Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000545 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000545
Unique NameTCONS_00000545
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1833

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000545 ID=TCONS_00000545|Name=TCONS_00000545|organism=Clytia hemisphaerica|type=transcript|length=1833bp
gttcaaaattattaaaaattatgtgaaaataatataaaagaaaataatgt
aaacaaagatgccgaaaaaggccaaaaaagctaaaggaaaatctaaaaaa
gacaaaaaaggAAGGAAGTCATCAAAAGGAGTCAAAGTCAATAATGACGA
CGTTTTGAAACAAGCTATAGCCAATGCTTGCTTATGGGAAAGTCGTCTTG
GAACTGTCGAAGTTGCCAAAAATGAGTATAGGGACACGACACGAACGTTG
CTTCATGAAAATGAGAAACTTCAAACACAAGTATCACAGACAGAGAAGGA
GACTGTTGACGTCCTTAGTTTCCTGAGGGATGAAGATATCAAGAAAAATA
ATACGATCAACAAACTACAACTAATGATCAAAGACTTGAAAAAAGattac
aagaaagaaaaacaaggaTTTATAGATGACTACACCAAACAGATCGAAAC
ACTTCAGACAAGTCTAACGGACAAAACAAATGAAGTGAAACTGATGCAAT
CGGAGTTGAAATTGGTGAAAGAATTTCGTCGGAAAAGAGCTCTCATGCAG
AAAGAGATTGATGATATCAAAGACAATCTTTTCATGAACGAAAAACAACA
TGAAAATGCTCTGGAAAAAATCGAAAGAAAGTTCTTCGATGAAAAGATTC
GTATGCAGCAAGAAGCCAATCGAAAGATTTCCGAACTTGCTGAAAGAGCT
CATAACGAAGCTATCAGCAATTTGGACGATACAACGAAATCAGTTTATAA
AGAGAACGTTCGATTAAACGAAGCATTGACTTATCATATAAAAGCTGGTG
AAGAACTATCACAGcacaaagaaaatttggaaGAGCAGAACAAGAAATTA
AGCAGTGAAAAAGAAATGAACAGCCTCATCGTCGAAGAGAAAGTCATCGA
AagcaagaaaattaaaaaagctaACAGCTCGCTTCAACAAAAAGTTGATG
ACCTTGAGAAAGCATTGACAGAAGTGATGTCGGAgaataatcaaaagaaa
acatcCTTAGTTCAGAAACATAATCAAGAACAAGAGGGAAATAAAATGGA
AATAGCACGGCTACAACGTATCATTGAACTAAAGAATAAGGAGATGAGCC
GTGTCAAGAAACTTGCCAAAAACATCCTCGATCAGCGTTCAGATGTCGAA
AAATTCTTTATCGAATCATTGGAAATGGTCAAAACTGAAATCATCAGAAA
TCGtgcgCAATATCGACGAGACGCTGAAGTAGCATACAATAAAAGAATGA
CCGAAGCACATTCTGGTCACTCTGATTATCCCAAAGTCCGCACATTTCGT
CATCTAAAGAACAGCACTAATTCCGTGTACGCAGATCTACGCGCGGCCGA
ACGGTGGGATGGGTTTGACGCGTCGGTTGATCTTTCAGAATTAACATGGG
AACAGAGAGAACAGGTTCTTCGCTTGTTGTTCGCTAAGATGAATGGCCAG
AAAACATCAAAAGTCAGCAAAAGTATACTTCCACCCATCAACAGTAAGAT
GGACGAAACTAAAGCTCATCAACCGAAACCACCTTCCGTTCAAAAAGCTT
TTCTCACGGAAGCCGATGATCCAAAAGAGGGTGTCAGTAGTGATGCAAGT
AGGGTATTTTCAGCCACTGAGATCCTTGCTTTTACATGACTTTTATGACT
TAGCAATTTTTAGGGTACTGATTatttgtaattaattttttttgaaaagt
tgtatATAATAGTTTGTGTATAGATTTAATCAGAATAGAAtgtgatttta
ttttattaccttgtaaaataattaattttttaatgatggtttaatttatt
ttttggtaaagaCTGATTCAAGGAAAAGTAATT
Run BLAST on NCBI

transcript from alignment at sc0000002:470542..486348-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000545 ID=TCONS_00000545|Name=TCONS_00000545|organism=Clytia hemisphaerica|type=transcript|length=15807bp|location=Sequence derived from alignment at sc0000002:470542..486348- (Clytia hemisphaerica)
