Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000548 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000548
Unique NameTCONS_00000548
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1837

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000548 ID=TCONS_00000548|Name=TCONS_00000548|organism=Clytia hemisphaerica|type=transcript|length=1837bp
ctcagttcaaaattattaaaaattatgtgaaaataatataaaagaaaata
atgtaaacaaagatgccgaaaaaggccaaaaaagctaaaggaaaatctaa
aaaagacaaaaaaggAAGGAAGTCATCAAAAGGAGTCAAAGTCAATAATG
ACGACGTTTTGAAACAAGCTATAGCCAATGCTTGCTTATGGGAAAGTCGT
CTTGGAACTGTCGAAGTTGCCAAAAATGAGTATAGGGACACGACACGAAC
GTTGCTTCATGAAAATGAGAAACTTCAAACACAAGTATCACAGACAGAGA
AGGAGACTGTTGACGTCCTTAGTTTCCTGAGGGATGAAGATATCAAGAAA
AATAATACGATCAACAAACTACAACTAATGATCAAAGACTTGAAAAAAGa
ttacaagaaagaaaaacaaggaTTTATAGATGACTACACCAAACAGATCG
AAACACTTCAGACAAGTCTAACGGACAAAACAAATGAAGTGAAACTGATG
CAATCGGAGTTGAAATTGGTGAAAGAATTTCGTCGGAAAAGAGCTCTCAT
GCAGAAAGAGATTGATGATATCAAAGACAATCTTTTCATGAACGAAAAAC
AACATgaacatgctctggaaaaaatCGAAAGAAAGTTCTTCGATGAAAAG
ATTCGTATGCAGCAAGAAGCCAATCGAAAGATTTCCGAACTTGCTGAAAG
AGCTCATAACGAAGCTATCAGCAATTTGGACGATACAACGAAATCAGTTT
ATAAAGAGAACGTTCGATTAAACGAAGCATTGACTTATCATATCAAAGCT
GGTGAAGAATTATCACAGcacaaagaaaatttggaaGAGCAGAACAAGAA
ATTAAGCAGTGAAAAAGAAATGAACAGCCTCATCGTCGAAGAGAAAGTCA
TCGAAagcaagaaaattaaaaaagctaACAGCTCGCTTCAACAAAAAGTT
GATGACCTTGAGAAAGCATTGACAGAAGTGATGTCGGAgaataatcaaaa
gaaaacatcCTTAGTTCAGAAACATAATCAAGAACAAGAGGGAAATAAAA
TGGAAATAGCACGGCTACAACGTATCATTGAACTAAAGAATAAGGAGATG
AGCCGTGTCAAGAAACTTGCCAAAAACATCCTCGATCAGCGTTCAGATGT
CGAAAAATTCTTTATCGAATCATTGGAAATGGTCAAAACTGAAATCATCA
GAAATCGtgcgCAATATCGACGAGACGCTGAAGTAGCATACAATAAAAGA
ATGACCGAAGCACATTCTGGTCACTCTGATTATCCCAAAGTCCGCACATT
TCGTCATCTAAAGAACAGCACTAATTCCGTGTACGCAGATCTACGCGCGG
CCGAACGGTGGGATGGGTTTGACGCGTCGGTTGATCTTTCAGAATTAACA
TGGGAACAGAGAGAACAGGTTCTTCGCTTGTTGTTCGCTAAGATGAATGG
CCAGAAAACATCAAAAGTCAGCAAAAGTATACTTCCACCCATCAACAGTA
AGATGGACGAAACTAAAGCTCATCAACCGAAACCACCTTCCGTTCAAAAA
GCTTTTCTCACGGAAGCCGATGATCCAAAAGAGGGTGTCAGTAGTGATGC
AAGTAGGGTATTTTCAGCCACTGAGATCCTTGCTTTTACATGACTTTTAT
GACTTAGCAATTTTTAGGGTACTGATTatttgtaattaattttttttgaa
aagttgtatATAATAGTTTGTGTATAGATTTAATCAGAATAGAAtgtgat
tttattttattaccttgtaaaataattaattttttaatgatggtttaatt
tattttttggtaaagaCTGATTCAAGGAAAAGTAATT
Run BLAST on NCBI

transcript from alignment at sc0000002:470542..486352-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000548 ID=TCONS_00000548|Name=TCONS_00000548|organism=Clytia hemisphaerica|type=transcript|length=15811bp|location=Sequence derived from alignment at sc0000002:470542..486352- (Clytia hemisphaerica)
CTCAGTTCAAAATTATTAAAAATTATGTGAAAATAATATAAAAGAAAATA ATGTAAACAAAGATGCCGAAAAAGGCCAAAAAAGCTAAAGGAAAATCTAA AAAAGACAAAAAAGGGTAAGAACTTTCTTTCATTTTTACTTCAAAAAGAC TTATTTTTACTGAAAAAAAGCCTCTTCGACAAGGCTATAAGCAGAGGAAA CAAAAAATGCTATAACTTCTTATAGAAATAGAACCAAATGTTTTTGTACT TGTTGAAAAGATATTCAGGAGTGGAACATTATTATAAAGAAAAAACTTTT CTTTAAAAAATTTTTTTTCGCAAAAAGACTTTTTCACAGTGATAACACTT TAAGATTGAAGATATTTTTATTTAAAAATGGTGACCATAGCACAATTAAT TCTACAAGGGCTGGATTTTTCTCTTCTTTACTTTTCTTTATTTTTTTAAT CTTAGAAGGAAGTCATCAAAAGGAGTCAAAGTCAATAATGACGACGTTTT GAAACAAGCTATAGCCAATGCTTGCTTATGGGAAAGTCGTCTTGGAACTG TCGAAGTTGCCAAAAATGAGTATAGGTAATGATTATTTTTCTAACAGATC