Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000550 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000550
Unique NameTCONS_00000550
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1838

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000550 ID=TCONS_00000550|Name=TCONS_00000550|organism=Clytia hemisphaerica|type=transcript|length=1838bp
tctcagttcaaaattattaaaaattatgtgaaaataatataaaagaaaat
aatgtaaacaaagatgccgaaaaaggccaaaaaagctaaaggaaaatcta
aaaaagacaaaaaaggAAGGAAGTCATCAAAAGGAGTCAAAGTCAATAAT
GACGACGTTTTGAAACAAGCTATAGCCAATGCTTGCTTATGGGAAAGTCG
TCTTGGAACTGTCGAAGTTGCCAAAAATGAGTATAGGGACACGACACGAA
CGTTGCTTCATGAAAATGAGAAACTTCAAACACAAGTATCACAGACAGAG
AAGGAGACTGTTGACGTCCTTAGTTTCCTGAGGGATGAAGATATCAAGAA
AAATAATACGATCAACAAACTACAACTAATGATCAAAGACTTGAAAAAAG
attacaagaaagaaaaacaaggaTTTATAGATGACTACACCAAACAGATC
GAAACACTTCAGACAAGTCTAACGGACAAAACAAATGAAGTGAAACTGAT
GCAATCGGAGTTGAAATTGGTGAAAGAATTTCGTCGGAAAAGAGCTCTCA
TGCAGAAAGAGATTGATGATATCAAAGACAATCTTTTCATGAACGAAAAA
CAACATGAAAATGCTCTGGAAAAAATCGAAAGAAAGTTCTTCGATGAAAA
GATTCGTATGCAGCAAGAAGCCAATCGAAAGATTTCCGAACTTGCTGAAA
GAGCTCATAACGAAGCTATCAGCAATTTGGACGATACAACGAAATCAGTT
TATAAAGAGAACGTTCGATTAAACGAAGCATTGACTTATCATATCAAAGC
TGGTGAAGAATTATCACAGcacaaagaaaatttggaaGAGCAGAACAAGA
AATTAAGCAGTGAAAAAGAAATGAACAGCCTCATCGTCGAAGAGAAAGTC
ATCGAAagcaagaaaattaaaaaagctaACAGCTCGCTTCAACAAAAAGT
TGATGACCTTGAGAAAGCATTGACAGAAGTGATGTCGGAgaataatcaaa
agaaaacatcCTTAGTTCAGAAACATAATCAAGAACAAGAGGGAAATAAA
ATGGAAATAGCACGGCTACAACGTATCATTGAACTAAAGAATAAGGAGAT
GAGCCGTGTCAAGAAACTTGCCAAAAACATCCTCGATCAGCGTTCAGATG
TCGAAAAATTCTTTATCGAATCATTGGAAATGGTCAAAACTGAAATCATC
AGAAATCGtgcgCAATATCGACGAGACGCTGAAGTAGCATACAATAAAAG
AATGACCGAAGCACATTCTGGTCACTCTGATTATCCCAAAGTCCGCACAT
TTCGTCATCTAAAGAACAGCACTAATTCCGTGTACGCAGATCTACGCGCG
GCCGAACGGTGGGATGGGTTTGACGCGTCGGTTGATCTTTCAGAATTAAC
ATGGGAACAGAGAGAACAGGTTCTTCGCTTGTTGTTCGCTAAGATGAATG
GCCAGAAAACATCAAAAGTCAGCAAAAGTATACTTCCACCCATCAACAGT
AAGATGGACGAAACTAAAGCTCATCAACCGAAACCACCTTCCGTTCAAAA
AGCTTTTCTCACGGAAGCCGATGATCCAAAAGAGGGTGTCAGTAGTGATG
CAAGTAGGGTATTTTCAGCCACTGAGATCCTTGCTTTTACATGACTTTTA
TGACTTAGCAATTTTTAGGGTACTGATTatttgtaattaattttttttga
aaagttgtatATAATAGTTTGTGTATAGATTTAATCAGAATAGAAtgtga
ttttattttattaccttgtaaaataattaattttttaatgatggtttaat
ttattttttggtaaagaCTGATTCAAGGAAAAGTAATT
Run BLAST on NCBI

transcript from alignment at sc0000002:470542..486353-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000550 ID=TCONS_00000550|Name=TCONS_00000550|organism=Clytia hemisphaerica|type=transcript|length=15812bp|location=Sequence derived from alignment at sc0000002:470542..486353- (Clytia hemisphaerica)
TCTCAGTTCAAAATTATTAAAAATTATGTGAAAATAATATAAAAGAAAAT AATGTAAACAAAGATGCCGAAAAAGGCCAAAAAAGCTAAAGGAAAATCTA AAAAAGACAAAAAAGGGTAAGAACTTTCTTTCATTTTTACTTCAAAAAGA CTTATTTTTACTGAAAAAAAGCCTCTTCGACAAGGCTATAAGCAGAGGAA ACAAAAAATGCTATAACTTCTTATAGAAATAGAACCAAATGTTTTTGTAC TTGTTGAAAAGATATTCAGGAGTGGAACATTATTATAAAGAAAAAACTTT TCTTTAAAAAATTTTTTTTCGCAAAAAGACTTTTTCACAGTGATAACACT TTAAGATTGAAGATATTTTTATTTAAAAATGGTGACCATAGCACAATTAA TTCTACAAGGGCTGGATTTTTCTCTTCTTTACTTTTCTTTATTTTTTTAA TCTTAGAAGGAAGTCATCAAAAGGAGTCAAAGTCAATAATGACGACGTTT TGAAACAAGCTATAGCCAATGCTTGCTTATGGGAAAGTCGTCTTGGAACT GTCGAAGTTGCCAAAAATGAGTATAGGTAATGATTATTTTTCTAACAGAT