GTTCAAAATTATTAAAAATTATGTGAAAATAATATAAAAGAAAATAATGT AAACAAAGATGCCGAAAAAGGCCAAAAAAGCTAAAGGAAAATCTAAAAAA GACAAAAAAGGGTAAGAACTTTCTTTCATTTTTACTTCAAAAAGACTTAT TTTTACTGAAAAAAAGCCTCTTCGACAAGGCTATAAGCAGAGGAAACAAA AAATGCTATAACTTCTTATAGAAATAGAACCAAATGTTTTTGTACTTGTT GAAAAGATATTCAGGAGTGGAACATTATTATAAAGAAAAAACTTTTCTTT AAAAAATTTTTTTTCGCAAAAAGACTTTTTCACAGTGATAACACTTTAAG ATTGAAGATATTTTTATTTAAAAATGGTGACCATAGCACAATTAATTCTA CAAGGGCTGGATTTTTCTCTTCTTTACTTTTCTTTATTTTTTTAATCTTA GAAGGAAGTCATCAAAAGGAGTCAAAGTCAATAATGACGACGTTTTGAAA CAAGCTATAGCCAATGCTTGCTTATGGGAAAGTCGTCTTGGAACTGTCGA AGTTGCCAAAAATGAGTATAGGTAATGATTATTTTTCTAACAGATCATTC ATTCTACCAGCACTTTGCTTTGCACTAAAGGTACAGCTCTCTTTTAGTAA TACTCATCCAATATCGATATTTACTTGGATAGTTCAGTAGTCTGCTAATT TTAGACAGTCTTTTGATTATTTTCACCGGTCCAGGGCCAGTCGGCTATCT ATGAACTGAACAGAACATTGAAAGGAGCGGGGATTCGACTTTGGAATTTG TTTAATATTTTTATTCTTTATTTAAAGTTGGGGACGCTAATAGAAATACA CAAGTATAATAGGAATTCTGATCAAATCCAACCAATTTCTAAGATAAAAA GAATTGTTAAACCTCTCAACCAATCTTAATAGGGACACGACACGAACGTT GCTTCATGAAAATGAGAAACTTCAAACACAAGTATCACAGACAGAGAAGG AGACTGTTGACGTCCTTAGTTTCCTGAGGGATGAAGATATCAAGAAAAAT AATACGGTATTCATCAGTTTAATCATAACCATCATGGACCTAGAGTTTTT TCATGGCACGATGAGTGTCCTCTCATTTGGGAGGGGCGGTTACAAAGTTA GGGTACTTGACTAGTGCCATAAATGTGTACTAACCACTGACCTTTATATA TCCCTGGAACAAGCTATATCCACCATCTTTGATCAGAGTTTTTTTGGAAT TGGTACCCGAGAAGAATCCATTGCAATGTTAAAAATTAACATATATAAAG GCCCTACATCATCAAAAGTATTCGAGATAAAGTAGATCTAGCGCTCTCGA TGCATTTTCACCATTTCGCCATTAGGGTACCAATTTCAAAAAATCTCCGA TCAAAGATTTTTGGTTGGCCGGAATTGAGTAACTTGGTCAAGGGTATATA AAGGTGAGTGGTACTAACATGGTTTTGGGAATGGAGTTTTGACCATCATC CGTTTGTACCTTAATATAAAAAGTTGAAAATATGCCTTCAATGTAGGTAG ACCACCCCTAACTAACTGGAATTACCTGTTAAAATCCTTATTTTGACGGG AAAGCAAGAGTAGAATTATACAGCCTAGTACCCAAAAATGTCCTAAGTTT TTACTTCCCTTAAAAATAAAAAATAAACACTTTTTCTTAGGCACTTTTCG ATACTGAGGTATTATAATCGACTTTTTTTCTCCAAATTTGCACAAGGTAA AGTTGAAAATCAGCTTTTAAATGAATTTCCAGCTTTGACCACTCCACTTA GTACATGGTACTAAGTTGTTTTTGACTTGCCAATTTTGACCATCAACCCC GGTAGTGGTCCCTACAATCTAGTACTGAGCCCCTGTTCAATAGATTTGAT TTAGACCTCGACTTGGGGTTCCATCGATATCAAGGACAATCCTCTCCAGG TCGACGAATAAGAAATCCATTGTACTCTATAACTTTTTTGAATTCTTTAC AGTATTCTATACATTGTCGCTTTCCTATTACAGTATCTGTAATATGCGAG AAATCGGTCTTGTTTTTTTCATTGCCTTTTCCTTGGTTCCATACGTAAAT ATAACCGACATCTCTTCAGAAGTATGCAGTATGTTTTTTAATAGGGATAA TAATATATTTTCGTAATACTTTTCAAAAGGGTGGAAAATTTCTTGCTCTA CTGAAGAAATTTGAAATTCGATTGTCTTATTCGATCATTATTTTTTTTGT TGGTCGTTCTGTTCAATTTAGTTCTTATTGATCCGATCGTCTATTCCGTT CGACTGAGATTACCTACCGAGCAATTTTAATACATATGTATCTCATATGA CATGGAGTTTTTGGCGGGAATTCGTTTGGTTTATTTTAGAGGCAGCCTAA AAATGCCTTGCGCCGAGAGCAAGTAAATCTTGCTTGTAAATTCGTTCCCA TTCCTCTAAAAAAGGCGACCGCGCTGATGCAAAGGGTTGATTGATACATT CGAACCTACACCATTCGGAGCTCAAGATTAATTGAAAGTCAACTGTTGTT ATACACGCTTTTTTTATTATAAGAACAAACTATATAAGAACATAAGGCTT CGATGGCCAAAATGTGAAGAACAAGTTAAGAACATTTGAAGGCTTTGCAG GGCTTTGCGGACTCGAAAACACCCTATTTCTTAGGAAAGTGGGTAAGAAT GGTCACAAAATGGTGAAAGTAAGCACATGTTAAGAACATTTTTAGGCTTA AAACTGAAAAAGTTAAGAACATCCAAAGGTTTCAAAATTTTTGGATGTTC TTATAAAAAAAGGTATCTTTTATTATCCATAGATCAACAAACTACAACTA ATGATCAAAGACTTGAAAAAAGATTACAAGAAAGAAAAACAAGGATTTAT AGATGACTACACCAAACAGATCGAAACACTTCAGACAAGTCTAACGGACA AAACAAATGAAGTGAAACTGATGCAATCGGAGTTGAAATTGGTGAAAGAA TTTCGTCGGAAAAGAGCTCTCATGCAGAAAGAGATTGATGATGTATGAAA TGTTTTTCTTCTTCGTTTTTTTATGGATTTTCTTTTAATAGACCTTTTTG TAAATTACGTCACGAACATCACTTGCCTCGTATTCAAACAATTACCATGG TGATTGTGTCCCTTGAGACATTAAATGAATATTTTTTGATGAATAGGAAG