0824647 0.055654 0 0.153369 0.179342 0 0 0 0 0 0 0.469406 0.752843 0 0 0.22303 3.04002e-06
Blast
BLAST of TCONS_00000582 vs. Swiss-Prot (Human)
Match: HELQ (Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2)

HSP 1 Score: 296.204 bits (757), Expect = 1.323e-85
Identity = 141/247 (57.09%), Postives = 188/247 (76.11%), Query Frame = 2
Query:  644 VNMNLTDIESSANSYPENTFYGLPMTVKDMLLQIRGIPSLYEWQNDCLNLSSVINRKNIVYSLPTSGGKTLVAEILMMQEILVKQRNVILVLPYVSIVQEKVRDLSPFAVQLGFHIEEYASRKGCLPPKKRRRKNSIFIATIEKANAIINSLVENERTEELGKVVVDELHMIGEGGGRAALLEILLTKIMFKFTHVQIIGMSATLGNMDDLKKFLNAQIFTNEFRPVELTEYVKLEDTLYKVDSMAK 1384
            +N+    +ESS+N      FY LP  V+D+  Q +GI  LYEWQ+ CL L+SV  RKN++YSLPTSGGKTLVAEILM+QE+L  +++V+++LPYV+IVQEK+  LS F ++LGF +EEYA  KG  PP KRR K S++IATIEK ++++NSL+E  R + LG VVVDELHMIGE G R A LE+ L KI++     QIIGMSATL N++DL+KFL A+ +T++FRPVEL EY+K+ DT+Y+VDS A+
Sbjct:  299 INVAKKTVESSSNDL--GPFYSLPSKVRDLYAQFKGIEKLYEWQHTCLTLNSVQERKNLIYSLPTSGGKTLVAEILMLQELLCCRKDVLMILPYVAIVQEKISGLSSFGIELGFFVEEYAGSKGRFPPTKRREKKSLYIATIEKGHSLVNSLIETGRIDSLGLVVVDELHMIGE-GSRGATLEMTLAKILYTSKTTQIIGMSATLNNVEDLQKFLQAEYYTSQFRPVELKEYLKINDTIYEVDSKAE 542          

HSP 2 Score: 182.57 bits (462), Expect = 1.931e-47
Identity = 90/142 (63.38%), Postives = 115/142 (80.99%), Query Frame = 3
Query: 1446 HREEEKYALLQNIHNVANG-VCKTLARTIPFGIAYHHSGLTMDERKLVEEAYSSGVXXXXXXTSTLAAGVNLPAKRVILRSPYVGNQCMSRAQYKQMIGRAGRAGIDSSGESILVIAKKDKNKLHKLIRGAMGSCSSSLMYE 1868
            H+E+EK  +++N+ N+ NG +C  L RTIPFG+AYHHSGLT DERKL+EEAYS+GVLCL  CTSTLAAGVNLPA+RVILR+PYV  + + R QYKQMIGRAGRAGID+ GESIL++ +KDK ++ +LI   + +C S L+ E
Sbjct:  608 HKEKEKCEVIKNLKNIGNGNLCPVLKRTIPFGVAYHHSGLTSDERKLLEEAYSTGVLCLFTCTSTLAAGVNLPARRVILRAPYVAKEFLKRNQYKQMIGRAGRAGIDTIGESILILQEKDKQQVLELITKPLENCYSHLVQE 749          

HSP 3 Score: 97.0561 bits (240), Expect = 1.754e-20
Identity = 43/91 (47.25%), Postives = 61/91 (67.03%), Query Frame = 2
Query: 2093 ITDIGRATVKGCIDIDFVPTLYKDLKKSLQGIVLATELHLLYLATPIDQTAILTVKWMTYYRQFSKLNENETKAAEMIGIQEGMLMKKATG 2365
            IT +GRA+ KG ID+ +   LY+DLKK L+G+VL + LHL+YL TP D  +     WM Y+RQFS+L+  E   A ++G+ E  + KKA+G
Sbjct:  830 ITKLGRASFKGTIDLAYCDILYRDLKKGLEGLVLESLLHLIYLTTPYDLVSQCNPDWMIYFRQFSQLSPAEQNVAAILGVSESFIGKKASG 920          
The following BLAST results are available for this feature:
BLAST of TCONS_00000582 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
HELQ1.323e-8557.09Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV... [more]
back to top