CATTCATTCTACCAGCACTTTGCTTTGCACTAAAGGTACAGCTCTCTTTT AGTAATACTCATCCAATATCGATATTTACTTGGATAGTTCAGTAGTCTGC TAATTTTAGACAGTCTTTTGATTATTTTCACCGGTCCAGGGCCAGTCGGC TATCTATGAACTGAACAGAACATTGAAAGGAGCGGGGATTCGACTTTGGA ATTTGTTTAATATTTTTATTCTTTATTTAAAGTTGGGGACGCTAATAGAA ATACACAAGTATAATAGGAATTCTGATCAAATCCAACCAATTTCTAAGAT AAAAAGAATTGTTAAACCTCTCAACCAATCTTAATAGGGACACGACACGA ACGTTGCTTCATGAAAATGAGAAACTTCAAACACAAGTATCACAGACAGA GAAGGAGACTGTTGACGTCCTTAGTTTCCTGAGGGATGAAGATATCAAGA AAAATAATACGGTATTCATCAGTTTAATCATAACCATCATGGACCTAGAG TTTTTTCATGGCACGATGAGTGTCCTCTCATTTGGGAGGGGCGGTTACAA AGTTAGGGTACTTGACTAGTGCCATAAATGTGTACTAACCACTGACCTTT ATATATCCCTGGAACAAGCTATATCCACCATCTTTGATCAGAGTTTTTTT GGAATTGGTACCCGAGAAGAATCCATTGCAATGTTAAAAATTAACATATA TAAAGGCCCTACATCATCAAAAGTATTCGAGATAAAGTAGATCTAGCGCT CTCGATGCATTTTCACCATTTCGCCATTAGGGTACCAATTTCAAAAAATC TCCGATCAAAGATTTTTGGTTGGCCGGAATTGAGTAACTTGGTCAAGGGT ATATAAAGGTGAGTGGTACTAACATGGTTTTGGGAATGGAGTTTTGACCA TCATCCGTTTGTACCTTAATATAAAAAGTTGAAAATATGCCTTCAATGTA GGTAGACCACCCCTAACTAACTGGAATTACCTGTTAAAATCCTTATTTTG ACGGGAAAGCAAGAGTAGAATTATACAGCCTAGTACCCAAAAATGTCCTA AGTTTTTACTTCCCTTAAAAATAAAAAATAAACACTTTTTCTTAGGCACT TTTCGATACTGAGGTATTATAATCGACTTTTTTTCTCCAAATTTGCACAA GGTAAAGTTGAAAATCAGCTTTTAAATGAATTTCCAGCTTTGACCACTCC ACTTAGTACATGGTACTAAGTTGTTTTTGACTTGCCAATTTTGACCATCA ACCCCGGTAGTGGTCCCTACAATCTAGTACTGAGCCCCTGTTCAATAGAT TTGATTTAGACCTCGACTTGGGGTTCCATCGATATCAAGGACAATCCTCT CCAGGTCGACGAATAAGAAATCCATTGTACTCTATAACTTTTTTGAATTC TTTACAGTATTCTATACATTGTCGCTTTCCTATTACAGTATCTGTAATAT GCGAGAAATCGGTCTTGTTTTTTTCATTGCCTTTTCCTTGGTTCCATACG TAAATATAACCGACATCTCTTCAGAAGTATGCAGTATGTTTTTTAATAGG GATAATAATATATTTTCGTAATACTTTTCAAAAGGGTGGAAAATTTCTTG CTCTACTGAAGAAATTTGAAATTCGATTGTCTTATTCGATCATTATTTTT TTTGTTGGTCGTTCTGTTCAATTTAGTTCTTATTGATCCGATCGTCTATT CCGTTCGACTGAGATTACCTACCGAGCAATTTTAATACATATGTATCTCA TATGACATGGAGTTTTTGGCGGGAATTCGTTTGGTTTATTTTAGAGGCAG CCTAAAAATGCCTTGCGCCGAGAGCAAGTAAATCTTGCTTGTAAATTCGT TCCCATTCCTCTAAAAAAGGCGACCGCGCTGATGCAAAGGGTTGATTGAT ACATTCGAACCTACACCATTCGGAGCTCAAGATTAATTGAAAGTCAACTG TTGTTATACACGCTTTTTTTATTATAAGAACAAACTATATAAGAACATAA GGCTTCGATGGCCAAAATGTGAAGAACAAGTTAAGAACATTTGAAGGCTT TGCAGGGCTTTGCGGACTCGAAAACACCCTATTTCTTAGGAAAGTGGGTA AGAATGGTCACAAAATGGTGAAAGTAAGCACATGTTAAGAACATTTTTAG GCTTAAAACTGAAAAAGTTAAGAACATCCAAAGGTTTCAAAATTTTTGGA TGTTCTTATAAAAAAAGGTATCTTTTATTATCCATAGATCAACAAACTAC AACTAATGATCAAAGACTTGAAAAAAGATTACAAGAAAGAAAAACAAGGA TTTATAGATGACTACACCAAACAGATCGAAACACTTCAGACAAGTCTAAC GGACAAAACAAATGAAGTGAAACTGATGCAATCGGAGTTGAAATTGGTGA AAGAATTTCGTCGGAAAAGAGCTCTCATGCAGAAAGAGATTGATGATGTA TGAAATGTTTTTCTTCTTCGTTTTTTTATGGATTTTCTTTTAATAGACCT TTTTGTAAATTACGTCACGAACATCACTTGCCTCGTATTCAAACAATTAC CATGGTGATTGTGTCCCTTGAGACATTAAATGAATATTTTTTGATGAATA GGAAGTAGTGGACTCCGCTGGGAGTTAATCACCATGGCAATAATTTCAAA ACGAGGTAAGTGATGTTCGTGACGTAATTTATGAAAAGGTCTATTCGTTT GGATATTATCATAATAATATAGAAAGGAGGCGCGTCTCTTATGCCGACAA AGCAGAATCAACAAAATAGTTTCTCGTTACTCAAAATGTGTGCTCGTGCG GTGGGAGGGGGGAATCTTTTTTTCTTTTTTTGTTTAAAACTGCTGAAAAC GCAAATGGTAGGAGATCCGTTAAAAATATCCTTTAATATGCTTAAAATTT CAAATTTTGATACAAATATTATGGAATTATGGTTAGCCACAGTCAAACTT TTGATGTAAAGTCTCATTTCTTCTATTAGTAAGATCAGTGCATGGCCGCA ATTCATAACATCTCGAATTAGAAATTCGTTGCAATTTCTAATTTGACGAC CTTTACGGTATTTCTTTTTGCAGTTTGCGATTATTTCCAATCTCTTTTGA