TAGTGGACTCCGCTGGGAGTTAATCACCATGGCAATAATTTCAAAACGAG GTAAGTGATGTTCGTGACGTAATTTATGAAAAGGTCTATTCGTTTGGATA TTATCATAATAATATAGAAAGGAGGCGCGTCTCTTATGCCGACAAAGCAG AATCAACAAAATAGTTTCTCGTTACTCAAAATGTGTGCTCGTGCGGTGGG AGGGGGGAATCTTTTTTTCTTTTTTTGTTTAAAACTGCTGAAAACGCAAA TGGTAGGAGATCCGTTAAAAATATCCTTTAATATGCTTAAAATTTCAAAT TTTGATACAAATATTATGGAATTATGGTTAGCCACAGTCAAACTTTTGAT GTAAAGTCTCATTTCTTCTATTAGTAAGATCAGTGCATGGCCGCAATTCA TAACATCTCGAATTAGAAATTCGTTGCAATTTCTAATTTGACGACCTTTA CGGTATTTCTTTTTGCAGTTTGCGATTATTTCCAATCTCTTTTGATACTC GTTTTCTTTTTAGATCAAAGACAATCTTTTCATGAACGAAAAACAACATG AACATGCTCTGGAAAAAATCGAAAGAAAGTTCTTCGATGAAAAGGTATGA TTTTCACATTTTCATTTCCAATCTTGTTTAAGTTAAGAATGATAGGGAAA TTTCGTCGTTTGATCTAAAAATTATGCTTATTTATATCGATTATTTCCTG CTTAACGCGAGTTTTTGATGTGATAACATCATTGTATTATAAACTTTTTA GATTCGTATGCAGCAAGAAGCCAATCGAAAGATTTCCGAACTTGCTGAAA GAGCTCATAACGAAGCTATCAGGTATATTAATGAAAAGGCATCTGTTTCA CGATTACCTCAAGGGGATTAATTTCCGCAAGGATTATATTTTGCGAGTTT CGCGAGTTTTTTCAAAAACTTGCGAAATTTAATCCTCGCGAAAATTCATC NAAATTTTTGGATGTTCTTATAAAAAAAGGTATCTTTTATTATCCATAGA TCAACAAACTACAACTAATGATCAAAGACTTGAAAAAAGATTACAAGAAA GAAAAACAAGGATTTATAGATGACTACACCAAACAGATCGAAACACTTCA GACAAGTCTAACGGACAAAACAAATGAAGTGAAACTGATGCAATCGGAGT TGAAATTGGTGAAAGAATTTCGTCGGAAAAGAGCTCTCATGCAGAAAGAG ATTGATGATGTATGAAATGTTTTTCTTCTTCGTTTTTTTATGGATTTTCT TTTAATAGACCTTTTTGTAAATTACGTCACGAACATCACTTGCCTCGTAT TCAAACAATTACCATGGTGATTGTGTCCCTTGAGACATTAAATGAATATT TTTTGATGAATAGGAAGTAGTGGACTCCGCTGGGAGTTAATCACCATGGC AATAATTTCAAAACGAGGTAAGTGATGTTCGTGACGTAATTTATGAAAAG GTCTATTCGTTTGGATATTATCATAATAATATAGAAAGGAGGCGCGTCTC TTATGCCGACAAAGCAGAATCAACAAAATAGTTTCTCGTTACTCAAAATG TGTGCTCGTGCGGTGGGAGGGGGGAATCTTTTTTTCTTTTTTTGTTTAAA ACTGCTGAAAACGCAAATGGTAGGAGATCCGTTAAAAATATCCTTTAATA TGCTTAAAATTTCAAATTTTGATACAAATATTATGGAATTATGGTTAGCC ACAGTCAAACTTTTGATGTAAAGTCTCATTTCTTCTATTAGTAAGATCAG TGCATGGCCGCAATTCATAACATCTCGAATTAGAAATTCGTTGCAATTTC TAATTTGACGACCTTTACGGTATTTCTTTTTGCAGTTTGCCATTATTTCC AATCTCTTTTGATACTCGTTTTCTTTTTAGATCAAAGACAATCTTTTCAT GAACGAAAAACAACATGAAAATGCTCTGGAAAAAATCGAAAGAAAGTTCT TCGATGAAAAGGTATAAATTTTCACATTTTTCCCAATCTTGTTAAGTTAG AATGATAGGGAAATTTCGTCGTTTGATCTAAAAATTATATCGATTATTTC CCGCCTAACGCGAGTTTAATTGTGATAACATCATTATGTATTATAAACTT TTTAGATTCGTATGCAGCAAGAAGCCAATCGAAAGATTTCCGAACTTGCT GAAAGAGCTCATAACGAAGCTATCAGGTATATTAATGAAAAGGCATCTGT TTCACGATTACCTCAAGGGGATTAATTTCCGCAAGGATTATATTTTGCGA GTTTCGCGAGTTTTTTCAAAAACTTGCGAAATTTAATCCTCGCGAAAATT CATCTTGCACAGTTTGTCCATGTTTGTCTCTTGAAATCTCAAAAACCCTT AGGAAATTGAAAGAAAATAGTCAAAGAAGGTAATTATCTCGCGAAAATAA GTCCCGCCAAGATTAAATATTTTCGCGAAAATGTCTTCCCGTGAAAATTA ATCCCCTAAGGTATTCAGTCCACTTGCCAAAACGCATAGCAGAGTTGTTC TCTTTGACTTCTGTTTGATTTCTGTTGATTATGTATGTTTACTAACTGAT TTTTTATCTCTTTATTCTTTTTTGACGTTTTGAGAATTCTAGAGATGGTG AAGAAGATTATCTTTTTCAATGGTTATTATCAGATTTACAAAATATTTTG GATTTGGGAAAAATGAAGATAGGGCAAATATACGCGAAGAGCATGGCTCT GTGACTTCCAATCTCGCACAAGGTTTCTTATGGCAAAGATATAACGGCCT TATCCGTTACATTGCAATACGAAGCGCAAAATTCCTCATAATTATGTGAT TTTTAAATCGTTGGTTGAAATAACACATGCAAGACCATTTTCCATTCCAT TATACAGTTGGGTGTCTTTAGCTCGAACCTTCATAGCTCGAATGTCTTCT