Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000561 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000561
Unique NameTCONS_00000561
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2910

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000561 ID=TCONS_00000561|Name=TCONS_00000561|organism=Clytia hemisphaerica|type=transcript|length=2910bp
atctcttaggaattcctcgagggaattctattgtaatacactcgaaacaa
tcccacaatgcatcacttttttagaaaaataaaaaactccgataaggtct
actTTGTTGAACTCGAAACGACGATCAATTGAGCCAATAAAATCCTCAAT
TTCCATGATTTCAAAGAATTCGATTaacaaatttgatcaaaattttgtca
tttGATTTTCAACGATGTTCGTTTAAATTAGGCCTGTCCAAAGGTCGATT
TGAATTCGACTGAGTGATTGCGACTAACATCCTCCAAGCGCATTTATCGA
TTAATTGGAGTCTGCTCGTTAGAAAATAGCCTGTGTTAGGTCTTGACAGA
ATCCAAATTAACGGTACAACAATTAGGgtcattttttttacaatttcgaA
GCTATATTTAATTGTTCACGATATCTGCActtatgaattatttttcaatt
atctTACTAGAAAATAGATGCAATTGGCTTATTATCGATGGGCTCATTTA
TAGTATACACTACGATATAAattgtgaatttatttttttgataccGTACT
GACAATTTATTACAAATGAGATTNGTTGGCTTATTATGACTATTATTGAT
GGGCTCATTTATAGTATGCACTATGAtataaattatgaatttattttttg
ataccGTACTGACAATTTATTACAAATGAGATTCTGCTGataaatttttg
attaatttgCTTTTTTGGCTTAGTTTAGTCACACTCTAAATTGAAACTGA
TACTGCTTGCGTTAGCAGTTTTGCTTGGTCTTGTGATATCTgcagaaagt
aaacaaaaaattgtttattttgcacAATTAGATTTACAGTAAAAACCTCT
AAGAGTAGTGGAANGTTTATTTTGCACAAATAGATTTACAGTAAAAAGCT
CTAAGAGTAGTGGAATTTGATCAGTTTTCTTGTGACTGTTTGTGGAAAAA
GTCTTTCTAATTTGGTGGTTGTCTTTCTATCTACGACTTTTGAAGATAAA
AGGAAAATCTTAACGCTAGACATTAACTTTTACAACTATGGATGGTTCAT
GTAACAAATGCATCAAATATTTGatgtttatttttaatttcatcttttgg
CTCAGTGGATTAGCACTCATTATAATAGGGTCGTATATGAAAACACGATA
TGGTGATTATCTATCTTACGGTGACGGTTACAAATTTCTATCAGTATCAG
TCTTCGTTATTGTTCTTGGTGTAATTATTTTCATTCTTGGATTTTTGGGT
TGCTGTGGAGCTATCAAAGAAAATTACTGTATGATCACAACATTCGCAAT
TCTCATGAGTATCATTTTGATTCTTCAAATTGCAGCTGGTGTTCTTGGAT
TTGTTTACAAAGGAAAGGTCGAAACAATCGTTGAAAATACATTAAACGGT
GCtgtgcaaaaatattttgacgatAGCCAACCAGGTGCTAAAACACTCTT
AGATTGGGctcaacaaaaatttgaatGCTGTGGAATCAAAGGGCCTGGTG
ACTACAGACAACCCTCCACAACATCATCTTATTACTGTGCCAAGTCTGGT
GGTGTGGCTTCTTGTTACTCTGATAACAAATGTGGTTCTGGCGTCCAATA
TGGTGAAGGTTGCGAGCAAAGTGTAATTGATATTGCCAAGAATAACATGT
TACTGTGTGGTGCTTTTGCAATAGCATTCGCTCTAATACAAATACTCGGA
GTGACATTTGCTTGCTGTCTCATGAAATCAGTCAGAAATAGTTACGAAAC
CGTTTAAAGTTACGCTGGGAACGCTGGGAAAGCTGATTTCTACTGTGCTC
GTTGCAAATAATATCCATCTTGATCTCATCCAAAAGTTAATGACTAAATC
TAACAGCCCACAAAAAGCTTTACTGGAATCAATAATTTTAAGGaatttat
tttcgatttttttcataaattgtggaaattatttttcatctttaattTTC
TGTTACTTCTTCATATATGTACAATGTgaataaaaatttctttctctata