TACTCGTTTTCTTTTTAGATCAAAGACAATCTTTTCATGAACGAAAAACA ACATGAACATGCTCTGGAAAAAATCGAAAGAAAGTTCTTCGATGAAAAGG TATGATTTTCACATTTTCATTTCCAATCTTGTTTAAGTTAAGAATGATAG GGAAATTTCGTCGTTTGATCTAAAAATTATGCTTATTTATATCGATTATT TCCTGCTTAACGCGAGTTTTTGATGTGATAACATCATTGTATTATAAACT TTTTAGATTCGTATGCAGCAAGAAGCCAATCGAAAGATTTCCGAACTTGC TGAAAGAGCTCATAACGAAGCTATCAGGTATATTAATGAAAAGGCATCTG TTTCACGATTACCTCAAGGGGATTAATTTCCGCAAGGATTATATTTTGCG AGTTTCGCGAGTTTTTTCAAAAACTTGCGAAATTTAATCCTCGCGAAAAT TCATCNAAATTTTTGGATGTTCTTATAAAAAAAGGTATCTTTTATTATCC ATAGATCAACAAACTACAACTAATGATCAAAGACTTGAAAAAAGATTACA AGAAAGAAAAACAAGGATTTATAGATGACTACACCAAACAGATCGAAACA CTTCAGACAAGTCTAACGGACAAAACAAATGAAGTGAAACTGATGCAATC GGAGTTGAAATTGGTGAAAGAATTTCGTCGGAAAAGAGCTCTCATGCAGA AAGAGATTGATGATGTATGAAATGTTTTTCTTCTTCGTTTTTTTATGGAT TTTCTTTTAATAGACCTTTTTGTAAATTACGTCACGAACATCACTTGCCT CGTATTCAAACAATTACCATGGTGATTGTGTCCCTTGAGACATTAAATGA ATATTTTTTGATGAATAGGAAGTAGTGGACTCCGCTGGGAGTTAATCACC ATGGCAATAATTTCAAAACGAGGTAAGTGATGTTCGTGACGTAATTTATG AAAAGGTCTATTCGTTTGGATATTATCATAATAATATAGAAAGGAGGCGC GTCTCTTATGCCGACAAAGCAGAATCAACAAAATAGTTTCTCGTTACTCA AAATGTGTGCTCGTGCGGTGGGAGGGGGGAATCTTTTTTTCTTTTTTTGT TTAAAACTGCTGAAAACGCAAATGGTAGGAGATCCGTTAAAAATATCCTT TAATATGCTTAAAATTTCAAATTTTGATACAAATATTATGGAATTATGGT TAGCCACAGTCAAACTTTTGATGTAAAGTCTCATTTCTTCTATTAGTAAG ATCAGTGCATGGCCGCAATTCATAACATCTCGAATTAGAAATTCGTTGCA ATTTCTAATTTGACGACCTTTACGGTATTTCTTTTTGCAGTTTGCCATTA TTTCCAATCTCTTTTGATACTCGTTTTCTTTTTAGATCAAAGACAATCTT TTCATGAACGAAAAACAACATGAAAATGCTCTGGAAAAAATCGAAAGAAA GTTCTTCGATGAAAAGGTATAAATTTTCACATTTTTCCCAATCTTGTTAA GTTAGAATGATAGGGAAATTTCGTCGTTTGATCTAAAAATTATATCGATT ATTTCCCGCCTAACGCGAGTTTAATTGTGATAACATCATTATGTATTATA AACTTTTTAGATTCGTATGCAGCAAGAAGCCAATCGAAAGATTTCCGAAC TTGCTGAAAGAGCTCATAACGAAGCTATCAGGTATATTAATGAAAAGGCA TCTGTTTCACGATTACCTCAAGGGGATTAATTTCCGCAAGGATTATATTT TGCGAGTTTCGCGAGTTTTTTCAAAAACTTGCGAAATTTAATCCTCGCGA AAATTCATCTTGCACAGTTTGTCCATGTTTGTCTCTTGAAATCTCAAAAA CCCTTAGGAAATTGAAAGAAAATAGTCAAAGAAGGTAATTATCTCGCGAA AATAAGTCCCGCCAAGATTAAATATTTTCGCGAAAATGTCTTCCCGTGAA AATTAATCCCCTAAGGTATTCAGTCCACTTGCCAAAACGCATAGCAGAGT TGTTCTCTTTGACTTCTGTTTGATTTCTGTTGATTATGTATGTTTACTAA CTGATTTTTTATCTCTTTATTCTTTTTTGACGTTTTGAGAATTCTAGAGA TGGTGAAGAAGATTATCTTTTTCAATGGTTATTATCAGATTTACAAAATA TTTTGGATTTGGGAAAAATGAAGATAGGGCAAATATACGCGAAGAGCATG GCTCTGTGACTTCCAATCTCGCACAAGGTTTCTTATGGCAAAGATATAAC GGCCTTATCCGTTACATTGCAATACGAAGCGCAAAATTCCTCATAATTAT GTGATTTTTAAATCGTTGGTTGAAATAACACATGCAAGACCATTTTCCAT TCCATTATACAGTTGGGTGTCTTTAGCTCGAACCTTCATAGCTCGAATGT CTTCTTGACACGAACAAGTTTTATGGTTTCAGTTAACAATGTCTTATAAA CCTTACTCCAAAACTCGAACAATATTGTGTTCCCCGTGCGTGTTCAAGTT ATAGAGACTCCACTACTGTACATGTTTTTTTATAAGCATATTTTTTTTGA AAAACAAGTTATGCTTATGCTACATTTTGAAATCAAGCTCAAATTATGCT TGTGATATGCTTATTTTTCCGAAAAAATTGGTTCTTTAAAAATGGAAAAG AAATGACCAAAGGCCAAAGCTCACTGATATGCTAATGATATGCTTATCTT TTCACCAGCCCAGGTCTTAGTATGCTTATAAACGTTATGCTTTTAAAAAA ACATATATTTCAGCATTCTACAGAATAGCGCTCCGCAACGCATACGTCAT AATTATTACTTTTCACTTCTTTTTGACATTTGTACGAAATGCAATCCCAC AATTCAATGCGGCTCAATTAAAGATACGTGCAAGTTGTTGTATACAGCTT TTGTGAAATGATGCAATTAACGTGAATAGAGATTTTTAACTCAAAGGTTG ACAGGATTGGAACTCGTACAAACACATCGAAAGTAATGATTAAGTCAAAA ATGAAATCTATTTTAGATTCAGTGCAGTGCGCTATTAACTTCTCCAATTT TAACTCGTTCTCTTTCCCATATTACGCAGCAATTTGGACGATACAACGAA