TGACACGAACAAGTTTTATGGTTTCAGTTAACAATGTCTTATAAACCTTA CTCCAAAACTCGAACAATATTGTGTTCCCCGTGCGTGTTCAAGTTATAGA GACTCCACTACTGTACATGTTTTTTTATAAGCATATTTTTTTTGAAAAAC AAGTTATGCTTATGCTACATTTTGAAATCAAGCTCAAATTATGCTTGTGA TATGCTTATTTTTCCGAAAAAATTGGTTCTTTAAAAATGGAAAAGAAATG ACCAAAGGCCAAAGCTCACTGATATGCTAATGATATGCTTATCTTTTCAC CAGCCCAGGTCTTAGTATGCTTATAAACGTTATGCTTTTAAAAAAACATA TATTTCAGCATTCTACAGAATAGCGCTCCGCAACGCATACGTCATAATTA TTACTTTTCACTTCTTTTTGACATTTGTACGAAATGCAATCCCACAATTC AATGCGGCTCAATTAAAGATACGTGCAAGTTGTTGTATACAGCTTTTGTG AAATGATGCAATTAACGTGAATAGAGATTTTTAACTCAAAGGTTGACAGG ATTGGAACTCGTACAAACACATCGAAAGTAATGATTAAGTCAAAAATGAA ATCTATTTTAGATTCAGTGCAGTGCGCTATTAACTTCTCCAATTTTAACT CGTTCTCTTTCCCATATTACGCAGCAATTTGGACGATACAACGAAATCAG TTTATAAAGAGAACGTTCGATTAAACGAAGCATTGACTTATCATATAAAA GCTGGTGAAGAACTATCACAGGTTTGTGTTGACTACNCCCCTGTTACGCA GCAATTTGGACGATACAACGAAATCAGTTTATAAAGAGAACGTTCGATTA AACGAAGCATTGACTTATCATATCAAAGCTGGTGAAGAATTATCACAGGT TTGTGTTGACTACATTATACTTAAAATCTATCACTTAGCAAAAACCTTCA AGTTTAAAAATCTTGAAAGATACTCCCACAAAACTGATGCATTTAAGCTA CCATCACAGCGTTACTGCAAATTATACTTAAAATCTATCACTTAGCAAAA ACCTTCAAGTTTAAAAATCTTGAAAGATACACCCACAAAACTGATGCATT TAAGCTACCATCACAGCGTTACTGCAAATTGTTCAAATATTTTTTTTTAT TTGACATTATGTTAACCACCCTGGACTTTTCTTCCTCAACATATGGTAAC CACCCTGGATTTTTACACTCAAGAAACCGGACCACCCTGGATTTTTTATC TTCCATATCACCCTGGACGTCACACCTCCCCCAACATAGGGGGTACACAC TATTTCTGGAATAGCCAAATGCGTGTATACACCAAAGAAGAGTTGAACCA GGGCTTTCTCAAAAATATTCACCCTCCCCTCGTTGAGGTCATGTCAAGGA CTTGAAAAATGGTTCTTAATGCCTCTCTGCTGACTGTTCTGAAATAAAAA AACCTATATCCAAGGGAAAAGAATGGCGTACTCTCTACATGTTTTTTTTA TAAGCAAGTGTCTGCCCCTTGATCAGGCTCGTGTATGCATAAATTCTCAA AGCATCCAGGCATAGCTTTTGCTAATTATATGCTTATGAATCATGCTTAT CATTCACCCCGAGCCAACTTTTTAGTAAATTTTCAGAAACTTTGTAAACA TTTGTTCAGATTTTGGGAGCAGTGGAATGTAGCTAGCCGTGGAATGTCTT TATTTTTACTTGACCTCTACCAAACCTTTTTAAACATATAAGAAATGACA ACTTGAAAAATATTCCAGGCTGACATATATGCTTATGTTCTGCTTACAAA TTCTGCAAATACGAGTCTTAATATGCTTATAATCGTTATGCTTATGAAAA AATGTACCTTCGGGTAGACATCTATCTACCTATATGAAAAAGGAGTCTTT GGTCGCCCCCCCCTTACGTGTTGCAAACCTACTTCAACTATAGAGATTTC TTCTTTTCAGCACAAAGAAAATTTGGAAGAGCAGAACAAGAAATTAAGCA GTGAAAAAGAAATGAACAGCCTCATCGTCGAAGAGAAAGTCATCGAAAGC AAGAAAATTAAAAAAGCTAACAGCTCGGTAAGAATGCTGTAGAAATTCGA AATTTGTCATTCTCAGTGACCGTCCTTTTTGTTTTGTTTATTCGGCAATC CCCTAAAATCAATAACGCGTTTTGAATTAAATTTTTTTGATTTTTGAAGA AAATAATTAAAACTAAAACATAACAAAAAAGGACGCTTAGCTCTCGCTCT TATTTAACCTGTTATTTGCCATATCTTAGTTAAAAGACCATTTCAAGACC GATCCAATTTTCAAAATCTGGAAACTTATATTACCGGGAATATGATTTAT TTTTGACGTATCTTTAATGTCATTTACTTTACAATTTTTCCTTTAATTTC ATTTATAGTAAAACAAATTCAAAAAAAAATTACGATTTTGAATAATCTTG ACATATTAACAGGCCTTTAAATGGCCAAAAATGCCAAAGAAACTTTTCTA ATTTTTGCCTGTAGTGCGAATCAGGACCCCCAGAAGGGTTCGGCCAATTT TGGACTTCGTCTATTTATTATTTGTATCCCATTTATAGCTTCAACAAAAA GTTGATGACCTTGAGAAAGCATTGACAGAAGTGATGTCGGAGAATAATCA AAAGAAAACATCCTTAGTTCAGAAACATAATCAAGAACAAGAGGGAAATA AGTAAGTTGGAATTCTACATGGTACTATGTTACAGGGGTCATGTTACAGA CTGTGGTGCAGTGGTAGAGCATCCGGCTACGGTTCGCAAGGTTGTGGGTT CAATCCCTAGCTTGGTCATACCAAAGATTCCAAAATGGTACTTGATGCCT