Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000578 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000578
Unique NameTCONS_00000578
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2253

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000578 ID=TCONS_00000578|Name=TCONS_00000578|organism=Clytia hemisphaerica|type=transcript|length=2253bp
aaataagggaaaaagtgaaaaacctTTCGTGATTTTTCATTCTCTGTGAA
TGAACTCTCGTTCAAGCAGAGATAGAAGGGAGTCGGTTGCCTTTGTGTGT
TTGGAGCAAATTATTTGAGAGGAGAGAACTAAAAGATTGATACAGAACGA
AAAAGCAACCAAAGAAATAACACTGCGatacgaaaaatatttcagaattt
taCAACCGTCACTttgatttttagaaatatttttcgcATAAACAACATAC
AATATGAGAGAGTGTATTTCCATCCACATTGGACAAGCTGGTTGTCAAAT
TGGCAATGCATGTTGGGAATTATACTGCATGGAACACAATATCAAACCTG
ATGGTCTAATGAACGAAGAAGGGTCACAACGAGATGATGAATCTTTCAGT
ACTTTCTTCAATGAAACCGGGAATGGTAAACATGTACCACGTGCTCTCTT
CCTTGACCTGGAACCTAATGTTATTGATGAAATCCGAACAGGAGCATACA
GTAAATTGTATCACCCGGAACAGTTGATCAGTGGAAGTGAAGATGCAGCT
AATAATTATGCTCGTGGTCATTACACAGTTGGAAAACAAATGATCGATGA
TGTCTTGGATAAAGTCCGAAGGTTAACCGAGAACTGTACCGGTCTTCAAG
GTTTCTTAATGTTCCATTCCTTTGGTGGAGGTACTGGATCTGGTTTCACA
TCTCTCCTCATGGAACGAATCACAGCCGACTATAGCCGTAAATCTAAACT
GGAGTTTGCAATCTATCCAGCTCCTCGAGTATCTACAGCTGTCGTTGAGC
CATATAATGCTTGCTTAACGACGCATACGACATTGGATAATTCAGATTGT
GCTTTCATGGTTGATAACGAAGCTATCTATGATATCTGTAGACGCAATCT
TGATATTGATCGTCCATCCTATACTAACTTGAATCGGTTGATTGGTCAAA
TTGTCTCCTCGATCACAGCTTCGTTGCGTTTCGATGGCTCCTTGAATGTT
GATCTGAATGAGTTTCAAACCAACTTGGTCCCATACCCCAGAATTCATTT
CCCAGTTGCCACCATAGCTCCAGTTCTGTCAGCTGCGAAAGCGTACCATG
AGAAAATCTCCGTATCGGAAATAACACATCAATGCTTCGAGCCTGCAAAC
CAAATGGTGAAGTGTGATCCAAGGCTAGGTAAATACATGGCTGTGTGCTT
GTTATACCGTGGTGATGTTGTCCCTAAAGATGTTAATACGGCAATTGCTC
atttaaaaacgaaaaagaataTCCAATTCGTTGATTGGTGTCCAACTGGA
TTCAAAGTTGGAATCAATTACCAACCACCAACGACAGTGCCTGGTGGTGA
TCTCGCTAAAGTTCCTCGGTCTGTCTGCATGTTATCTAACACAACTGCTG
TTGCTGAGGCCTGGGCTCGATTGGATCATAAGTTCGATTTGATGTATGCT
AAACGTGCTTTTATACATTGGTATGTCGGTGAAGGGATGGAGGAAGGTGA
ATTTGCTGAAGCCAGGGAGAATATGGCATCTTTGGAGAGAGATTATGAAG
AAGTTGCTTCAGATTCAGTGGCTGATGATTATGATGAAGATGAGGAGGGA
GAAGGAAGCGGTGAAGAATACTGAAGATCGTGTATTTCTCCCATTGCATT
CACAGCTAAGTCTTTAAGATATCTTtagaattttatgaatttttgattga
aagcaAATTTAGAATGTATGATACTTAGAGATTgttgatttaaaaataaa
tttgaaaataatttacacACCCCAACCTAAGCTACTATCCCGgataaaat
tgcatttttgatAACAACAAGGGAGATATCCGTGGTGGTTTGTGGGTTCC
TCTAAAATTAGGAGAGTTTTATTAAATCTTTCACTTTTTGAGCGTTTGTC
CCGGGGTAATGGAGCCTGTTAAATATCTTCAGGACCACTTGGACCAGTGG
CACGTgaccgtacccaattttgcctttTCTCTGTTTTGAACTATCACAGC
AAATCAAAAAATGTCTGGaataatttcattgaatttactTCTTGCTAAGG
TTAactgtaatatttttttgcatttgtGTACATAGATTATGGCGAttatc
ataaaattttatgttaATTTTAGAAATagggaaaatcaaaattatctaAA
TGCCGAAACACCTCTCTTGGTAAGTTccttaaaagttcaaaaatcaaTGG