ataataataatcttaGAAaggaataaataaaaattttcatctaaAACCGA
AAAAATTGGACAGGAGGTATTCAGACATGCATCTTTATTCTGGATTgcga
aaaattgcgaaaaattgcgaaaaattcTGTCAGGTCAAGTCTGGCAGTTc
aggatttttttttacttagacgagaccaatttgattcgttgttttacggg
cccgaccgaccctgaaattcaaaaaatcgaaatgaaaataaaattgatag
aacgttaaattctacttttattttttcgctgaccgaccctcttttttggg
tagcttggcccgtaaaacaacaaattaagtGTTTTCGTACTTGAAGAATA
AGAGAATAGGACACATAATTTATTGTCTACATCAAAAACAATCGATTGAT
AGTAATGTAGCTCATAACCAAAGTAAGCTTCTAAAAAATAGTAGTTTTTT
TTCTAGTCTTCAGATAGTAAAAATTTAGTAGTTTTTTTTCCATACAGTAT
TGTGAAAGTGAACGTGCATCACTCCTGGTGTAAATGTGAAAAGCATGCTT
AGTTAAACAGTTCTATGATATCGAACCAATTTTGATGCTCCAAACCTTTT
TCATGTCATGGGCATGGAAGGAGTTTTTTTAATGGCTGATCCGATTCCAC
TATTGATTGCAAACAATATTCATAACGATCACCGTAAATCAAGCTTGCGA
AGTTTCCTCAGCGATGGCGTCTACAGCTTGTCGGATTTTGCCGCTAGTTT
CATCCGTCAGACGGTCTGCCAACGTTTCGTCTGAAAACGAGTCTGATGAA
AAAATGTTGGTAAATAGTGTGAAATTGAAGTACCATTTGGAGGGTTTAAC
AtaactttgtttttaaaactaaaCTTTTCTCAGGTACCTTTATGAATACT
CTTGTCTCCN
Run BLAST on NCBI

protein sequence of TCONS_00000561-protein

>TCONS_00000561-protein ID=TCONS_00000561-protein|Name=TCONS_00000561-protein|organism=Clytia hemisphaerica|type=polypeptide|length=239bp
MDGSCNKCIKYLMFIFNFIFWLSGLALIIIGSYMKTRYGDYLSYGDGYKF
LSVSVFVIVLGVIIFILGFLGCCGAIKENYCMITTFAILMSIILILQIAA
GVLGFVYKGKVETIVENTLNGAVQKYFDDSQPGAKTLLDWAQQKFECCGI
KGPGDYRQPSTTSSYYCAKSGGVASCYSDNKCGSGVQYGEGCEQSVIDIA
KNNMLLCGAFAIAFALIQILGVTFACCLMKSVRNSYETV
Run BLAST on NCBI

transcript from alignment at sc0000002:698087..702769-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000561 ID=TCONS_00000561|Name=TCONS_00000561|organism=Clytia hemisphaerica|type=transcript|length=4683bp|location=Sequence derived from alignment at sc0000002:698087..702769- (Clytia hemisphaerica)
ATCTCTTAGGAATTCCTCGAGGGAATTCTATTGTAATACACTCGAAACAA TCCCACAATGCATCACTTTTTTAGAAAAATAAAAAACTCCGATAAGGTCT ACTTTGTTGAACTCGAAACGACGATCAATTGAGCCAATAAAATCCTCAAT TTCCATGATTTCAAAGAATTCGATTAACAAATTTGATCAAAATTTTGTCA TTTGATTTTCAACGATGTTCGTTTAAATTAGGCCTGTCCAAAGGTCGATT TGAATTCGACTGAGTGATTGCGACTAACATCCTCCAAGCGCATTTATCGA TTAATTGGAGTCTGCTCGTTAGAAAATAGCCTGTGTTAGGTCTTGACAGA ATCCAAATTAACGGTACAACAATTAGGGTCATTTTTTTTACAATTTCGAA GCTATATTTAATTGTTCACGATATCTGCACTTATGAATTATTTTTCAATT ATCTTACTAGAAAATAGATGCAATTGGCTTATTATCGATGGGCTCATTTA TAGTATACACTACGATATAAATTGTGAATTTATTTTTTTGATACCGTACT GACAATTTATTACAAATGAGATTNGTTGGCTTATTATGACTATTATTGAT GGGCTCATTTATAGTATGCACTATGATATAAATTATGAATTTATTTTTTG