ATTCATTCTACCAGCACTTTGCTTTGCACTAAAGGTACAGCTCTCTTTTA GTAATACTCATCCAATATCGATATTTACTTGGATAGTTCAGTAGTCTGCT AATTTTAGACAGTCTTTTGATTATTTTCACCGGTCCAGGGCCAGTCGGCT ATCTATGAACTGAACAGAACATTGAAAGGAGCGGGGATTCGACTTTGGAA TTTGTTTAATATTTTTATTCTTTATTTAAAGTTGGGGACGCTAATAGAAA TACACAAGTATAATAGGAATTCTGATCAAATCCAACCAATTTCTAAGATA AAAAGAATTGTTAAACCTCTCAACCAATCTTAATAGGGACACGACACGAA CGTTGCTTCATGAAAATGAGAAACTTCAAACACAAGTATCACAGACAGAG AAGGAGACTGTTGACGTCCTTAGTTTCCTGAGGGATGAAGATATCAAGAA AAATAATACGGTATTCATCAGTTTAATCATAACCATCATGGACCTAGAGT TTTTTCATGGCACGATGAGTGTCCTCTCATTTGGGAGGGGCGGTTACAAA GTTAGGGTACTTGACTAGTGCCATAAATGTGTACTAACCACTGACCTTTA TATATCCCTGGAACAAGCTATATCCACCATCTTTGATCAGAGTTTTTTTG GAATTGGTACCCGAGAAGAATCCATTGCAATGTTAAAAATTAACATATAT AAAGGCCCTACATCATCAAAAGTATTCGAGATAAAGTAGATCTAGCGCTC TCGATGCATTTTCACCATTTCGCCATTAGGGTACCAATTTCAAAAAATCT CCGATCAAAGATTTTTGGTTGGCCGGAATTGAGTAACTTGGTCAAGGGTA TATAAAGGTGAGTGGTACTAACATGGTTTTGGGAATGGAGTTTTGACCAT CATCCGTTTGTACCTTAATATAAAAAGTTGAAAATATGCCTTCAATGTAG GTAGACCACCCCTAACTAACTGGAATTACCTGTTAAAATCCTTATTTTGA CGGGAAAGCAAGAGTAGAATTATACAGCCTAGTACCCAAAAATGTCCTAA GTTTTTACTTCCCTTAAAAATAAAAAATAAACACTTTTTCTTAGGCACTT TTCGATACTGAGGTATTATAATCGACTTTTTTTCTCCAAATTTGCACAAG GTAAAGTTGAAAATCAGCTTTTAAATGAATTTCCAGCTTTGACCACTCCA CTTAGTACATGGTACTAAGTTGTTTTTGACTTGCCAATTTTGACCATCAA CCCCGGTAGTGGTCCCTACAATCTAGTACTGAGCCCCTGTTCAATAGATT TGATTTAGACCTCGACTTGGGGTTCCATCGATATCAAGGACAATCCTCTC CAGGTCGACGAATAAGAAATCCATTGTACTCTATAACTTTTTTGAATTCT TTACAGTATTCTATACATTGTCGCTTTCCTATTACAGTATCTGTAATATG CGAGAAATCGGTCTTGTTTTTTTCATTGCCTTTTCCTTGGTTCCATACGT AAATATAACCGACATCTCTTCAGAAGTATGCAGTATGTTTTTTAATAGGG ATAATAATATATTTTCGTAATACTTTTCAAAAGGGTGGAAAATTTCTTGC TCTACTGAAGAAATTTGAAATTCGATTGTCTTATTCGATCATTATTTTTT TTGTTGGTCGTTCTGTTCAATTTAGTTCTTATTGATCCGATCGTCTATTC CGTTCGACTGAGATTACCTACCGAGCAATTTTAATACATATGTATCTCAT ATGACATGGAGTTTTTGGCGGGAATTCGTTTGGTTTATTTTAGAGGCAGC CTAAAAATGCCTTGCGCCGAGAGCAAGTAAATCTTGCTTGTAAATTCGTT CCCATTCCTCTAAAAAAGGCGACCGCGCTGATGCAAAGGGTTGATTGATA CATTCGAACCTACACCATTCGGAGCTCAAGATTAATTGAAAGTCAACTGT TGTTATACACGCTTTTTTTATTATAAGAACAAACTATATAAGAACATAAG GCTTCGATGGCCAAAATGTGAAGAACAAGTTAAGAACATTTGAAGGCTTT GCAGGGCTTTGCGGACTCGAAAACACCCTATTTCTTAGGAAAGTGGGTAA GAATGGTCACAAAATGGTGAAAGTAAGCACATGTTAAGAACATTTTTAGG CTTAAAACTGAAAAAGTTAAGAACATCCAAAGGTTTCAAAATTTTTGGAT GTTCTTATAAAAAAAGGTATCTTTTATTATCCATAGATCAACAAACTACA ACTAATGATCAAAGACTTGAAAAAAGATTACAAGAAAGAAAAACAAGGAT TTATAGATGACTACACCAAACAGATCGAAACACTTCAGACAAGTCTAACG GACAAAACAAATGAAGTGAAACTGATGCAATCGGAGTTGAAATTGGTGAA AGAATTTCGTCGGAAAAGAGCTCTCATGCAGAAAGAGATTGATGATGTAT GAAATGTTTTTCTTCTTCGTTTTTTTATGGATTTTCTTTTAATAGACCTT TTTGTAAATTACGTCACGAACATCACTTGCCTCGTATTCAAACAATTACC ATGGTGATTGTGTCCCTTGAGACATTAAATGAATATTTTTTGATGAATAG GAAGTAGTGGACTCCGCTGGGAGTTAATCACCATGGCAATAATTTCAAAA CGAGGTAAGTGATGTTCGTGACGTAATTTATGAAAAGGTCTATTCGTTTG GATATTATCATAATAATATAGAAAGGAGGCGCGTCTCTTATGCCGACAAA GCAGAATCAACAAAATAGTTTCTCGTTACTCAAAATGTGTGCTCGTGCGG TGGGAGGGGGGAATCTTTTTTTCTTTTTTTGTTTAAAACTGCTGAAAACG CAAATGGTAGGAGATCCGTTAAAAATATCCTTTAATATGCTTAAAATTTC AAATTTTGATACAAATATTATGGAATTATGGTTAGCCACAGTCAAACTTT TGATGTAAAGTCTCATTTCTTCTATTAGTAAGATCAGTGCATGGCCGCAA TTCATAACATCTCGAATTAGAAATTCGTTGCAATTTCTAATTTGACGACC TTTACGGTATTTCTTTTTGCAGTTTGCGATTATTTCCAATCTCTTTTGAT