TCGTAATGTCTCTACTCTCTACTAAAGTTCTACTTCCAAGCAATATAAGG
GGG
Run BLAST on NCBI

transcript from alignment at sc0000002:1071636..1075800-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000578 ID=TCONS_00000578|Name=TCONS_00000578|organism=Clytia hemisphaerica|type=transcript|length=4165bp|location=Sequence derived from alignment at sc0000002:1071636..1075800- (Clytia hemisphaerica)
AAATAAGGGAAAAAGTGAAAAACCTTTCGTGATTTTTCATTCTCTGTGAA TGAACTCTCGTTCAAGCAGAGATAGAAGGGAGTCGGTTGCCTTTGTGTGT TTGGAGCAAATTATTTGAGAGGAGAGAACTAAAAGATTGATACAGAACGA AAAAGCAACCAAAGAAATAACACTGCGATACGAAAAATATTTCAGAATTT TACAACCGTCACTTTGATTTTTAGAAATATTTTTCGCATAAACAACATAC AATATGGTAAGTTGCTTTTCCTAATGCTTTTATGTACTTCTACCTTTAAC ATTTTATTCTTCTTCNTTTAAACAACATACAATATGGTAAGTGTTTTTTA ATGTACTTCTACCTTTAACATTTTATTCTTCTTCGTTTTCATTTTTTCTT CAATATTTACTATATTTGATGATGGACTGATCCACTCGCATTATTTCTTC CACAACCAAAAATACCGAGCTCATTCCAGATCTATCACAGTGCACAGCTT TTTTCATTGCTTCTATAACAGACTTGAGTAGAAATTTTACTATCCAACAA ACTCAAACCCAGTCCCTTAGTTTACTTTTTCATGATTCCTGATTGCATCA CGTCTATCAGTAAAATCAAAAAATGGTGCAAGTGGTTTGTGATACGAGAT AAGCTGAAATTCTTTAGCGGTACGCTTGACTTTTGAGAAAAGGCCTGGTA GTGAATTTGCATTTTTCACAAGAGCGCTTTTCACGCTTGTGTTTTCTATA CCATCATCAAAAGAAATTTTCCTTGTAAATTCAATAGTCTCATGAGTCTC CTCTACATGAACCGTGCCAATAAGAGTTGATATAGGTGTATTAGCATAAT TTTGGGAGTGAAATATCTTTCATGGCACTAAAACAAACTAACTTTCAAAT TCAACAATTGTTATCATAGAGAGAGTGTATTTCCATCCACATTGGACAAG CTGGTTGTCAAATTGGCAATGCATGTTGGGAATTATACTGCATGGAACAC AATATCAAACCTGATGGTCTAATGAACGAAGAAGGGTCACAACGAGATGA TGAATCTTTCAGTACTTTCTTCAATGAAACCGGGAATGGTAAACATGTAC CACGTGCTCTCTTCCTTGACCTGGAACCTAATGTTATTGGTAAGCAACTT AATCTAATACTGATTCATCGGTGTGGTTTGTGGTTTGTGTTTTTTTGTGC CATTCGACAAAGAGTTTTACTTCACTGCCAAGCTCATTTCAGAAATCTCT CGGAATCTTATCTAACCTCTTGGAATTTTATCGAAGAGTTTGACTTTTAG AGGCACATCCACATGTGGTCTGAGTTTTGTTTCAAATGTCTTTGAATTGT ATATCAATCGATCAGTTGCAAAATTTCACGTAGATTTAAAAAATGCAATA AAAAAGTAAGAACAACTTTCTTTATCAAAACTATGACTCTTTGAAGTACT ACCTGTATTTTGACCCCTCTTCCTCTAATACGAGTATACTCGTAGTTGGC ACCGAAAGTGTTAAGTTACGCTCTTTCGCAGGAACTATTGTTAAAACTCA ATGGGTAAGTACCGATTAAAAATATGGTAAACGTAGAGTAAATCCACCGC TATGGAATTGAGACAGGTCAGGGGAGTTTTTCTGAGAGCGTTTAGATATG CTATTTCATTGATATTTTAAGCCCGGGGGGGGGGTACTACCCTTGTCGAC CGACGGGGGTGCTCCGCTGAGGTTCGAAAAATGGACCCTACGTGGGACTC GAAATTTGCGAAAAAAGTNTTTGAATATTCAATTAAATAAACAACTGAAA TAGCTGAAATAGTAACAAATCTCAGAAATATATTTATAACATGGGAATAA ACCTAATAAAACGAACAATTATGAAAATTATGGAATTACTGTATTCTTGT TTTTGTCCCCCCCCCACCAGGCAGAGGACTGAATATACCCCCATTTGTAT TTCTCTCCCCATGAAGCTTGTAATTCTCACTCCCCCCTAGTACCAAAATC TGATTTCCCCCCATCTTCCTGGGGGGATTATCCCATGTGTATATCAATCG ATCAGTTGCAAAATTTCACGTAGATTTAAAAAATGCAATAAAAAAGTGAG AGCAACTTTCTGTATCAAAACTATGACTCTTTGAAGTACTACCTTTATTT