ATCAGTTTATAAAGAGAACGTTCGATTAAACGAAGCATTGACTTATCATA TAAAAGCTGGTGAAGAACTATCACAGGTTTGTGTTGACTACNCCCCTGTT ACGCAGCAATTTGGACGATACAACGAAATCAGTTTATAAAGAGAACGTTC GATTAAACGAAGCATTGACTTATCATATCAAAGCTGGTGAAGAATTATCA CAGGTTTGTGTTGACTACATTATACTTAAAATCTATCACTTAGCAAAAAC CTTCAAGTTTAAAAATCTTGAAAGATACTCCCACAAAACTGATGCATTTA AGCTACCATCACAGCGTTACTGCAAATTATACTTAAAATCTATCACTTAG CAAAAACCTTCAAGTTTAAAAATCTTGAAAGATACACCCACAAAACTGAT GCATTTAAGCTACCATCACAGCGTTACTGCAAATTGTTCAAATATTTTTT TTTATTTGACATTATGTTAACCACCCTGGACTTTTCTTCCTCAACATATG GTAACCACCCTGGATTTTTACACTCAAGAAACCGGACCACCCTGGATTTT TTATCTTCCATATCACCCTGGACGTCACACCTCCCCCAACATAGGGGGTA CACACTATTTCTGGAATAGCCAAATGCGTGTATACACCAAAGAAGAGTTG AACCAGGGCTTTCTCAAAAATATTCACCCTCCCCTCGTTGAGGTCATGTC AAGGACTTGAAAAATGGTTCTTAATGCCTCTCTGCTGACTGTTCTGAAAT AAAAAAACCTATATCCAAGGGAAAAGAATGGCGTACTCTCTACATGTTTT TTTTATAAGCAAGTGTCTGCCCCTTGATCAGGCTCGTGTATGCATAAATT CTCAAAGCATCCAGGCATAGCTTTTGCTAATTATATGCTTATGAATCATG CTTATCATTCACCCCGAGCCAACTTTTTAGTAAATTTTCAGAAACTTTGT AAACATTTGTTCAGATTTTGGGAGCAGTGGAATGTAGCTAGCCGTGGAAT GTCTTTATTTTTACTTGACCTCTACCAAACCTTTTTAAACATATAAGAAA TGACAACTTGAAAAATATTCCAGGCTGACATATATGCTTATGTTCTGCTT ACAAATTCTGCAAATACGAGTCTTAATATGCTTATAATCGTTATGCTTAT GAAAAAATGTACCTTCGGGTAGACATCTATCTACCTATATGAAAAAGGAG TCTTTGGTCGCCCCCCCCTTACGTGTTGCAAACCTACTTCAACTATAGAG ATTTCTTCTTTTCAGCACAAAGAAAATTTGGAAGAGCAGAACAAGAAATT AAGCAGTGAAAAAGAAATGAACAGCCTCATCGTCGAAGAGAAAGTCATCG AAAGCAAGAAAATTAAAAAAGCTAACAGCTCGGTAAGAATGCTGTAGAAA TTCGAAATTTGTCATTCTCAGTGACCGTCCTTTTTGTTTTGTTTATTCGG CAATCCCCTAAAATCAATAACGCGTTTTGAATTAAATTTTTTTGATTTTT GAAGAAAATAATTAAAACTAAAACATAACAAAAAAGGACGCTTAGCTCTC GCTCTTATTTAACCTGTTATTTGCCATATCTTAGTTAAAAGACCATTTCA AGACCGATCCAATTTTCAAAATCTGGAAACTTATATTACCGGGAATATGA TTTATTTTTGACGTATCTTTAATGTCATTTACTTTACAATTTTTCCTTTA ATTTCATTTATAGTAAAACAAATTCAAAAAAAAATTACGATTTTGAATAA TCTTGACATATTAACAGGCCTTTAAATGGCCAAAAATGCCAAAGAAACTT TTCTAATTTTTGCCTGTAGTGCGAATCAGGACCCCCAGAAGGGTTCGGCC AATTTTGGACTTCGTCTATTTATTATTTGTATCCCATTTATAGCTTCAAC AAAAAGTTGATGACCTTGAGAAAGCATTGACAGAAGTGATGTCGGAGAAT AATCAAAAGAAAACATCCTTAGTTCAGAAACATAATCAAGAACAAGAGGG AAATAAGTAAGTTGGAATTCTACATGGTACTATGTTACAGGGGTCATGTT ACAGACTGTGGTGCAGTGGTAGAGCATCCGGCTACGGTTCGCAAGGTTGT GGGTTCAATCCCTAGCTTGGTCATACCAAAGATTCCAAAATGGTACTTGA TGCCTCTCTGCTTGATGCTCAGTAATTAAGATAAGGATCAAGGATGAGTG GAGCGAGCCAGGGAAAAAGAGTGGCGCCCTCCCCTACCTTCGGGTAAATA GCTATCGAAAGAGGAGCTATCGGGTCGCCTCTGACAGCAGTCACAGACTT ACTTAAATTCTCGCATCGCTGAGATTTTTTAGATACACAATGCTTCTCGT GCTTGTTCTGATTTTTTGCACAATTAAGTAAAATAGTAATTCCCAAAATA TGATAGAGGCCAATTTTCGATTAAAAATCTTTCCGGCCGCCAGAACCTGA AAAAGCGGTTTTTCTGGATTTTCTCGAGATTTTATCTTTTTTTTTTCCTG ACTTGTTTATTTTGAATTTAATTTTTTTTGTTGAACAGACGGGTAGGTCC ATTAAAGTATCACTTTTTTCATTAATTTTTATTAATTAACTTTTACAGAA TGGAAATAGCACGGCTACAACGTATCATTGAACTAAAGAATAAGGAGATG AGCCGTGTCAAGAAACTTGCCAAAAACATCCTCGATCAGGTAAGACAATT AACTTATCATTTTCTTATTTGTATGGCTCTTAAAATCAGAGCTTGGCATG GGTTTACGGCAACACTGTTTTACCGACGAGTTCTTCGACAGGTTTTGAAG GATCCTGTAAAGCCTCAACTCGTCGTAGTCATAGATTTATAAAGCCCGAA GGGCTAGATGTCGTGCTTTGGCTGAAATGTGTTCAATATGCTGATGACAC GACTATATATCGCCACACCAAACCAAACGAGCTTGAAAATTGTGTCACTG AAATGAACTCTGATATTAGAGTAATTGAGAAATGGTCGCTGGATTCGAAC TTGATATTTAACGCCAGAAAAACTAAATCGATGCTCTTTGCCACATCTCA AATGGCAAGGAGGCATGATTTTGAATTCGAAATCAAGTCAAATAACGAAA