ATACCGTACTGACAATTTATTACAAATGAGATTCTGCTGATAAATTTTTG ATTAATTTGCTTTTTTGGCTTAGTTTAGTCACACTCTAAATTGAAACTGA TACTGCTTGCGTTAGCAGTTTTGCTTGGTCTTGTGATATCTGCAGAAAGT AAACAAAAAATTGTTTATTTTGCACAATTAGATTTACAGTAAAAACCTCT AAGAGTAGTGGAANGTTTATTTTGCACAAATAGATTTACAGTAAAAAGCT CTAAGAGTAGTGGAATTTGATCAGTTTTCTTGTGACTGTTTGTGGAAAAA GTCTTTCTAATTTGGTGGTTGTCTTTCTATCTACGACTTTTGAAGATAAA AGGAAAATCTTAACGCTAGACATTAACTTTTACAACTATGGATGGTTCAT GTAACAAATGCATCAAATATTTGATGTTTATTTTTAATTTCATCTTTTGG GTAAGTATTTTTTTAAATCTTAATCTTTTTATTCTCCTCTAAAAATACTT TCTAACAGAGTATAATAACTTTCTACTAAAGCTAAATGGGTGCTGAGAAA TTATTCAAAAAGTAAAACGTTCACATAATTTTGAGACAGACTTTTAGTAA CTCCACATATTTTTGAGACAGACTTTTAGTACCTCCCTGAACAGTGTTTA ATTCGAAAATTCTGATTAATTAATTCGAAAAAACACCCCTGTCTCAACAA CCCGGTGGAACCTTTTCTTTCAGTTGGAATGAAGCTTTATCGAAATCCCA ATGGGATAAAAAGACAGTTTCCAATTTTCACTGCTTGATTTTGAATGGGA ATAAAATCGTCGGGTGATATCGCAGAGAGGTTAAAATTGGTATTTTTTTT AACGGGGACGAGTTTCTGGCCAATTTTTCCAGTTGGCCGTGGGACCACCG GGTCTGTGACACGACGTTGTTTCGTATCATCCTTCTTTATTTATCTTACT CTATTCGTTTTCTCTTTTCAGCTCAGTGGATTAGCACTCATTATAATAGG GTCGTATATGAAAACACGATATGGTGATTATCTATCTTACGGTGACGGTT ACAAATTTCTATCAGTATCAGTCTTCGTTATTGTTCTTGGTGTAATTATT TTCATTCTTGGATTTTTGGGTTGCTGTGGAGCTATCAAAGAAAATTACTG TATGATCACAACATTCGCAATTCTCATGAGTATCATTTTGATTCTTCAAA TTGCAGCTGGTGTTCTTGGATTTGTTTACAAAGGAAAGGCAAAATAACTT CAGTATGGGTAAACCCCCTTCTCACAGACCTGGCATGAGTTTTTTAGCCA GTGGGGGTAAAAATAACGGACAAGAACTTGATGGGGGATTGCTATTGCCA TATTTCTATCTATTGTTTTTCAGCGGGGATGGGAAAAAAAAGATATTTTT GCAGTGAGGATTATTTTCAGTGGGGACGGAATTTGGAGTATAATTTTCCA CTGGGGAGGATATTTAGGCCAATTTTTCAAGTGGGGCTGTGAGAAGGGGG TATACGGATTGTGGAAATACTCTCATACCTCTACAAATACAGCTACATGC TAGGGCCCTAGANAGGGGTATATGGATTGTGGAAATACTCTCATACCTCT CAAAAAACAGCTACATACTAGGGCCCTAGAACAATTAATTACCCAACAGC TGTCTGAAGGCAATCGTTTAGGCTTCTGCTATCCTCTGGAGGAAGATATC AATCTAGTTATTTTCTGCCCTGCATATTAGAGGTTAATTACAGGTATCAA GCGGTGACACAAATAGCACTGTCTTCATTTTTTTTGGGAATTTTAATGTA AGAAATGGCATATATTCGTTCCTAAGATCTTTGTACTACTATAAGTTTAC TAAAAATTAATTTTCAACACGACAGGTCGAAACAATCGTTGAAAATACAT TAAACGGTGCTGTGCAAAAATATTTTGACGATAGCCAACCAGGTGCTAAA ACACTCTTAGATTGGGCTCAACAAAAATTTGAATGCTGTGGAATCAAAGG GCCTGGTGACTACAGACAACCCTCCACAACATCATCTTATTACTGTGCCA AGTCTGGTGGTGTGGCTTCTTGTTACTCTGATAACAAATGTGGTTCTGGC GTCCAATATGGTGAAGGTTGCGAGCAAAGTGTAATTGATATTGCCAAGAA TAACATGTTACTGTGTGGTGCTTTTGCAATAGCATTNGAGTGTAATTGAT ATTGCCAAGAACAACATGTTACTGTGTGGTGCTTTTGCAATAGCATTCGC TCTAATACAAGTAAGTAGAGTTTAAAAATCTTCGTAACGTCGTGCTATTG CTACTTAGGACCCTCCCCTACCTTAGGGTATATAGCTAACGAAGGAAACG