ACTCGTTTTCTTTTTAGATCAAAGACAATCTTTTCATGAACGAAAAACAA CATGAACATGCTCTGGAAAAAATCGAAAGAAAGTTCTTCGATGAAAAGGT ATGATTTTCACATTTTCATTTCCAATCTTGTTTAAGTTAAGAATGATAGG GAAATTTCGTCGTTTGATCTAAAAATTATGCTTATTTATATCGATTATTT CCTGCTTAACGCGAGTTTTTGATGTGATAACATCATTGTATTATAAACTT TTTAGATTCGTATGCAGCAAGAAGCCAATCGAAAGATTTCCGAACTTGCT GAAAGAGCTCATAACGAAGCTATCAGGTATATTAATGAAAAGGCATCTGT TTCACGATTACCTCAAGGGGATTAATTTCCGCAAGGATTATATTTTGCGA GTTTCGCGAGTTTTTTCAAAAACTTGCGAAATTTAATCCTCGCGAAAATT CATCNAAATTTTTGGATGTTCTTATAAAAAAAGGTATCTTTTATTATCCA TAGATCAACAAACTACAACTAATGATCAAAGACTTGAAAAAAGATTACAA GAAAGAAAAACAAGGATTTATAGATGACTACACCAAACAGATCGAAACAC TTCAGACAAGTCTAACGGACAAAACAAATGAAGTGAAACTGATGCAATCG GAGTTGAAATTGGTGAAAGAATTTCGTCGGAAAAGAGCTCTCATGCAGAA AGAGATTGATGATGTATGAAATGTTTTTCTTCTTCGTTTTTTTATGGATT TTCTTTTAATAGACCTTTTTGTAAATTACGTCACGAACATCACTTGCCTC GTATTCAAACAATTACCATGGTGATTGTGTCCCTTGAGACATTAAATGAA TATTTTTTGATGAATAGGAAGTAGTGGACTCCGCTGGGAGTTAATCACCA TGGCAATAATTTCAAAACGAGGTAAGTGATGTTCGTGACGTAATTTATGA AAAGGTCTATTCGTTTGGATATTATCATAATAATATAGAAAGGAGGCGCG TCTCTTATGCCGACAAAGCAGAATCAACAAAATAGTTTCTCGTTACTCAA AATGTGTGCTCGTGCGGTGGGAGGGGGGAATCTTTTTTTCTTTTTTTGTT TAAAACTGCTGAAAACGCAAATGGTAGGAGATCCGTTAAAAATATCCTTT AATATGCTTAAAATTTCAAATTTTGATACAAATATTATGGAATTATGGTT AGCCACAGTCAAACTTTTGATGTAAAGTCTCATTTCTTCTATTAGTAAGA TCAGTGCATGGCCGCAATTCATAACATCTCGAATTAGAAATTCGTTGCAA TTTCTAATTTGACGACCTTTACGGTATTTCTTTTTGCAGTTTGCCATTAT TTCCAATCTCTTTTGATACTCGTTTTCTTTTTAGATCAAAGACAATCTTT TCATGAACGAAAAACAACATGAAAATGCTCTGGAAAAAATCGAAAGAAAG TTCTTCGATGAAAAGGTATAAATTTTCACATTTTTCCCAATCTTGTTAAG TTAGAATGATAGGGAAATTTCGTCGTTTGATCTAAAAATTATATCGATTA TTTCCCGCCTAACGCGAGTTTAATTGTGATAACATCATTATGTATTATAA ACTTTTTAGATTCGTATGCAGCAAGAAGCCAATCGAAAGATTTCCGAACT TGCTGAAAGAGCTCATAACGAAGCTATCAGGTATATTAATGAAAAGGCAT CTGTTTCACGATTACCTCAAGGGGATTAATTTCCGCAAGGATTATATTTT GCGAGTTTCGCGAGTTTTTTCAAAAACTTGCGAAATTTAATCCTCGCGAA AATTCATCTTGCACAGTTTGTCCATGTTTGTCTCTTGAAATCTCAAAAAC CCTTAGGAAATTGAAAGAAAATAGTCAAAGAAGGTAATTATCTCGCGAAA ATAAGTCCCGCCAAGATTAAATATTTTCGCGAAAATGTCTTCCCGTGAAA ATTAATCCCCTAAGGTATTCAGTCCACTTGCCAAAACGCATAGCAGAGTT GTTCTCTTTGACTTCTGTTTGATTTCTGTTGATTATGTATGTTTACTAAC TGATTTTTTATCTCTTTATTCTTTTTTGACGTTTTGAGAATTCTAGAGAT GGTGAAGAAGATTATCTTTTTCAATGGTTATTATCAGATTTACAAAATAT TTTGGATTTGGGAAAAATGAAGATAGGGCAAATATACGCGAAGAGCATGG CTCTGTGACTTCCAATCTCGCACAAGGTTTCTTATGGCAAAGATATAACG GCCTTATCCGTTACATTGCAATACGAAGCGCAAAATTCCTCATAATTATG TGATTTTTAAATCGTTGGTTGAAATAACACATGCAAGACCATTTTCCATT CCATTATACAGTTGGGTGTCTTTAGCTCGAACCTTCATAGCTCGAATGTC TTCTTGACACGAACAAGTTTTATGGTTTCAGTTAACAATGTCTTATAAAC CTTACTCCAAAACTCGAACAATATTGTGTTCCCCGTGCGTGTTCAAGTTA TAGAGACTCCACTACTGTACATGTTTTTTTATAAGCATATTTTTTTTGAA AAACAAGTTATGCTTATGCTACATTTTGAAATCAAGCTCAAATTATGCTT GTGATATGCTTATTTTTCCGAAAAAATTGGTTCTTTAAAAATGGAAAAGA AATGACCAAAGGCCAAAGCTCACTGATATGCTAATGATATGCTTATCTTT TCACCAGCCCAGGTCTTAGTATGCTTATAAACGTTATGCTTTTAAAAAAA CATATATTTCAGCATTCTACAGAATAGCGCTCCGCAACGCATACGTCATA ATTATTACTTTTCACTTCTTTTTGACATTTGTACGAAATGCAATCCCACA ATTCAATGCGGCTCAATTAAAGATACGTGCAAGTTGTTGTATACAGCTTT TGTGAAATGATGCAATTAACGTGAATAGAGATTTTTAACTCAAAGGTTGA CAGGATTGGAACTCGTACAAACACATCGAAAGTAATGATTAAGTCAAAAA TGAAATCTATTTTAGATTCAGTGCAGTGCGCTATTAACTTCTCCAATTTT AACTCGTTCTCTTTCCCATATTACGCAGCAATTTGGACGATACAACGAAA TCAGTTTATAAAGAGAACGTTCGATTAAACGAAGCATTGACTTATCATAT