Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000580 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000580
Unique NameTCONS_00000580
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1024

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000580 ID=TCONS_00000580|Name=TCONS_00000580|organism=Clytia hemisphaerica|type=transcript|length=1024bp
CACGTTATGAAATCAGCTGAAAGTGGCATGGACTTACAGATCGGTGTAGA
GCGAGAAGTCTCAGTGGGTGTGAATATCAAGGGCGTGGAGGCGTCAAGTA
CATCAACTATTCCACCACCCTTCCAAAGAGGATGGCGTAATTCTGAAAAC
ATGGAATCACTAAGATCGTTCTTTTCAAAGAAGACGCGTGACGACCTCTG
TTGGAATCTGTCTCTCCTATCAATTACGTTTGCAACAATTTCGCTACCCT
CCTTTTACTGACAGTTTCAAGAATGCTATCCAAGAGTTGTATTCGGTATC
CCAACAACACCAAGTGaacgttttcaaaaagtttgtgagTGAATTTGGTA
CTCATTTTCTAGCTCACACTGTCCTTGGCGCCGAGTTTATCCACCAGACA
AAATATTCTGGTGAAGTTCGCCGACATTACAATGTCGATACATTGCAAAA
GTGTAGCGAAGTCGCTGGATCAAAAATCTTCGGCCTTCAAGTGGAAGAGG
ACTCTAAGAAATGCACAGATAGCGACAAAAAGAACCTTGGAGGAATGAGT
CGATCAGATGTGGAGGATGTCGTAATCACTCGAGGATCACGACCAACCGA
TATTAAAGATTGGTCTACACAAGACTTTAAACCTGTCCCTATTCAGTTTA
CGCTGTCTCCTATCGTCAACCTTTTTACCAATTCTATTTTGAAGAGGAAC
AACATTACAGTTGGAGGACATCAAATCAGCGACAGCTTGAAGATCCGTAG
TTGGTTTTTACCATTGTATTGGGATTACTGCAAAGTGATGGGTGTAGAGT
GCAAGACGAAAGAAGGATGTGGAATCGATGACAAATGTCCTGTAGATGCC
ATCTGCAATCCTAGTGCCAACAAACACCAATGCACTGAATGGACGGATTG
GAGATGTACAGGCACATGTTCAACAAACCAAGAAATCGCACGTGTAGTGG
TTGTGATGGAGAGACCAAGCAGAAGAGAGCAAACAGCATCTGTAAACCTG
CATCTTGTTACAAAGATAAAAGTA
Run BLAST on NCBI

protein sequence of TCONS_00000580-protein

>TCONS_00000580-protein ID=TCONS_00000580-protein|Name=TCONS_00000580-protein|organism=Clytia hemisphaerica|type=polypeptide|length=160bp
MSRSDVEDVVITRGSRPTDIKDWSTQDFKPVPIQFTLSPIVNLFTNSILK
RNNITVGGHQISDSLKIRSWFLPLYWDYCKVMGVECKTKEGCGIDDKCPV
DAICNPSANKHQCTEWTDWRCTGTCSTNQEIARVVVVMERPSRREQTASV
NLHLVTKIKV
Run BLAST on NCBI

transcript from alignment at sc0000002:1119645..1121263-

Legend: exonfive_prime_UTRCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000580 ID=TCONS_00000580|Name=TCONS_00000580|organism=Clytia hemisphaerica|type=transcript|length=1619bp|location=Sequence derived from alignment at sc0000002:1119645..1121263- (Clytia hemisphaerica)
CACGTTATGAAATCAGCTGAAAGTGGCATGGACTTACAGATCGGTGTAGA GCGAGAAGTCTCAGTGGGTGTGAATATCAAGGGCGTGGAGGCGTCAAGTA CATCAACTATTCCACCACCCTTCCAAAGAGGATGGCGTAATTCTGAAAAC ATGGAATCACTAAGATCGTTCTTTTCAAAGAAGACGCGTGACGACCTCTG TTGGAATCTGTCTCTCCTATCAATTACGTTTGCAACAATTTCGCTACCCT CCTTTTACTGACAGTTTCAAGAATGCTATCCAAGAGTTGTATTCGGTATC CCAACAACACCAAGTGAACGTTTTCAAAAAGTTTGTGAGTGAATTTGGTA CTCATTTTCTAGCTCACACTGTCCTTGGCGCCGAGTTTATCCACCAGACA AAATATTCTGGTGAAGTTCGCCGACATTACAATGTCGATACATTGCAAAA GTGTAGCGAAGTCGCTGGATCAAAAATCTTCGGCCTTCAAGTGGAAGAGG ACTCTAAGAAATGCACAGATAGCGACAAAAAGAACCTTGGAGGAATGAGT CGATCAGATGTGGAGGATGTCGTAATCACTCGAGGATCACGACCAACCGA TATTAAAGATTGGTCTACACAAGACTTTAAACCTGTCCCTATTCAGTTTA CGCTGTCTCCTATCGTCAACCTTTTTACCAATTCTATTTTGAAGAGGAAC AACATTACAGTTGGAGGACATCAAATCAGCGACAGCTTGAAGATCCGTAG TTGGTTTTTACCATTGTATTGGGATTACTGCAAAGTGATGGGTGTAGAGT GCAAGACGAAAGAAGGATGTGGAATCGATGACAAATGTCCTGTAGATGCC ATCTGCAATCCTAGTGCCAACAAACACCAATGCACTGGTAAGTTTTATTT TCTAAATTTTGACATTTCTTTATTTCTTGTTTGTTAACATTATGTTTGTA AGGTAAGGAATCTCTGAGATTCCGAAAAGGTTTAATGCCCTTTTAAGCTT TCTTAAAAATAAATCGAAAGTTATACTTCGATGACTTCTCGCATCTTTAT TTCTTACATGATCTTTCAACGCCAGCTTTAGTTGTGGTACCTACCTTATC GGCCAAAACTTAGTCGGCCTTGAGTGACTAAATTTTGGCTCGGTGACTAA AATTAGGGCCGAATAAAAATTTGGGCCGGCTAAAATTAAGGCCGACTAAA AATTTGGGCCAAATTAAAAGTTTCTAATTAAGCTCTCCTTATTTTCCAGT ATTTTAAGCTTTCTCATTTTTTCCATCTGCTTGTAAATTTAGAAATGACC CACATTTTTATTCGGTCTTAATTATTAGTCGGCCCTTAGTGACTAAATTT TGACGAGCTGACTAAAATTAGGGCTGACTAATAATTAAGGCCGACTAAAA TTAAGGCCCGACTAAAATTAAGGCTGACTAAGTTTGGGCCAATAAGGTAT GATGAATTTAATAATTTATTTTTCAATTAAAGAATGGACGGATTGGAGAT GTACAGGCACATGTTCAACAAACCAAGAAATCGCACGTGTAGTGGTTGTG ATGGAGAGACCAAGCAGAAGAGAGCAAACAGCATCTGTAAACCTGCATCT TGTTACAAAGATAAAAGTA