CTCTGCTTGATGCTCAGTAATTAAGATAAGGATCAAGGATGAGTGGAGCG AGCCAGGGAAAAAGAGTGGCGCCCTCCCCTACCTTCGGGTAAATAGCTAT CGAAAGAGGAGCTATCGGGTCGCCTCTGACAGCAGTCACAGACTTACTTA AATTCTCGCATCGCTGAGATTTTTTAGATACACAATGCTTCTCGTGCTTG TTCTGATTTTTTGCACAATTAAGTAAAATAGTAATTCCCAAAATATGATA GAGGCCAATTTTCGATTAAAAATCTTTCCGGCCGCCAGAACCTGAAAAAG CGGTTTTTCTGGATTTTCTCGAGATTTTATCTTTTTTTTTTCCTGACTTG TTTATTTTGAATTTAATTTTTTTTGTTGAACAGACGGGTAGGTCCATTAA AGTATCACTTTTTTCATTAATTTTTATTAATTAACTTTTACAGAATGGAA ATAGCACGGCTACAACGTATCATTGAACTAAAGAATAAGGAGATGAGCCG TGTCAAGAAACTTGCCAAAAACATCCTCGATCAGGTAAGACAATTAACTT ATCATTTTCTTATTTGTATGGCTCTTAAAATCAGAGCTTGGCATGGGTTT ACGGCAACACTGTTTTACCGACGAGTTCTTCGACAGGTTTTGAAGGATCC TGTAAAGCCTCAACTCGTCGTAGTCATAGATTTATAAAGCCCGAAGGGCT AGATGTCGTGCTTTGGCTGAAATGTGTTCAATATGCTGATGACACGACTA TATATCGCCACACCAAACCAAACGAGCTTGAAAATTGTGTCACTGAAATG AACTCTGATATTAGAGTAATTGAGAAATGGTCGCTGGATTCGAACTTGAT ATTTAACGCCAGAAAAACTAAATCGATGCTCTTTGCCACATCTCAAATGG CAAGGAGGCATGATTTTGAATTCGAAATCAAGTCAAATAACGAAAATGTG ATTGAGCGTGTTCCCCTATTCAAGCTGTTGGGAATCATCTTCACCGAAAA CCTAACATGGAATGAACATGTCAAAAAAATCGTCACTAAAGCATATGGTA CGCTGAAGAGTCTATCACTCATCAAACGATATTTACCATACCGTGTACGA CGCCAATTGGCAGAATCTCTTGTATTGAGTAAANNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNTGACTTTATTATATTTCTAGTTCTATGAAGTTTTTTTT CTTTTCTATTTGATGTTTAATTAGTTTCAATTAATTTAATTTAGATAGTT GATAGCTCACTGGTCGTGTTTTGCAAGGTCCAGTACACTTTTACACAGCC TTCGGTTTGCAATCTATGCTAGTTTTGCTCATAATATCTTACGCTCTGTC GTGATTCTATCTCACCGAGTTCTTAGATCTATTTTGTCGCTTACTTTATC TCTAGCCATCAATAGTACTTGAGCCTTAGTCTAGTCTAGCTTATAACATT ATGTTAGTATTTTTTTTTTAAATATATTCGTTAATTTTTTATAATAGCAC ACATTGCGATGGCCTCAGCTAGCATACTCAGATACTCGGATTTGTTTAGG TTTTAGTCTAGCTCTATCACTATTCACATTTTACCCCTCAATCCTAATCT TTTATTCATCATACTAGCCCACCGCTTCGTCCCTATCTGTTTGTCTATAC NTTACAGAATGGAAATAGCACGGCTACAACGTATCATTGAACTAAAGAAT AAAGAGATGAGCCGTGTCAAGAAACTTGCCAAAAACATCCTCGATCAGGT AAGACAATTAACTTATCATTTTCTTCTTTGTATGGCTCTTAAACTCAGAG CTTGGCATGGGTTTACGACAACACTGTTTTACCGACGAGTTCTTCGACAG GTTTTGAAGGATCCTGTAAAGCCTCAACTCGTCGTAGTCATAGATTTATA AAGCCCGAAGGGCTAGATGTCGTGCTTTGGCTGAAATGTGTGCCGAGGTT AGGTAGGATTCCTAACTGAAGTCTGTCTCAAAATAATTTGCAGCTGGAGA CAAAAATGGCTGTAACTTTAGATAGAATACGAATCAAGTTGTGAGTGGAA TATTATCAAGTAAAAAATTTGAGAAAAAAAAGGAAAATGAAAATGAAAAA TGAAGAAGAAAAAAAATCAACTTCTTGTAGAAATGTGGTATAANNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NCAATCAAAAGATATCAAACAAAGTTTATTGCTGGTTGATCGACAAAAGG CTGTTTTTTGTCGTTTTTTACTACTTTATAGAGTCAACCAGCAATAAACT TTATTTGATATCTTTTGATTGAATGAATATTTTTTTGAACCATTTACTTG ATAATATTCCACTCACGAATATCTTTTTAACGAGCACAAAATCGCTACTT GATTCGAATTCTATGAAAAGTTACAGCCATTTTTGTCTCCAGCTGCAAAT TATTTTGAGACAGACTGTAGGTCACGTGACATTACAATAGAATTTCAGCG CTTGACCAATCTTTGCAGGTTTTCGAAAACAATAGCAGCAATATTCTTTG CCATATTCACTTTTTTTTTGCTTAAAGCACGACATCTAGCCCTTTGGGCT TTACTGAAATCTGTAGTCGTTGTCTTGCTTTTCAATCAATCTTTTCATTG AGTATTATTAAAAGTCCACTCCTTCTTCACTATTGCGTTGATGATGTATT CGCATACAATAATAATCTCAATAATGCACGATAAAAAGCTGACATTTTTC AATATATTAAGTTCTCTCTCTTTTTCTCTATATTAAGTTCAAAAGTGACA ATGACCGGGGGGTAAATTTCCAAGAAATGTTATATCCTCCACCTCCACCC