TGACCCCTCTTCCTCTACTACGAGTATACTCGTAGTTGGCACCGAACGTG TTAAGTTACGCTCTTTCGCAGGAACTATTGTTAAAACTCAATGGGTAAGT ACCGATTAAAAATATGGTAAACGTAGAGTAAATCCACCGCTAAGGAATTG AGACAGGTCAGGGGAGTTTTTCTGAGAGGGTTTAGATATGCTATTTCATT GATATTTTAAGTGAATATTTTCTTCTTCTACTCAACAGATGAAATCCGAA CAGGAGCATACAGTAAATTGTATCACCCGGAACAGTTGATCAGTGGAAGT GAAGATGCAGCTAATAATTATGCTCGTGGTCATTACACAGTTGGAAAACA AATGATCGATGATGTCTTGGATAAAGTCCGAAGGTTAACCGAGAACTGTA CCGGTCTTCAAGGTTTCTTAATGTTCCATTCCTTTGGTGGAGGTACTGGA TCTGGTTTCACATCTCTCCTCATGGAACGAATCACAGCCGACTATAGCCG TAAATCTAAACTGGAGTTTGCAATCTATCCAGCTCCTCGAGTATCTACAG CTGTCGTTGAGCCATATAATGCTTGCTTAACGACGCATACGACATTGGAT AATTCAGATTGTGCTTTCATGGTTGATAACGAAGCTATCTATGATATCTG TAGACGCAATCTTGATATTGATCGTCCATCCTATACTAACTTGAATCGGT TGATTGGTCAAATTGTCTCCTCGATCACAGCTTCGTTGCGTTTCGATGGC TCCTTGAATGTTGATCTGAATGAGTTTCAAACCAACTTGGTCCCATACCC CAGAATTCATTTCCCAGTTGCCACCATAGCTCCAGTTCTGTCAGCTGCGA AAGCGTACCATGAGAAAATCTCCGTATCGGAAATAACACATCAATGCTTC GAGCCTGCAAACCAAATGGTGAAGTGTGATCCAAGGCTAGGTAAATACAT GGCTGTGTGCTTGTTATACCGTGGTGATGTTGTCCCTAAAGATGTTAATA CGGCAATTGCTCATTTAAAAACGAAAAAGAATATCCAATTCGTTGATTGG TGTCCAACTGGATTCAAAGTTGGAATCAATTACCAACCACCAACGACAGT GCCTGGTGGTGATCTCGCTAAAGTTCCTCGGTCTGTCTGCATGTTATCTA ACACAACTGCTGTTGCTGAGGCCTGGGCTCGATTGGATCATAAGTTCGAT TTGATGTATGCTAAACGTGCTTTTATACATTGGTATGTCGGTGAAGGGAT GGAGGAAGGTGAATTTGCTGAAGCCAGGGAGAATATGGCATCTTTGGAGA GAGATTATGAAGAAGTTGCTTCAGATTCAGTGGCTGATGATTATGATGAA GATGAGGAGGGAGAAGGAAGCGGTGAAGAATACTGAAGATCGTGTATTTC TCCCATTGCATTCACAGCTAAGTCTTTAAGATATCTTTAGAATTTTATGA ATTTTTGATTGAAAGCAAATTTAGAATGTATGATACTTAGAGATTGTTGA TTTAAAAATAAATTTGAAAATAATTTACACACCCCAACCTAAGCTACTAT CCCGGATAAAATTGCATTTTTGATAACAACAAGGGAGATATCCGTGGTGG TTTGTGGGTTCCTCTAAAATTAGGAGAGTTTTATTAAATCTTTCACTTTT TGAGCGTTTGTCCCGGGGTAATGGAGCCTGTTAAATATCTTCAGGACCAC TTGGACCAGTGGCACGTGACCGTACCCAATTTTGCCTTTTCTCTGTTTTG AACTATCACAGCAAATCAAAAAATGTCTGGAATAATTTCATTGAATTTAC TTCTTGCTAAGGTTAACTGTAATATTTTTTTGCATTTGTGTACATAGATT ATGGCGATTATCATAAAATTTTATGTTAATTTTAGAAATAGGGAAAATCA AAATTATCTAAATGCCGAAACACCTCTCTTGGTAAGTTCCTTAAAAGTTC AAAAATCAATGGTCGTAATGTCTCTACTCTCTACTAAAGTTCTACTTCCA AGCAATATAAGGGGG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000341XLOC_000341Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000578-exon-sc0000002-1575043694:1075545..1075800TCONS_00000578-exon-sc0000002-1575043694:1075545..1075800Clytia hemisphaericaexon
TCONS_00000578-exon-sc0000002-1575043694:1074662..1074881TCONS_00000578-exon-sc0000002-1575043694:1074662..1074881Clytia hemisphaericaexon
TCONS_00000578-exon-sc0000002-1575043694:1071636..1073412TCONS_00000578-exon-sc0000002-1575043694:1071636..1073412Clytia hemisphaericaexon