ATGTGATTGAGCGTGTTCCCCTATTCAAGCTGTTGGGAATCATCTTCACC GAAAACCTAACATGGAATGAACATGTCAAAAAAATCGTCACTAAAGCATA TGGTACGCTGAAGAGTCTATCACTCATCAAACGATATTTACCATACCGTG TACGACGCCAATTGGCAGAATCTCTTGTATTGAGTAAANNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNTGACTTTATTATATTTCTAGTTCTATGAAGTTT TTTTTCTTTTCTATTTGATGTTTAATTAGTTTCAATTAATTTAATTTAGA TAGTTGATAGCTCACTGGTCGTGTTTTGCAAGGTCCAGTACACTTTTACA CAGCCTTCGGTTTGCAATCTATGCTAGTTTTGCTCATAATATCTTACGCT CTGTCGTGATTCTATCTCACCGAGTTCTTAGATCTATTTTGTCGCTTACT TTATCTCTAGCCATCAATAGTACTTGAGCCTTAGTCTAGTCTAGCTTATA ACATTATGTTAGTATTTTTTTTTTAAATATATTCGTTAATTTTTTATAAT AGCACACATTGCGATGGCCTCAGCTAGCATACTCAGATACTCGGATTTGT TTAGGTTTTAGTCTAGCTCTATCACTATTCACATTTTACCCCTCAATCCT AATCTTTTATTCATCATACTAGCCCACCGCTTCGTCCCTATCTGTTTGTC TATACNTTACAGAATGGAAATAGCACGGCTACAACGTATCATTGAACTAA AGAATAAAGAGATGAGCCGTGTCAAGAAACTTGCCAAAAACATCCTCGAT CAGGTAAGACAATTAACTTATCATTTTCTTCTTTGTATGGCTCTTAAACT CAGAGCTTGGCATGGGTTTACGACAACACTGTTTTACCGACGAGTTCTTC GACAGGTTTTGAAGGATCCTGTAAAGCCTCAACTCGTCGTAGTCATAGAT TTATAAAGCCCGAAGGGCTAGATGTCGTGCTTTGGCTGAAATGTGTGCCG AGGTTAGGTAGGATTCCTAACTGAAGTCTGTCTCAAAATAATTTGCAGCT GGAGACAAAAATGGCTGTAACTTTAGATAGAATACGAATCAAGTTGTGAG TGGAATATTATCAAGTAAAAAATTTGAGAAAAAAAAGGAAAATGAAAATG AAAAATGAAGAAGAAAAAAAATCAACTTCTTGTAGAAATGTGGTATAANN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNCAATCAAAAGATATCAAACAAAGTTTATTGCTGGTTGATCGACA AAAGGCTGTTTTTTGTCGTTTTTTACTACTTTATAGAGTCAACCAGCAAT AAACTTTATTTGATATCTTTTGATTGAATGAATATTTTTTTGAACCATTT ACTTGATAATATTCCACTCACGAATATCTTTTTAACGAGCACAAAATCGC TACTTGATTCGAATTCTATGAAAAGTTACAGCCATTTTTGTCTCCAGCTG CAAATTATTTTGAGACAGACTGTAGGTCACGTGACATTACAATAGAATTT CAGCGCTTGACCAATCTTTGCAGGTTTTCGAAAACAATAGCAGCAATATT CTTTGCCATATTCACTTTTTTTTTGCTTAAAGCACGACATCTAGCCCTTT GGGCTTTACTGAAATCTGTAGTCGTTGTCTTGCTTTTCAATCAATCTTTT CATTGAGTATTATTAAAAGTCCACTCCTTCTTCACTATTGCGTTGATGAT GTATTCGCATACAATAATAATCTCAATAATGCACGATAAAAAGCTGACAT TTTTCAATATATTAAGTTCTCTCTCTTTTTCTCTATATTAAGTTCAAAAG TGACAATGACCGGGGGGTAAATTTCCAAGAAATGTTATATCCTCCACCTC CACCCCCCCCCCATATTCAAATTTTTTTCTGTATAAGCCCATTGCTGCTC ATTACCGTGAAGACACCTAAAACGTCGCTTTTCTTGTGATACGTTTTTTT AAGAAACTAAGAAACCAAGCAGCCTCTCAATGTTTCTTAAGAAATCGGCT TTTTGAGCCTTAAATGTTTCTTACATGTTTCTAAACTTTTTGACATAATC AGCCTCGTGTTTCTTAAATTTTGCTTCTTTCAAAAAAAAAACCGAATTAA AAAACTTTATTTTCTCATTCTCAGCCTCAGCATGTTTCTTAGATGTTTCT TAGTTTTAAGGCATTCTGAGCCTCGTGTTTCTTAAAATTGTGTTTCTTTA AAAAAAAAGTGTAGCTGTCGGTAACTTTTAAAATCTATTCATGGTAAGTT TGCACTCTTTTTTCTTTTACCTATAACTTTTGAAGGATTTCTTCAATCTT TATAAATTTGGTATGTATCTTTGGAGAGATATTTCTCAGTGAAACAATTC GAAATAAAAAATTCTTCAAAAAAATTCTAAAAATGAAAGATGAAAATAAG GAAGAAAAAAATGAAGATCTTATGTAAAAGTGCTATAACTTTCATTTTCA CTGGAGAGATTCTTTGATCTTAGGAGGTCATCACTGTGAAGAAATTTCAC TAAAATATTTATTCAATATAAAGTTATGATACAAAGTTAACAAGTGATTG ACCCCAAAAAACAAGATCTTCATTTTTTTCTTCTTCATTTTTATCTTCAT TTTTATAATTTTTTTAAAGATATTTTTATTTCAAATTGTTCCACTCTCCG CACTCTCCCACACAATCTTTCCAACGATACCAAATTTAAAAAGATTGAAG AATTCCTTCAAAAGTTATAAGTAAAAGAAAAAAGAGTGCACACTTATCGT GAACAGACTTTTAGTTTTGATTATTTCATTCCTCTACATACGTGTAATCA AAAGGTCTTCAAAATCATCTTTTACAGCGTTCAGATGTCGAAAAATTCTT TATCGAATCATTGGAAATGGTCAAAACTGAAATCATCAGAAATCGGTAAC CGTATTTTTATTTTTCTGAATCAACTTTTTTTATAAGATTATTCAAAGAT AACTTAAAATAATTGTGGCTAGAATATTGATGGTCACACAATTATGATCA TTGAATGATAAATAGAACGGTTATTTTCAATTGTAGACCCAAATTCAATT