CCCCCCCATATTCAAATTTTTTTCTGTATAAGCCCATTGCTGCTCATTAC CGTGAAGACACCTAAAACGTCGCTTTTCTTGTGATACGTTTTTTTAAGAA ACTAAGAAACCAAGCAGCCTCTCAATGTTTCTTAAGAAATCGGCTTTTTG AGCCTTAAATGTTTCTTACATGTTTCTAAACTTTTTGACATAATCAGCCT CGTGTTTCTTAAATTTTGCTTCTTTCAAAAAAAAAACCGAATTAAAAAAC TTTATTTTCTCATTCTCAGCCTCAGCATGTTTCTTAGATGTTTCTTAGTT TTAAGGCATTCTGAGCCTCGTGTTTCTTAAAATTGTGTTTCTTTAAAAAA AAAGTGTAGCTGTCGGTAACTTTTAAAATCTATTCATGGTAAGTTTGCAC TCTTTTTTCTTTTACCTATAACTTTTGAAGGATTTCTTCAATCTTTATAA ATTTGGTATGTATCTTTGGAGAGATATTTCTCAGTGAAACAATTCGAAAT AAAAAATTCTTCAAAAAAATTCTAAAAATGAAAGATGAAAATAAGGAAGA AAAAAATGAAGATCTTATGTAAAAGTGCTATAACTTTCATTTTCACTGGA GAGATTCTTTGATCTTAGGAGGTCATCACTGTGAAGAAATTTCACTAAAA TATTTATTCAATATAAAGTTATGATACAAAGTTAACAAGTGATTGACCCC AAAAAACAAGATCTTCATTTTTTTCTTCTTCATTTTTATCTTCATTTTTA TAATTTTTTTAAAGATATTTTTATTTCAAATTGTTCCACTCTCCGCACTC TCCCACACAATCTTTCCAACGATACCAAATTTAAAAAGATTGAAGAATTC CTTCAAAAGTTATAAGTAAAAGAAAAAAGAGTGCACACTTATCGTGAACA GACTTTTAGTTTTGATTATTTCATTCCTCTACATACGTGTAATCAAAAGG TCTTCAAAATCATCTTTTACAGCGTTCAGATGTCGAAAAATTCTTTATCG AATCATTGGAAATGGTCAAAACTGAAATCATCAGAAATCGGTAACCGTAT TTTTATTTTTCTGAATCAACTTTTTTTATAAGATTATTCAAAGATAACTT AAAATAATTGTGGCTAGAATATTGATGGTCACACAATTATGATCATTGAA TGATAAATAGAACGGTTATTTTCAATTGTAGACCCAAATTCAATTCAGTT TTCGTAATTTAACACTGTTATTCAAGTGATAGACAGATTTTATTAGCGTG TAATCAAATTTCAATATTGTATTTAATATATGTACGCTTAATTATCGTAT CAGCTGATATAACAACGAAAGTGTTTTTCGATGTCGAAAGCTCCTTTTAC ATAAGTCACGTTTTGTATCCCAGTTTGCAGTGCTGGAAAATTTACCACTA GAAAGTTATCAAACGTGGCTTTTTACCGACAGGTTTCAAAAACACCAAAA TTGTGTACGAAAGTAACCTTTGTTATACCTCTAACCTTTACACCACCCAG GAACTAGAAATAATCATAAAAGTTATGAGGGAAACACCAAGGCTACGATT AGCTCACAATAAAACCTTCCTGGGTATACGGTTAAACGCTTTTTCGATCT ACGAAGGCAACGAAAATATCTTTTCTTTTATCATGACAGTTCTCTTGCAA TTGCAGGAGGATAAAAACGCCATCAGTCGTGTCACGCACGGCCAGGCAAA ATGCCGAATGCATATCATCAATTAATGATATTCATGACGTAATATTATGT ACGGAAAGACCCCGGTTTTTGCCAGTAGTGGCAAATTTTATACAACTTTT GTCTAGTTTAAATTTGCCACTACTGGCTGAAACCGAGGTATTTCCGTAGA AAACATTACGTCATGAATATCATTAATTGAGATTAAATCTCTAACGTCGC ATCTTAAAAATAAATAAATTTTGCTGTCATTCCTTCCCTGGAAACTAGAC CCAATTCATTTGTAGTGTTTAGGATTAAGACCATGTTCAGACGCTACGGT TCCGTTCCGGAACAAGTGCAAACGTCAAAATTCGGAGCGTCAAAAAAGAG GACGTTACAAAGCAAAATATATCGAAACAGTTTCGCTCCACTTTTTTTAT CGTAACGGAACTGCTCTGTTTTCTTGCTCCGAAACGTTCCGAAACCAATA TGAACACATTCGATCCGTAACGCAAATCATACCGGAGCGAAACGGAACAG TAACGTGTGAACATTGTGGAATAGATGTATTACTTCTTCGGAAAAGAAAT CTTTAATGTTTTTTTTTCAGTGCGCAATATCGACGAGACGCTGAAGTAGC ATACAATAAAAGAATGACCGAAGCACATTCTGGTCACTCTGATTATCCCA AAGTCCGCACATTTCGTCATCTAAAGAACAGCACTAATTCCGTGTACGCA GATCTACGCGCGGCCGAACGGTGGGATGGGTTTGACGCGTCGGTTGATCT TTCAGAATTAACATGGGAACAGAGAGAACAGGTTCTTCGCTTGTTGTTCG CTAAGATGAATGGCCAGAAAACGTGAGTTATAATTTGAATTCCGTAATTA TTTTTCATGCTTTCGAACTTTTTAGGTGTGAAATTTTAACTTATGGGAAT CTAGAAATCGGAGCTTTCTACCACGAAAATCGAAAAATTGAAAAATTTCA AAAATCAGATTAAAAAAGATTTGCGTGATACAATGTCAAAATGTCTCACT CTCAAGCTCAAGGCTTTATTTAAAGGCTTATTTTTTTAAGGAAAGTATTA CTAAATATCTGCTATAATATTTCCTATAGATCAAAAGTCAGCAAAAGTAT ACTTCCACCCATCAACAGTAAGATGGACGAAACTAAAGCTCATCAACCGA