AAAAGCTGGTGAAGAACTATCACAGGTTTGTGTTGACTACNCCCCTGTTA CGCAGCAATTTGGACGATACAACGAAATCAGTTTATAAAGAGAACGTTCG ATTAAACGAAGCATTGACTTATCATATCAAAGCTGGTGAAGAATTATCAC AGGTTTGTGTTGACTACATTATACTTAAAATCTATCACTTAGCAAAAACC TTCAAGTTTAAAAATCTTGAAAGATACTCCCACAAAACTGATGCATTTAA GCTACCATCACAGCGTTACTGCAAATTATACTTAAAATCTATCACTTAGC AAAAACCTTCAAGTTTAAAAATCTTGAAAGATACACCCACAAAACTGATG CATTTAAGCTACCATCACAGCGTTACTGCAAATTGTTCAAATATTTTTTT TTATTTGACATTATGTTAACCACCCTGGACTTTTCTTCCTCAACATATGG TAACCACCCTGGATTTTTACACTCAAGAAACCGGACCACCCTGGATTTTT TATCTTCCATATCACCCTGGACGTCACACCTCCCCCAACATAGGGGGTAC ACACTATTTCTGGAATAGCCAAATGCGTGTATACACCAAAGAAGAGTTGA ACCAGGGCTTTCTCAAAAATATTCACCCTCCCCTCGTTGAGGTCATGTCA AGGACTTGAAAAATGGTTCTTAATGCCTCTCTGCTGACTGTTCTGAAATA AAAAAACCTATATCCAAGGGAAAAGAATGGCGTACTCTCTACATGTTTTT TTTATAAGCAAGTGTCTGCCCCTTGATCAGGCTCGTGTATGCATAAATTC TCAAAGCATCCAGGCATAGCTTTTGCTAATTATATGCTTATGAATCATGC TTATCATTCACCCCGAGCCAACTTTTTAGTAAATTTTCAGAAACTTTGTA AACATTTGTTCAGATTTTGGGAGCAGTGGAATGTAGCTAGCCGTGGAATG TCTTTATTTTTACTTGACCTCTACCAAACCTTTTTAAACATATAAGAAAT GACAACTTGAAAAATATTCCAGGCTGACATATATGCTTATGTTCTGCTTA CAAATTCTGCAAATACGAGTCTTAATATGCTTATAATCGTTATGCTTATG AAAAAATGTACCTTCGGGTAGACATCTATCTACCTATATGAAAAAGGAGT CTTTGGTCGCCCCCCCCTTACGTGTTGCAAACCTACTTCAACTATAGAGA TTTCTTCTTTTCAGCACAAAGAAAATTTGGAAGAGCAGAACAAGAAATTA AGCAGTGAAAAAGAAATGAACAGCCTCATCGTCGAAGAGAAAGTCATCGA AAGCAAGAAAATTAAAAAAGCTAACAGCTCGGTAAGAATGCTGTAGAAAT TCGAAATTTGTCATTCTCAGTGACCGTCCTTTTTGTTTTGTTTATTCGGC AATCCCCTAAAATCAATAACGCGTTTTGAATTAAATTTTTTTGATTTTTG AAGAAAATAATTAAAACTAAAACATAACAAAAAAGGACGCTTAGCTCTCG CTCTTATTTAACCTGTTATTTGCCATATCTTAGTTAAAAGACCATTTCAA GACCGATCCAATTTTCAAAATCTGGAAACTTATATTACCGGGAATATGAT TTATTTTTGACGTATCTTTAATGTCATTTACTTTACAATTTTTCCTTTAA TTTCATTTATAGTAAAACAAATTCAAAAAAAAATTACGATTTTGAATAAT CTTGACATATTAACAGGCCTTTAAATGGCCAAAAATGCCAAAGAAACTTT TCTAATTTTTGCCTGTAGTGCGAATCAGGACCCCCAGAAGGGTTCGGCCA ATTTTGGACTTCGTCTATTTATTATTTGTATCCCATTTATAGCTTCAACA AAAAGTTGATGACCTTGAGAAAGCATTGACAGAAGTGATGTCGGAGAATA ATCAAAAGAAAACATCCTTAGTTCAGAAACATAATCAAGAACAAGAGGGA AATAAGTAAGTTGGAATTCTACATGGTACTATGTTACAGGGGTCATGTTA CAGACTGTGGTGCAGTGGTAGAGCATCCGGCTACGGTTCGCAAGGTTGTG GGTTCAATCCCTAGCTTGGTCATACCAAAGATTCCAAAATGGTACTTGAT GCCTCTCTGCTTGATGCTCAGTAATTAAGATAAGGATCAAGGATGAGTGG AGCGAGCCAGGGAAAAAGAGTGGCGCCCTCCCCTACCTTCGGGTAAATAG CTATCGAAAGAGGAGCTATCGGGTCGCCTCTGACAGCAGTCACAGACTTA CTTAAATTCTCGCATCGCTGAGATTTTTTAGATACACAATGCTTCTCGTG CTTGTTCTGATTTTTTGCACAATTAAGTAAAATAGTAATTCCCAAAATAT GATAGAGGCCAATTTTCGATTAAAAATCTTTCCGGCCGCCAGAACCTGAA AAAGCGGTTTTTCTGGATTTTCTCGAGATTTTATCTTTTTTTTTTCCTGA CTTGTTTATTTTGAATTTAATTTTTTTTGTTGAACAGACGGGTAGGTCCA TTAAAGTATCACTTTTTTCATTAATTTTTATTAATTAACTTTTACAGAAT GGAAATAGCACGGCTACAACGTATCATTGAACTAAAGAATAAGGAGATGA GCCGTGTCAAGAAACTTGCCAAAAACATCCTCGATCAGGTAAGACAATTA ACTTATCATTTTCTTATTTGTATGGCTCTTAAAATCAGAGCTTGGCATGG GTTTACGGCAACACTGTTTTACCGACGAGTTCTTCGACAGGTTTTGAAGG ATCCTGTAAAGCCTCAACTCGTCGTAGTCATAGATTTATAAAGCCCGAAG GGCTAGATGTCGTGCTTTGGCTGAAATGTGTTCAATATGCTGATGACACG ACTATATATCGCCACACCAAACCAAACGAGCTTGAAAATTGTGTCACTGA AATGAACTCTGATATTAGAGTAATTGAGAAATGGTCGCTGGATTCGAACT TGATATTTAACGCCAGAAAAACTAAATCGATGCTCTTTGCCACATCTCAA ATGGCAAGGAGGCATGATTTTGAATTCGAAATCAAGTCAAATAACGAAAA TGTGATTGAGCGTGTTCCCCTATTCAAGCTGTTGGGAATCATCTTCACCG