CTTTTAGGTCGCCCCCTACTGCGGTCACAGACTTACTAGACTAAAGTCTT ACTTCTGACTGAACTTTGCTTTCTGATGATTTTGATGGCGTTGAGTCCAG TGAAGTATACTAGAGGATATTGCCATCTTGAATTTCTTCACTTTCGTTTT CAAAAATTATATCAAGACGCCAAAACAATAAAATATATTCTAAAATCCAA TCAAAGTTTACGAGACTATAATAAAAACTCAAAAATACCTCCTAACTTTG AAAACAATCGATCCCTTGGTCATAGTTTTCTATTTGTTTTTCTCGAAAAG AGGACTGGATCTAGTGGCATGTATTTGCTACCACCTCAAAAGATGGAGCC TGCCAAATTACACCGGGCCACTTATCAGCGCCATCCAGTCTATCAGTGGC CCCAGGGCTACAGACTTACTTACTTATTTTAGTCTAGATACTATCTTTTG AATTTTAATTTCAGATACTCGGAGTGACATTTGCTTGCTGTCTCATGAAA TCAGTCAGAAATAGTTACGAAACCGTTTAAAGTTACGCTGGGAACGCTGG GAAAGCTGATTTCTACTGTGCTCGTTGCAAATAATATCCATCTTGATCTC ATCCAAAAGTTAATGACTAAATCTAACAGCCCACAAAAAGCTTTACTGGA ATCAATAATTTTAAGGAATTTATTTTCGATTTTTTTCATAAATTGTGGAA ATTATTTTTCATCTTTAATTTTCTGTTACTTCTTCATATATGTACAATGT GAATAAAAATTTCTTTCTCTATAATAATAATAATCTTAGAAAGGAATAAA TAAAAATTTTCATCTAAAACCGAAAAAATTGGACAGGAGGTATTCAGACA TGCATCTTTATTCTGGATTGCGAAAAATTGCGAAAAATTGCGAAAAATTC TGTCAGGTCAAGTCTGGCAGTTCAGGATTTTTTTTTACTTAGACGAGACC AATTTGATTCGTTGTTTTACGGGCCCGACCGACCCTGAAATTCAAAAAAT CGAAATGAAAATAAAATTGATAGAACGTTAAATTCTACTTTTATTTTTTC GCTGACCGACCCTCTTTTTTGGGTAGCTTGGCCCGTAAAACAACAAATTA AGTGTTTTCGTACTTGAAGAATAAGAGAATAGGACACATAATTTATTGTC TACATCAAAAACAATCGATTGATAGTAATGTAGCTCATAACCAAAGTAAG CTTCTAAAAAATAGTAGTTTTTTTTCTAGTCTTCAGATAGTAAAAATTTA GTAGTTTTTTTTCCATACAGTATTGTGAAAGTGAACGTGCATCACTCCTG GTGTAAATGTGAAAAGCATGCTTAGTTAAACAGTTCTATGATATCGAACC AATTTTGATGCTCCAAACCTTTTTCATGTCATGGGCATGGAAGGAGTTTT TTTAATGGCTGATCCGATTCCACTATTGATTGCAAACAATATTCATAACG ATCACCGTAAATCAAGCTTGCGAAGTTTCCTCAGCGATGGCGTCTACAGC TTGTCGGATTTTGCCGCTAGTTTCATCCGTCAGACGGTCTGCCAACGTTT CGTCTGAAAACGAGTCTGATGAAAAAATGTTGGTAAATAGTGTGAAATTG AAGTACCATTTGGAGGGTTTAACATAACTTTGTTTTTAAAACTAAACTTT TCTCAGGTACCTTTATGAATACTCTTGTCTCCN

Coding sequence (CDS) from alignment at sc0000002:698087..702769-

>TCONS_00000561 ID=TCONS_00000561|Name=TCONS_00000561|organism=Clytia hemisphaerica|type=CDS|length=3600bp|location=Sequence derived from alignment at sc0000002:698087..702769- (Clytia hemisphaerica)
ATACTCGGAGTGACATTTGCTTGCTGTCTCATGAAATCAGTCAGAAATAG
TTACGAAACCGTTTAAATGTTACTGTGTGGTGCTTTTGCAATAGCATTCG
CTCTAATACAAGTCGAAACAATCGTTGAAAATACATTAAACGGTGCTGTG
CAAAAATATTTTGACGATAGCCAACCAGGTGCTAAAACACTCTTAGATTG
GGCTCAACAAAAATTTGAATGCTGTGGAATCAAAGGGCCTGGTGACTACA
GACAACCCTCCACAACATCATCTTATTACTGTGCCAAGTCTGGTGGTGTG
GCTTCTTGTTACTCTGATAACAAATGTGGTTCTGGCGTCCAATATGGTGA
AGGTTGCGAGCAAAGTGTAATTGATATTGCCAAGAATAACCTCAGTGGAT