CAGTTTTCGTAATTTAACACTGTTATTCAAGTGATAGACAGATTTTATTA GCGTGTAATCAAATTTCAATATTGTATTTAATATATGTACGCTTAATTAT CGTATCAGCTGATATAACAACGAAAGTGTTTTTCGATGTCGAAAGCTCCT TTTACATAAGTCACGTTTTGTATCCCAGTTTGCAGTGCTGGAAAATTTAC CACTAGAAAGTTATCAAACGTGGCTTTTTACCGACAGGTTTCAAAAACAC CAAAATTGTGTACGAAAGTAACCTTTGTTATACCTCTAACCTTTACACCA CCCAGGAACTAGAAATAATCATAAAAGTTATGAGGGAAACACCAAGGCTA CGATTAGCTCACAATAAAACCTTCCTGGGTATACGGTTAAACGCTTTTTC GATCTACGAAGGCAACGAAAATATCTTTTCTTTTATCATGACAGTTCTCT TGCAATTGCAGGAGGATAAAAACGCCATCAGTCGTGTCACGCACGGCCAG GCAAAATGCCGAATGCATATCATCAATTAATGATATTCATGACGTAATAT TATGTACGGAAAGACCCCGGTTTTTGCCAGTAGTGGCAAATTTTATACAA CTTTTGTCTAGTTTAAATTTGCCACTACTGGCTGAAACCGAGGTATTTCC GTAGAAAACATTACGTCATGAATATCATTAATTGAGATTAAATCTCTAAC GTCGCATCTTAAAAATAAATAAATTTTGCTGTCATTCCTTCCCTGGAAAC TAGACCCAATTCATTTGTAGTGTTTAGGATTAAGACCATGTTCAGACGCT ACGGTTCCGTTCCGGAACAAGTGCAAACGTCAAAATTCGGAGCGTCAAAA AAGAGGACGTTACAAAGCAAAATATATCGAAACAGTTTCGCTCCACTTTT TTTATCGTAACGGAACTGCTCTGTTTTCTTGCTCCGAAACGTTCCGAAAC CAATATGAACACATTCGATCCGTAACGCAAATCATACCGGAGCGAAACGG AACAGTAACGTGTGAACATTGTGGAATAGATGTATTACTTCTTCGGAAAA GAAATCTTTAATGTTTTTTTTTCAGTGCGCAATATCGACGAGACGCTGAA GTAGCATACAATAAAAGAATGACCGAAGCACATTCTGGTCACTCTGATTA TCCCAAAGTCCGCACATTTCGTCATCTAAAGAACAGCACTAATTCCGTGT ACGCAGATCTACGCGCGGCCGAACGGTGGGATGGGTTTGACGCGTCGGTT GATCTTTCAGAATTAACATGGGAACAGAGAGAACAGGTTCTTCGCTTGTT GTTCGCTAAGATGAATGGCCAGAAAACGTGAGTTATAATTTGAATTCCGT AATTATTTTTCATGCTTTCGAACTTTTTAGGTGTGAAATTTTAACTTATG GGAATCTAGAAATCGGAGCTTTCTACCACGAAAATCGAAAAATTGAAAAA TTTCAAAAATCAGATTAAAAAAGATTTGCGTGATACAATGTCAAAATGTC TCACTCTCAAGCTCAAGGCTTTATTTAAAGGCTTATTTTTTTAAGGAAAG TATTACTAAATATCTGCTATAATATTTCCTATAGATCAAAAGTCAGCAAA AGTATACTTCCACCCATCAACAGTAAGATGGACGAAACTAAAGCTCATCA ACCGAAACCACCTTCCGTTCAAAAAGCTTTTCTCACGGAAGCCGATGATC CAAAAGAGGGTGTCAGTAGTGATGCAAGTAGGGTATTTTCAGCCACTGAG ATCCTTGCTTTTACATGACTTTTATGACTTAGCAATTTTTAGGGTACTGA TTATTTGTAATTAATTTTTTTTGAAAAGTTGTATATAATAGTTTGTGTAT AGATTTAATCAGAATAGAATGTGATTTTATTTTATTACCTTGTAAAATAA TTAATTTTTTAATGATGGTTTAATTTATTTTTTGGTAAAGACTGATTCAA GGAAAAGTAATT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000328XLOC_000328Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000550-exon-sc0000002-1575043694:486238..486353TCONS_00000550-exon-sc0000002-1575043694:486238..486353Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1575043694:485778..485897TCONS_00000550-exon-sc0000002-1575043694:485778..485897Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1575043694:485293..485416TCONS_00000550-exon-sc0000002-1575043694:485293..485416Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1575043694:481940..482149TCONS_00000550-exon-sc0000002-1575043694:481940..482149Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1575043694:481188..481268TCONS_00000550-exon-sc0000002-1575043694:481188..481268Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1575043694:480973..481043TCONS_00000550-exon-sc0000002-1575043694:480973..481043Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1575043694:479351..479447TCONS_00000550-exon-sc0000002-1575043694:479351..479447Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1575043694:478172..478288TCONS_00000550-exon-sc0000002-1575043694:478172..478288Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1575043694:477548..477660TCONS_00000550-exon-sc0000002-1575043694:477548..477660Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1575043694:476865..476955TCONS_00000550-exon-sc0000002-1575043694:476865..476955Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1575043694:472659..472726TCONS_00000550-exon-sc0000002-1575043694:472659..472726Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1575043694:471177..471428TCONS_00000550-exon-sc0000002-1575043694:471177..471428Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1575043694:470542..470919TCONS_00000550-exon-sc0000002-1575043694:470542..470919Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1510915933:486238..486353TCONS_00000550-exon-sc0000002-1510915933:486238..486353Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1510915933:485778..485897TCONS_00000550-exon-sc0000002-1510915933:485778..485897Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1510915933:485293..485416TCONS_00000550-exon-sc0000002-1510915933:485293..485416Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1510915933:481940..482149TCONS_00000550-exon-sc0000002-1510915933:481940..482149Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1510915933:481188..481268TCONS_00000550-exon-sc0000002-1510915933:481188..481268Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1510915933:480973..481043TCONS_00000550-exon-sc0000002-1510915933:480973..481043Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1510915933:479351..479447TCONS_00000550-exon-sc0000002-1510915933:479351..479447Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1510915933:478172..478288TCONS_00000550-exon-sc0000002-1510915933:478172..478288Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1510915933:477548..477660TCONS_00000550-exon-sc0000002-1510915933:477548..477660Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1510915933:476865..476955TCONS_00000550-exon-sc0000002-1510915933:476865..476955Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1510915933:472659..472726TCONS_00000550-exon-sc0000002-1510915933:472659..472726Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1510915933:471177..471428TCONS_00000550-exon-sc0000002-1510915933:471177..471428Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1510915933:470542..470919TCONS_00000550-exon-sc0000002-1510915933:470542..470919Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1491911889:486238..486353TCONS_00000550-exon-sc0000002-1491911889:486238..486353Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1491911889:485778..485897TCONS_00000550-exon-sc0000002-1491911889:485778..485897Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1491911889:485293..485416TCONS_00000550-exon-sc0000002-1491911889:485293..485416Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1491911889:481940..482149TCONS_00000550-exon-sc0000002-1491911889:481940..482149Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1491911889:481188..481268TCONS_00000550-exon-sc0000002-1491911889:481188..481268Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1491911889:480973..481043TCONS_00000550-exon-sc0000002-1491911