AAAACCTAACATGGAATGAACATGTCAAAAAAATCGTCACTAAAGCATAT GGTACGCTGAAGAGTCTATCACTCATCAAACGATATTTACCATACCGTGT ACGACGCCAATTGGCAGAATCTCTTGTATTGAGTAAANNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNTGACTTTATTATATTTCTAGTTCTATGAAGTTTT TTTTCTTTTCTATTTGATGTTTAATTAGTTTCAATTAATTTAATTTAGAT AGTTGATAGCTCACTGGTCGTGTTTTGCAAGGTCCAGTACACTTTTACAC AGCCTTCGGTTTGCAATCTATGCTAGTTTTGCTCATAATATCTTACGCTC TGTCGTGATTCTATCTCACCGAGTTCTTAGATCTATTTTGTCGCTTACTT TATCTCTAGCCATCAATAGTACTTGAGCCTTAGTCTAGTCTAGCTTATAA CATTATGTTAGTATTTTTTTTTTAAATATATTCGTTAATTTTTTATAATA GCACACATTGCGATGGCCTCAGCTAGCATACTCAGATACTCGGATTTGTT TAGGTTTTAGTCTAGCTCTATCACTATTCACATTTTACCCCTCAATCCTA ATCTTTTATTCATCATACTAGCCCACCGCTTCGTCCCTATCTGTTTGTCT ATACNTTACAGAATGGAAATAGCACGGCTACAACGTATCATTGAACTAAA GAATAAAGAGATGAGCCGTGTCAAGAAACTTGCCAAAAACATCCTCGATC AGGTAAGACAATTAACTTATCATTTTCTTCTTTGTATGGCTCTTAAACTC AGAGCTTGGCATGGGTTTACGACAACACTGTTTTACCGACGAGTTCTTCG ACAGGTTTTGAAGGATCCTGTAAAGCCTCAACTCGTCGTAGTCATAGATT TATAAAGCCCGAAGGGCTAGATGTCGTGCTTTGGCTGAAATGTGTGCCGA GGTTAGGTAGGATTCCTAACTGAAGTCTGTCTCAAAATAATTTGCAGCTG GAGACAAAAATGGCTGTAACTTTAGATAGAATACGAATCAAGTTGTGAGT GGAATATTATCAAGTAAAAAATTTGAGAAAAAAAAGGAAAATGAAAATGA AAAATGAAGAAGAAAAAAAATCAACTTCTTGTAGAAATGTGGTATAANNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNCAATCAAAAGATATCAAACAAAGTTTATTGCTGGTTGATCGACAA AAGGCTGTTTTTTGTCGTTTTTTACTACTTTATAGAGTCAACCAGCAATA AACTTTATTTGATATCTTTTGATTGAATGAATATTTTTTTGAACCATTTA CTTGATAATATTCCACTCACGAATATCTTTTTAACGAGCACAAAATCGCT ACTTGATTCGAATTCTATGAAAAGTTACAGCCATTTTTGTCTCCAGCTGC AAATTATTTTGAGACAGACTGTAGGTCACGTGACATTACAATAGAATTTC AGCGCTTGACCAATCTTTGCAGGTTTTCGAAAACAATAGCAGCAATATTC TTTGCCATATTCACTTTTTTTTTGCTTAAAGCACGACATCTAGCCCTTTG GGCTTTACTGAAATCTGTAGTCGTTGTCTTGCTTTTCAATCAATCTTTTC ATTGAGTATTATTAAAAGTCCACTCCTTCTTCACTATTGCGTTGATGATG TATTCGCATACAATAATAATCTCAATAATGCACGATAAAAAGCTGACATT TTTCAATATATTAAGTTCTCTCTCTTTTTCTCTATATTAAGTTCAAAAGT GACAATGACCGGGGGGTAAATTTCCAAGAAATGTTATATCCTCCACCTCC ACCCCCCCCCCATATTCAAATTTTTTTCTGTATAAGCCCATTGCTGCTCA TTACCGTGAAGACACCTAAAACGTCGCTTTTCTTGTGATACGTTTTTTTA AGAAACTAAGAAACCAAGCAGCCTCTCAATGTTTCTTAAGAAATCGGCTT TTTGAGCCTTAAATGTTTCTTACATGTTTCTAAACTTTTTGACATAATCA GCCTCGTGTTTCTTAAATTTTGCTTCTTTCAAAAAAAAAACCGAATTAAA AAACTTTATTTTCTCATTCTCAGCCTCAGCATGTTTCTTAGATGTTTCTT AGTTTTAAGGCATTCTGAGCCTCGTGTTTCTTAAAATTGTGTTTCTTTAA AAAAAAAGTGTAGCTGTCGGTAACTTTTAAAATCTATTCATGGTAAGTTT GCACTCTTTTTTCTTTTACCTATAACTTTTGAAGGATTTCTTCAATCTTT ATAAATTTGGTATGTATCTTTGGAGAGATATTTCTCAGTGAAACAATTCG AAATAAAAAATTCTTCAAAAAAATTCTAAAAATGAAAGATGAAAATAAGG AAGAAAAAAATGAAGATCTTATGTAAAAGTGCTATAACTTTCATTTTCAC TGGAGAGATTCTTTGATCTTAGGAGGTCATCACTGTGAAGAAATTTCACT AAAATATTTATTCAATATAAAGTTATGATACAAAGTTAACAAGTGATTGA CCCCAAAAAACAAGATCTTCATTTTTTTCTTCTTCATTTTTATCTTCATT TTTATAATTTTTTTAAAGATATTTTTATTTCAAATTGTTCCACTCTCCGC ACTCTCCCACACAATCTTTCCAACGATACCAAATTTAAAAAGATTGAAGA ATTCCTTCAAAAGTTATAAGTAAAAGAAAAAAGAGTGCACACTTATCGTG AACAGACTTTTAGTTTTGATTATTTCATTCCTCTACATACGTGTAATCAA AAGGTCTTCAAAATCATCTTTTACAGCGTTCAGATGTCGAAAAATTCTTT ATCGAATCATTGGAAATGGTCAAAACTGAAATCATCAGAAATCGGTAACC GTATTTTTATTTTTCTGAATCAACTTTTTTTATAAGATTATTCAAAGATA ACTTAAAATAATTGTGGCTAGAATATTGATGGTCACACAATTATGATCAT TGAATGATAAATAGAACGGTTATTTTCAATTGTAGACCCAAATTCAATTC AGTTTTCGTAATTTAACACTGTTATTCAAGTGATAGACAGATTTTATTAG