TAGCACTCATTATAATAGGGTCGTATATGAAAACACGATATGGTGATTAT
CTATCTTACGGTGACGGTTACAAATTTCTATCAGTATCAGTCTTCGTTAT
TGTTCTTGGTGTAATTATTTTCATTCTTGGATTTTTGGGTTGCTGTGGAG
CTATCAAAGAAAATTACTGTATGATCACAACATTCGCAATTCTCATGAGT
ATCATTTTGATTCTTCAAATTGCAGCTGGTGTTCTTGGATTTGTTTACAA
AGGAAAGATGGATGGTTCATGTAACAAATGCATCAAATATTTGATGTTTA
TTTTTAATTTCATCTTTTGGATACTCGGAGTGACATTTGCTTGCTGTCTC
ATGAAATCAGTCAGAAATAGTTACGAAACCGTTTAAATGTTACTGTGTGG
TGCTTTTGCAATAGCATTCGCTCTAATACAAGTCGAAACAATCGTTGAAA
ATACATTAAACGGTGCTGTGCAAAAATATTTTGACGATAGCCAACCAGGT
GCTAAAACACTCTTAGATTGGGCTCAACAAAAATTTGAATGCTGTGGAAT
CAAAGGGCCTGGTGACTACAGACAACCCTCCACAACATCATCTTATTACT
GTGCCAAGTCTGGTGGTGTGGCTTCTTGTTACTCTGATAACAAATGTGGT
TCTGGCGTCCAATATGGTGAAGGTTGCGAGCAAAGTGTAATTGATATTGC
CAAGAATAACCTCAGTGGATTAGCACTCATTATAATAGGGTCGTATATGA
AAACACGATATGGTGATTATCTATCTTACGGTGACGGTTACAAATTTCTA
TCAGTATCAGTCTTCGTTATTGTTCTTGGTGTAATTATTTTCATTCTTGG
ATTTTTGGGTTGCTGTGGAGCTATCAAAGAAAATTACTGTATGATCACAA
CATTCGCAATTCTCATGAGTATCATTTTGATTCTTCAAATTGCAGCTGGT
GTTCTTGGATTTGTTTACAAAGGAAAGATGGATGGTTCATGTAACAAATG
CATCAAATATTTGATGTTTATTTTTAATTTCATCTTTTGGATACTCGGAG
TGACATTTGCTTGCTGTCTCATGAAATCAGTCAGAAATAGTTACGAAACC
GTTTAAATGTTACTGTGTGGTGCTTTTGCAATAGCATTCGCTCTAATACA
AGTCGAAACAATCGTTGAAAATACATTAAACGGTGCTGTGCAAAAATATT
TTGACGATAGCCAACCAGGTGCTAAAACACTCTTAGATTGGGCTCAACAA
AAATTTGAATGCTGTGGAATCAAAGGGCCTGGTGACTACAGACAACCCTC
CACAACATCATCTTATTACTGTGCCAAGTCTGGTGGTGTGGCTTCTTGTT
ACTCTGATAACAAATGTGGTTCTGGCGTCCAATATGGTGAAGGTTGCGAG
CAAAGTGTAATTGATATTGCCAAGAATAACCTCAGTGGATTAGCACTCAT
TATAATAGGGTCGTATATGAAAACACGATATGGTGATTATCTATCTTACG
GTGACGGTTACAAATTTCTATCAGTATCAGTCTTCGTTATTGTTCTTGGT
GTAATTATTTTCATTCTTGGATTTTTGGGTTGCTGTGGAGCTATCAAAGA
AAATTACTGTATGATCACAACATTCGCAATTCTCATGAGTATCATTTTGA
TTCTTCAAATTGCAGCTGGTGTTCTTGGATTTGTTTACAAAGGAAAGATG
GATGGTTCATGTAACAAATGCATCAAATATTTGATGTTTATTTTTAATTT
CATCTTTTGGATACTCGGAGTGACATTTGCTTGCTGTCTCATGAAATCAG
TCAGAAATAGTTACGAAACCGTTTAAATGTTACTGTGTGGTGCTTTTGCA
ATAGCATTCGCTCTAATACAAGTCGAAACAATCGTTGAAAATACATTAAA
CGGTGCTGTGCAAAAATATTTTGACGATAGCCAACCAGGTGCTAAAACAC
TCTTAGATTGGGCTCAACAAAAATTTGAATGCTGTGGAATCAAAGGGCCT
GGTGACTACAGACAACCCTCCACAACATCATCTTATTACTGTGCCAAGTC
TGGTGGTGTGGCTTCTTGTTACTCTGATAACAAATGTGGTTCTGGCGTCC
AATATGGTGAAGGTTGCGAGCAAAGTGTAATTGATATTGCCAAGAATAAC
CTCAGTGGATTAGCACTCATTATAATAGGGTCGTATATGAAAACACGATA
TGGTGATTATCTATCTTACGGTGACGGTTACAAATTTCTATCAGTATCAG
TCTTCGTTATTGTTCTTGGTGTAATTATTTTCATTCTTGGATTTTTGGGT
TGCTGTGGAGCTATCAAAGAAAATTACTGTATGATCACAACATTCGCAAT