889:480973..481043Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1491911889:479351..479447TCONS_00000550-exon-sc0000002-1491911889:479351..479447Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1491911889:478172..478288TCONS_00000550-exon-sc0000002-1491911889:478172..478288Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1491911889:477548..477660TCONS_00000550-exon-sc0000002-1491911889:477548..477660Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1491911889:476865..476955TCONS_00000550-exon-sc0000002-1491911889:476865..476955Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1491911889:472659..472726TCONS_00000550-exon-sc0000002-1491911889:472659..472726Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1491911889:471177..471428TCONS_00000550-exon-sc0000002-1491911889:471177..471428Clytia hemisphaericaexon
TCONS_00000550-exon-sc0000002-1491911889:470542..470919TCONS_00000550-exon-sc0000002-1491911889:470542..470919Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:470542..486353 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 4.07059e-08 1.51012e-09 0 0.650709 0 0 0 0 0 0 0 0 0 0 1.15222e-07 0 0 0 2.95147e-07 3.13098e-06 3.44855e-07 8.22486e-10 0 0 9.22855e-10 2.9653e-08 0.000157589 1.41718e-08
Blast
BLAST of TCONS_00000550 vs. Swiss-Prot (Human)
Match: BBOF1 (Basal body-orientation factor 1 OS=Homo sapiens GN=BBOF1 PE=2 SV=3)

HSP 1 Score: 337.806 bits (865), Expect = 1.654e-107
Identity = 192/477 (40.25%), Postives = 319/477 (66.88%), Query Frame = 1
Query:  148 NDDVLKQAIANACLWESRLGTVEVAKNEYRDTTRTLLHENEKLQTQVSQTEKETVDVLSFLRDEDIKKNNTINKLQLMIXXXXXXXXXXXQGFIDDYTKQIETLQTSLTDKTNEVKLMQSELKLVKEFRRKRALMQKEIDDIKDNLFMNEKQHENALEKIERKFFDEKIRMQQEANRKISELAERAHNEAISNLDDTTKSVYKENVRLNEALTYHIKAGEELSQHKENLEEQNKKLSSEKEMNSLXXXXXXXXXXXXXXANSSLQQKVDDLEKALTEVMSENNQKKTSLVQKHNQEQEGNKMEIARLQRIIELKNKEMSRVKKLAKNILDQRSDVEKFFIESLEMVKTEIIRNRAQYRRDAEVAYNKRMTEAHSGHSDYPKVRTFRHLKNSTNSVYADLRAAERWDGFDASVDLSELTWEQREQVLRLLFAKMNGQKTSKVSKSILPPIN----SKMDETKAHQPKPPSVQKAFLTE 1566
            ++ V+ +A ANA LWE+RL   E+++ +YRDT+R L   NE L+ +  + EK+ + VLS+L+ +D +K+N I KL+  + + K+  ++EK      YT+QI  L+     K  E+ ++ +ELK V++F++++  +++E+DD+K+NL   E+ H+  L ++E +FF+EK R++QEA +KI  LAERAH+EAI  L+D  ++V+KEN  L +AL YH+K  + L ++ + L+E +  L  +KE+N L+V+EK+++  + +    +LQ+KV +LE AL+ +  E   +   L Q    E +  ++EI +LQ ++++K++EM+RVKKLAKNILD+R++VE+FF+++L  VK +I+ +R  Y++ A+ A+N +M  A +G ++YPK+RTF   ++STNSV  DL  AE+W   + +VD+ +LTWEQ+E+VLRLLFAKMNG  + K ++S  PP+     S   ETK    +     K F+T+
Sbjct:   25 DESVVDRAKANASLWEARLEVTELSRIKYRDTSRILAKSNEDLKKKQCKMEKDIMSVLSYLKKQDQEKDNMIEKLKQQLNETKEKAQEEKDKLEQKYTRQINELEGQFHQKAKEIGMIHTELKAVRQFQKRKIQVERELDDLKENLRNTERIHQETLRRLESRFFEEKHRLEQEAEKKIIMLAERAHHEAIVQLNDAGRNVFKENDYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKKLAKNILDERTEVERFFLDALHQVKQQILISRKHYKQIAQAAFNLKMRAACTGRTEYPKIRTFDGREHSTNSVNQDLLEAEKWTHIEGNVDIGDLTWEQKEKVLRLLFAKMNGCPSRKYNQSSRPPVPDYVVSDSGETKEFGDESKLQDKIFITQ 501          
The following BLAST results are available for this feature:
BLAST of TCONS_00000550 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
BBOF11.654e-10740.25Basal body-orientation factor 1 OS=Homo sapiens GN... [more]
back to top