Coding sequence (CDS) from alignment at sc0000002:1119645..1121263-

>TCONS_00000580 ID=TCONS_00000580|Name=TCONS_00000580|organism=Clytia hemisphaerica|type=CDS|length=960bp|location=Sequence derived from alignment at sc0000002:1119645..1121263- (Clytia hemisphaerica)
AATGGACGGATTGGAGATGTACAGGCACATGTTCAACAAACCAAGAAATC
GCACGTGTAGTGGTTGTGATGGAGAGACCAAGCAGAAGAGAGCAAACAGC
ATCTGTAAACCTGCATCTTGTTACAAAGATAAAAGTAATGAGTCGATCAG
ATGTGGAGGATGTCGTAATCACTCGAGGATCACGACCAACCGATATTAAA
GATTGGTCTACACAAGACTTTAAACCTGTCCCTATTCAGTTTACGCTGTC
TCCTATCGTCAACCTTTTTACCAATTCTATTTTGAAGAGGAACAACATTA
CAGTTGGAGGACATCAAATCAGCGACAGCTTGAAGATCCGTAGTTGGTTT
TTACCATTGTATTGGGATTACTGCAAAGTGATGGGTGTAGAGTGCAAGAC
GAAAGAAGGATGTGGAATCGATGACAAATGTCCTGTAGATGCCATCTGCA
ATCCTAGTGCCAACAAACACCAATGCACTGAATGGACGGATTGGAGATGT
ACAGGCACATGTTCAACAAACCAAGAAATCGCACGTGTAGTGGTTGTGAT
GGAGAGACCAAGCAGAAGAGAGCAAACAGCATCTGTAAACCTGCATCTTG
TTACAAAGATAAAAGTAATGAGTCGATCAGATGTGGAGGATGTCGTAATC
ACTCGAGGATCACGACCAACCGATATTAAAGATTGGTCTACACAAGACTT
TAAACCTGTCCCTATTCAGTTTACGCTGTCTCCTATCGTCAACCTTTTTA
CCAATTCTATTTTGAAGAGGAACAACATTACAGTTGGAGGACATCAAATC
AGCGACAGCTTGAAGATCCGTAGTTGGTTTTTACCATTGTATTGGGATTA
CTGCAAAGTGATGGGTGTAGAGTGCAAGACGAAAGAAGGATGTGGAATCG
ATGACAAATGTCCTGTAGATGCCATCTGCAATCCTAGTGCCAACAAACAC
CAATGCACTG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000343XLOC_000343Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000580-proteinTCONS_00000580-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000580-exon-sc0000002-1575043694:1120377..1121263TCONS_00000580-exon-sc0000002-1575043694:1120377..1121263Clytia hemisphaericaexon
TCONS_00000580-exon-sc0000002-1575043694:1119645..1119781TCONS_00000580-exon-sc0000002-1575043694:1119645..1119781Clytia hemisphaericaexon
TCONS_00000580-exon-sc0000002-1510915933:1120377..1121263TCONS_00000580-exon-sc0000002-1510915933:1120377..1121263Clytia hemisphaericaexon
TCONS_00000580-exon-sc0000002-1510915933:1119645..1119781TCONS_00000580-exon-sc0000002-1510915933:1119645..1119781Clytia hemisphaericaexon
TCONS_00000580-exon-sc0000002-1491911889:1120377..1121263TCONS_00000580-exon-sc0000002-1491911889:1120377..1121263Clytia hemisphaericaexon
TCONS_00000580-exon-sc0000002-1491911889:1119645..1119781TCONS_00000580-exon-sc0000002-1491911889:1119645..1119781Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1119645..1121263 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.43531 0.466945 0.591456 0.675089 0 0.0463886 0.0559659 0.0523946 0.0366827 0.18175 0.264616 0.260922 5.84812 1.95429 0.074155 0.132633 0.0653571 0.0334944 213.279 223.81 0.210441 0.123175 0.0499118 0 0.0934746 0.125136 0.119379 0 0.096632 0.0984527
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000580 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top