CGTGTAATCAAATTTCAATATTGTATTTAATATATGTACGCTTAATTATC GTATCAGCTGATATAACAACGAAAGTGTTTTTCGATGTCGAAAGCTCCTT TTACATAAGTCACGTTTTGTATCCCAGTTTGCAGTGCTGGAAAATTTACC ACTAGAAAGTTATCAAACGTGGCTTTTTACCGACAGGTTTCAAAAACACC AAAATTGTGTACGAAAGTAACCTTTGTTATACCTCTAACCTTTACACCAC CCAGGAACTAGAAATAATCATAAAAGTTATGAGGGAAACACCAAGGCTAC GATTAGCTCACAATAAAACCTTCCTGGGTATACGGTTAAACGCTTTTTCG ATCTACGAAGGCAACGAAAATATCTTTTCTTTTATCATGACAGTTCTCTT GCAATTGCAGGAGGATAAAAACGCCATCAGTCGTGTCACGCACGGCCAGG CAAAATGCCGAATGCATATCATCAATTAATGATATTCATGACGTAATATT ATGTACGGAAAGACCCCGGTTTTTGCCAGTAGTGGCAAATTTTATACAAC TTTTGTCTAGTTTAAATTTGCCACTACTGGCTGAAACCGAGGTATTTCCG TAGAAAACATTACGTCATGAATATCATTAATTGAGATTAAATCTCTAACG TCGCATCTTAAAAATAAATAAATTTTGCTGTCATTCCTTCCCTGGAAACT AGACCCAATTCATTTGTAGTGTTTAGGATTAAGACCATGTTCAGACGCTA CGGTTCCGTTCCGGAACAAGTGCAAACGTCAAAATTCGGAGCGTCAAAAA AGAGGACGTTACAAAGCAAAATATATCGAAACAGTTTCGCTCCACTTTTT TTATCGTAACGGAACTGCTCTGTTTTCTTGCTCCGAAACGTTCCGAAACC AATATGAACACATTCGATCCGTAACGCAAATCATACCGGAGCGAAACGGA ACAGTAACGTGTGAACATTGTGGAATAGATGTATTACTTCTTCGGAAAAG AAATCTTTAATGTTTTTTTTTCAGTGCGCAATATCGACGAGACGCTGAAG TAGCATACAATAAAAGAATGACCGAAGCACATTCTGGTCACTCTGATTAT CCCAAAGTCCGCACATTTCGTCATCTAAAGAACAGCACTAATTCCGTGTA CGCAGATCTACGCGCGGCCGAACGGTGGGATGGGTTTGACGCGTCGGTTG ATCTTTCAGAATTAACATGGGAACAGAGAGAACAGGTTCTTCGCTTGTTG TTCGCTAAGATGAATGGCCAGAAAACGTGAGTTATAATTTGAATTCCGTA ATTATTTTTCATGCTTTCGAACTTTTTAGGTGTGAAATTTTAACTTATGG GAATCTAGAAATCGGAGCTTTCTACCACGAAAATCGAAAAATTGAAAAAT TTCAAAAATCAGATTAAAAAAGATTTGCGTGATACAATGTCAAAATGTCT CACTCTCAAGCTCAAGGCTTTATTTAAAGGCTTATTTTTTTAAGGAAAGT ATTACTAAATATCTGCTATAATATTTCCTATAGATCAAAAGTCAGCAAAA GTATACTTCCACCCATCAACAGTAAGATGGACGAAACTAAAGCTCATCAA CCGAAACCACCTTCCGTTCAAAAAGCTTTTCTCACGGAAGCCGATGATCC AAAAGAGGGTGTCAGTAGTGATGCAAGTAGGGTATTTTCAGCCACTGAGA TCCTTGCTTTTACATGACTTTTATGACTTAGCAATTTTTAGGGTACTGAT TATTTGTAATTAATTTTTTTTGAAAAGTTGTATATAATAGTTTGTGTATA GATTTAATCAGAATAGAATGTGATTTTATTTTATTACCTTGTAAAATAAT TAATTTTTTAATGATGGTTTAATTTATTTTTTGGTAAAGACTGATTCAAG GAAAAGTAATT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000328XLOC_000328Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000548-exon-sc0000002-1575043694:486238..486352TCONS_00000548-exon-sc0000002-1575043694:486238..486352Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1575043694:485778..485897TCONS_00000548-exon-sc0000002-1575043694:485778..485897Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1575043694:485293..485416TCONS_00000548-exon-sc0000002-1575043694:485293..485416Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1575043694:483307..483516TCONS_00000548-exon-sc0000002-1575043694:483307..483516Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1575043694:482555..482635TCONS_00000548-exon-sc0000002-1575043694:482555..482635Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1575043694:482327..482397TCONS_00000548-exon-sc0000002-1575043694:482327..482397Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1575043694:479351..479447TCONS_00000548-exon-sc0000002-1575043694:479351..479447Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1575043694:478172..478288TCONS_00000548-exon-sc0000002-1575043694:478172..478288Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