TCTCATGAGTATCATTTTGATTCTTCAAATTGCAGCTGGTGTTCTTGGAT
TTGTTTACAAAGGAAAGATGGATGGTTCATGTAACAAATGCATCAAATAT
TTGATGTTTATTTTTAATTTCATCTTTTGGATACTCGGAGTGACATTTGC
TTGCTGTCTCATGAAATCAGTCAGAAATAGTTACGAAACCGTTTAAATGT
TACTGTGTGGTGCTTTTGCAATAGCATTCGCTCTAATACAAGTCGAAACA
ATCGTTGAAAATACATTAAACGGTGCTGTGCAAAAATATTTTGACGATAG
CCAACCAGGTGCTAAAACACTCTTAGATTGGGCTCAACAAAAATTTGAAT
GCTGTGGAATCAAAGGGCCTGGTGACTACAGACAACCCTCCACAACATCA
TCTTATTACTGTGCCAAGTCTGGTGGTGTGGCTTCTTGTTACTCTGATAA
CAAATGTGGTTCTGGCGTCCAATATGGTGAAGGTTGCGAGCAAAGTGTAA
TTGATATTGCCAAGAATAACCTCAGTGGATTAGCACTCATTATAATAGGG
TCGTATATGAAAACACGATATGGTGATTATCTATCTTACGGTGACGGTTA
CAAATTTCTATCAGTATCAGTCTTCGTTATTGTTCTTGGTGTAATTATTT
TCATTCTTGGATTTTTGGGTTGCTGTGGAGCTATCAAAGAAAATTACTGT
ATGATCACAACATTCGCAATTCTCATGAGTATCATTTTGATTCTTCAAAT
TGCAGCTGGTGTTCTTGGATTTGTTTACAAAGGAAAGATGGATGGTTCAT
GTAACAAATGCATCAAATATTTGATGTTTATTTTTAATTTCATCTTTTGG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000333XLOC_000333Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000561-exon-sc0000002-1575043694:701670..702769TCONS_00000561-exon-sc0000002-1575043694:701670..702769Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1575043694:700882..701148TCONS_00000561-exon-sc0000002-1575043694:700882..701148Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1575043694:699966..700244TCONS_00000561-exon-sc0000002-1575043694:699966..700244Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1575043694:699860..699904TCONS_00000561-exon-sc0000002-1575043694:699860..699904Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1575043694:698087..699305TCONS_00000561-exon-sc0000002-1575043694:698087..699305Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1510915933:701670..702769TCONS_00000561-exon-sc0000002-1510915933:701670..702769Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1510915933:700882..701148TCONS_00000561-exon-sc0000002-1510915933:700882..701148Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1510915933:699966..700244TCONS_00000561-exon-sc0000002-1510915933:699966..700244Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1510915933:699860..699904TCONS_00000561-exon-sc0000002-1510915933:699860..699904Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1510915933:698087..699305TCONS_00000561-exon-sc0000002-1510915933:698087..699305Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1491911889:701670..702769TCONS_00000561-exon-sc0000002-1491911889:701670..