TCONS_00000578-exon-sc0000002-1510915933:1075545..1075800TCONS_00000578-exon-sc0000002-1510915933:1075545..1075800Clytia hemisphaericaexon
TCONS_00000578-exon-sc0000002-1510915933:1074662..1074881TCONS_00000578-exon-sc0000002-1510915933:1074662..1074881Clytia hemisphaericaexon
TCONS_00000578-exon-sc0000002-1510915933:1071636..1073412TCONS_00000578-exon-sc0000002-1510915933:1071636..1073412Clytia hemisphaericaexon
TCONS_00000578-exon-sc0000002-1491911889:1075545..1075800TCONS_00000578-exon-sc0000002-1491911889:1075545..1075800Clytia hemisphaericaexon
TCONS_00000578-exon-sc0000002-1491911889:1074662..1074881TCONS_00000578-exon-sc0000002-1491911889:1074662..1074881Clytia hemisphaericaexon
TCONS_00000578-exon-sc0000002-1491911889:1071636..1073412TCONS_00000578-exon-sc0000002-1491911889:1071636..1073412Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1071636..1075800 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.147848 0.171665 0 2.65798 1.93881 69.5879 79.5637 25.7224 25.9888 16.801 11.4409 11.2386 8.12566 2.65372 2.92244 7.74654 9.26325 11.7801 14.8424 10.9327 15.7678 3.30292 4.36921 4.72066 6.39226 9.75864 8.01716 0.33656 0
Blast
BLAST of TCONS_00000578 vs. Swiss-Prot (Human)
Match: TBA1A (Tubulin alpha-1A chain OS=Homo sapiens GN=TUBA1A PE=1 SV=1)

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 358/440 (81.36%), Postives = 407/440 (92.50%), Query Frame = 2
Query:  254 MRECISIHIGQAGCQIGNACWELYCMEHNIKPDGLM-NEEGSQRDDESFSTFFNETGNGKHVPRALFLDLEPNVIDEIRTGAYSKLYHPEQLISGSEDAANNYARGHYTVGKQMIDDVLDKVRRLTENCTGLQGFLMFHXXXXXXXXXXXXLLMERITADYSRKSKLEFAIYPAPRVSTAVVEPYNACLTTHTTLDNSDCAFMVDNEAIYDICRRNLDIDRPSYTNLNRLIGQIVSSITASLRFDGSLNVDLNEFQTNLVPYPRIHFPVATIAPVLSAAKAYHEKISVSEITHQCFEPANQMVKCDPRLGKYMAVCLLYRGDVVPKDVNTAIAHLKTKKNIQFVDWCPTGFKVGINYQPPTTVPGGDLAKVPRSVCMLSNTTAVAEAWARLDHKFDLMYAKRAFIHWYVXXXXXXXXXXXXXXNMASLERDYEEVASDSV 1570
            MRECISIH+GQAG QIGNACWELYC+EH I+PDG M +++     D+SF+TFF+ETG GKHVPRA+F+DLEP VIDE+RTG Y +L+HPEQLI+G EDAANNYARGHYT+GK++ID VLD++R+L + CTGLQGFL+FHSFGGGTGSGFTSLLMER++ DY +KSKLEF+IYPAP+VSTAVVEPYN+ LTTHTTL++SDCAFMVDNEAIYDICRRNLDI+RP+YTNLNRLIGQIVSSITASLRFDG+LNVDL EFQTNLVPYPRIHFP+AT APV+SA KAYHE++SV+EIT+ CFEPANQMVKCDPR GKYMA CLLYRGDVVPKDVN AIA +KTK+ IQFVDWCPTGFKVGINYQPPT VPGGDLAKV R+VCMLSNTTA+AEAWARLDHKFDLMYAKRAF+HWYVGEGMEEGEF+EARE+MA+LE+DYEEV  DSV
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV 440          
The following BLAST results are available for this feature:
BLAST of TCONS_00000578 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TBA1A0.000e+081.36Tubulin alpha-1A chain OS=Homo sapiens GN=TUBA1A P... [more]
back to top