1575043694:477548..477660TCONS_00000548-exon-sc0000002-1575043694:477548..477660Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1575043694:476865..476955TCONS_00000548-exon-sc0000002-1575043694:476865..476955Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1575043694:472659..472726TCONS_00000548-exon-sc0000002-1575043694:472659..472726Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1575043694:471177..471428TCONS_00000548-exon-sc0000002-1575043694:471177..471428Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1575043694:470542..470919TCONS_00000548-exon-sc0000002-1575043694:470542..470919Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1510915933:486238..486352TCONS_00000548-exon-sc0000002-1510915933:486238..486352Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1510915933:485778..485897TCONS_00000548-exon-sc0000002-1510915933:485778..485897Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1510915933:485293..485416TCONS_00000548-exon-sc0000002-1510915933:485293..485416Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1510915933:483307..483516TCONS_00000548-exon-sc0000002-1510915933:483307..483516Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1510915933:482555..482635TCONS_00000548-exon-sc0000002-1510915933:482555..482635Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1510915933:482327..482397TCONS_00000548-exon-sc0000002-1510915933:482327..482397Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1510915933:479351..479447TCONS_00000548-exon-sc0000002-1510915933:479351..479447Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1510915933:478172..478288TCONS_00000548-exon-sc0000002-1510915933:478172..478288Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1510915933:477548..477660TCONS_00000548-exon-sc0000002-1510915933:477548..477660Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1510915933:476865..476955TCONS_00000548-exon-sc0000002-1510915933:476865..476955Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1510915933:472659..472726TCONS_00000548-exon-sc0000002-1510915933:472659..472726Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1510915933:471177..471428TCONS_00000548-exon-sc0000002-1510915933:471177..471428Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1510915933:470542..470919TCONS_00000548-exon-sc0000002-1510915933:470542..470919Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1491911889:486238..486352TCONS_00000548-exon-sc0000002-1491911889:486238..486352Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1491911889:485778..485897TCONS_00000548-exon-sc0000002-1491911889:485778..485897Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1491911889:485293..485416TCONS_00000548-exon-sc0000002-1491911889:485293..485416Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1491911889:483307..483516TCONS_00000548-exon-sc0000002-1491911889:483307..483516Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1491911889:482555..482635TCONS_00000548-exon-sc0000002-1491911889:482555..482635Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1491911889:482327..482397TCONS_00000548-exon-sc0000002-1491911889:482327..482397Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