702769Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1491911889:700882..701148TCONS_00000561-exon-sc0000002-1491911889:700882..701148Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1491911889:699966..700244TCONS_00000561-exon-sc0000002-1491911889:699966..700244Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1491911889:699860..699904TCONS_00000561-exon-sc0000002-1491911889:699860..699904Clytia hemisphaericaexon
TCONS_00000561-exon-sc0000002-1491911889:698087..699305TCONS_00000561-exon-sc0000002-1491911889:698087..699305Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000561-proteinTCONS_00000561-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:698087..702769 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.765998 0.630639 0.649392 0.542251 1.30213 0.909631 12.8843 14.4303 21.8681 28.129 50.7439 11.592 16.6741 12.4547 55.1856 58.1064 19.0598 13.9564 43.8482 47.2324 9.83167 10.3054 9.38615 21.9881 13.9942 21.7489 25.6355 15.1822 92.7701 61.4739
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000301Tetraspanin
IPR008952Tetraspanin_EC2
IPR018499Tetraspanin/Peripherin
IPR018503Tetraspanin_CS
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
Blast
BLAST of TCONS_00000561 vs. Swiss-Prot (Human)
Match: CD63 (CD63 antigen OS=Homo sapiens GN=CD63 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 1.654e-22
Identity = 73/239 (30.54%), Postives = 131/239 (54.81%), Query Frame = 3
Query: 1056 KCIKYLMFIFNFIFWLSGLALIIIGSYMKTRYGDYLSYGDGYKXXXXXXXXXXXXXXXXXXXXXXCCGAIKENYCMITTFAILMSIILILQIAAGVLGFVYKGKVETIVENTLNGAVQKYFDDSQPGAKTLLDWAQQKFECCGIKGPGDYRQPSTTSSYYCAKSGGVASCYSDNKCGSGVQYG------EGCEQSVIDIAKNNMLLCGXXXXXXXXXXXXGVTFACCLMKSVRNSYETV 1754
            KC+K+L+++    F    + LI +G   +      +  G       + V +I +GV +F++ F+GCCGA KENYC++ TFAI +S+I+++++AA + G+V++ KV +   N     ++ Y  ++     ++LD  Q  F+CCG     D+ +  + S     K+    SC  +   G G+ +       EGC + +    + N+L+  A A+  A +++LG+ FACCL+KS+R+ YE +
Sbjct:    8 KCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQG-ATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTA--SILDRMQADFKCCGAANYTDWEKIPSMS-----KNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM 238          
The following BLAST results are available for this feature:
BLAST of TCONS_00000561 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CD631.654e-2230.54CD63 antigen OS=Homo sapiens GN=CD63 PE=1 SV=2[more]
back to top