1491911889:479351..479447TCONS_00000548-exon-sc0000002-1491911889:479351..479447Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1491911889:478172..478288TCONS_00000548-exon-sc0000002-1491911889:478172..478288Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1491911889:477548..477660TCONS_00000548-exon-sc0000002-1491911889:477548..477660Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1491911889:476865..476955TCONS_00000548-exon-sc0000002-1491911889:476865..476955Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1491911889:472659..472726TCONS_00000548-exon-sc0000002-1491911889:472659..472726Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1491911889:471177..471428TCONS_00000548-exon-sc0000002-1491911889:471177..471428Clytia hemisphaericaexon
TCONS_00000548-exon-sc0000002-1491911889:470542..470919TCONS_00000548-exon-sc0000002-1491911889:470542..470919Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:470542..486352 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
6.5183 5.83718 70.0964 60.346 193.398 163.422 42.0438 51.2452 54.309 42.217 34.6378 32.9171 7.70521 7.15352 9.71541 10.4767 12.5402 15.7069 12.1063 13.5592 12.9342 11.9083 13.2653 14.9805 43.733 28.8064 26.8923 21.1555 17.9554 16.8574
Blast
BLAST of TCONS_00000548 vs. Swiss-Prot (Human)
Match: BBOF1 (Basal body-orientation factor 1 OS=Homo sapiens GN=BBOF1 PE=2 SV=3)

HSP 1 Score: 337.421 bits (864), Expect = 2.098e-107
Identity = 192/477 (40.25%), Postives = 319/477 (66.88%), Query Frame = 3
Query:  147 NDDVLKQAIANACLWESRLGTVEVAKNEYRDTTRTLLHENEKLQTQVSQTEKETVDVLSFLRDEDIKKNNTINKLQLMIXXXXXXXXXXXQGFIDDYTKQIETLQTSLTDKTNEVKLMQSELKLVKEFRRKRALMQKEIDDIKDNLFMNEKQHEHALEKIERKFFDEKIRMQQEANRKISELAERAHNEAISNLDDTTKSVYKENVRLNEALTYHIKAGEELSQHKENLEEQNKKLSSEKEMNSLXXXXXXXXXXXXXXANSSLQQKVDDLEKALTEVMSENNQKKTSLVQKHNQEQEGNKMEIARLQRIIELKNKEMSRVKKLAKNILDQRSDVEKFFIESLEMVKTEIIRNRAQYRRDAEVAYNKRMTEAHSGHSDYPKVRTFRHLKNSTNSVYADLRAAERWDGFDASVDLSELTWEQREQVLRLLFAKMNGQKTSKVSKSILPPIN----SKMDETKAHQPKPPSVQKAFLTE 1565
            ++ V+ +A ANA LWE+RL   E+++ +YRDT+R L   NE L+ +  + EK+ + VLS+L+ +D +K+N I KL+  + + K+  ++EK      YT+QI  L+     K  E+ ++ +ELK V++F++++  +++E+DD+K+NL   E+ H+  L ++E +FF+EK R++QEA +KI  LAERAH+EAI  L+D  ++V+KEN  L +AL YH+K  + L ++ + L+E +  L  +KE+N L+V+EK+++  + +    +LQ+KV +LE AL+ +  E   +   L Q    E +  ++EI +LQ ++++K++EM+RVKKLAKNILD+R++VE+FF+++L  VK +I+ +R  Y++ A+ A+N +M  A +G ++YPK+RTF   ++STNSV  DL  AE+W   + +VD+ +LTWEQ+E+VLRLLFAKMNG  + K ++S  PP+     S   ETK    +     K F+T+
Sbjct:   25 DESVVDRAKANASLWEARLEVTELSRIKYRDTSRILAKSNEDLKKKQCKMEKDIMSVLSYLKKQDQEKDNMIEKLKQQLNETKEKAQEEKDKLEQKYTRQINELEGQFHQKAKEIGMIHTELKAVRQFQKRKIQVERELDDLKENLRNTERIHQETLRRLESRFFEEKHRLEQEAEKKIIMLAERAHHEAIVQLNDAGRNVFKENDYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKKLAKNILDERTEVERFFLDALHQVKQQILISRKHYKQIAQAAFNLKMRAACTGRTEYPKIRTFDGREHSTNSVNQDLLEAEKWTHIEGNVDIGDLTWEQKEKVLRLLFAKMNGCPSRKYNQSSRPPVPDYVVSDSGETKEFGDESKLQDKIFITQ 501          
The following BLAST results are available for this feature:
BLAST of TCONS_00000548 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
BBOF12.098e-10740.25Basal body-orientation factor 1 OS=Homo sapiens GN... [more]
back to top