AACCACCTTCCGTTCAAAAAGCTTTTCTCACGGAAGCCGATGATCCAAAA GAGGGTGTCAGTAGTGATGCAAGTAGGGTATTTTCAGCCACTGAGATCCT TGCTTTTACATGACTTTTATGACTTAGCAATTTTTAGGGTACTGATTATT TGTAATTAATTTTTTTTGAAAAGTTGTATATAATAGTTTGTGTATAGATT TAATCAGAATAGAATGTGATTTTATTTTATTACCTTGTAAAATAATTAAT TTTTTAATGATGGTTTAATTTATTTTTTGGTAAAGACTGATTCAAGGAAA AGTAATT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000328XLOC_000328Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000545-exon-sc0000002-1575043694:486238..486348TCONS_00000545-exon-sc0000002-1575043694:486238..486348Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1575043694:485778..485897TCONS_00000545-exon-sc0000002-1575043694:485778..485897Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1575043694:485293..485416TCONS_00000545-exon-sc0000002-1575043694:485293..485416Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1575043694:481940..482149TCONS_00000545-exon-sc0000002-1575043694:481940..482149Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1575043694:481188..481268TCONS_00000545-exon-sc0000002-1575043694:481188..481268Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1575043694:480973..481043TCONS_00000545-exon-sc0000002-1575043694:480973..481043Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1575043694:479478..479574TCONS_00000545-exon-sc0000002-1575043694:479478..479574Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1575043694:478172..478288TCONS_00000545-exon-sc0000002-1575043694:478172..478288Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1575043694:477548..477660TCONS_00000545-exon-sc0000002-1575043694:477548..477660Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1575043694:476865..476955TCONS_00000545-exon-sc0000002-1575043694:476865..476955Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1575043694:472659..472726TCONS_00000545-exon-sc0000002-1575043694:472659..472726Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1575043694:471177..471428TCONS_00000545-exon-sc0000002-1575043694:471177..471428Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1575043694:470542..470919TCONS_00000545-exon-sc0000002-1575043694:470542..470919Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1510915933:486238..486348TCONS_00000545-exon-sc0000002-1510915933:486238..486348Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1510915933:485778..485897TCONS_00000545-exon-sc0000002-1510915933:485778..485897Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1510915933:485293..485416TCONS_00000545-exon-sc0000002-1510915933:485293..485416Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1510915933:481940..482149TCONS_00000545-exon-sc0000002-1510915933:481940..482149Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1510915933:481188..481268TCONS_00000545-exon-sc0000002-1510915933:481188..481268Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1510915933:480973..481043TCONS_00000545-exon-sc0000002-1510915933:480973..481043Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1510915933:479478..479574TCONS_00000545-exon-sc0000002-1510915933:479478..479574Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1510915933:478172..478288TCONS_00000545-exon-sc0000002-1510915933:478172..478288Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1510915933:477548..477660TCONS_00000545-exon-sc0000002-1510915933:477548..477660Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1510915933:476865..476955TCONS_00000545-exon-sc0000002-1510915933:476865..476955Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1510915933:472659..472726TCONS_00000545-exon-sc0000002-1510915933:472659..472726Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1510915933:471177..471428TCONS_00000545-exon-sc0000002-1510915933:471177..471428Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1510915933:470542..470919TCONS_00000545-exon-sc0000002-1510915933:470542..470919Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1491911889:486238..486348TCONS_00000545-exon-sc0000002-1491911889:486238..486348Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1491911889:485778..485897TCONS_00000545-exon-sc0000002-1491911889:485778..485897Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1491911889:485293..485416TCONS_00000545-exon-sc0000002-1491911889:485293..485416Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1491911889:481940..482149TCONS_00000545-exon-sc0000002-1491911889:481940..482149Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1491911889:481188..481268TCONS_00000545-exon-sc0000002-1491911889:481188..481268Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1491911889:480973..481043TCONS_00000545-exon-sc0000002-1491911889:480973..481043Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1491911889:479478..479574TCONS_00000545-exon-sc0000002-1491911889:479478..479574Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1491911889:478172..478288TCONS_00000545-exon-sc0000002-1491911889:478172..478288Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1491911889:477548..477660TCONS_00000545-exon-sc0000002-1491911889:477548..477660Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1491911889:476865..476955TCONS_00000545-exon-sc0000002-1491911889:476865..476955Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1491911889:472659..472726TCONS_00000545-exon-sc0000002-1491911889:472659..472726Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1491911889:471177..471428TCONS_00000545-exon-sc0000002-1491911889:471177..471428Clytia hemisphaericaexon
TCONS_00000545-exon-sc0000002-1491911889:470542..470919TCONS_00000545-exon-sc0000002-1491911889:470542..470919Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:470542..486348 -
Expression
No biomaterial libraries express this feature.
Blast
BLAST of TCONS_00000545 vs. Swiss-Prot (Human)
Match: BBOF1 (Basal body-orientation factor 1 OS=Homo sapiens GN=BBOF1 PE=2 SV=3)

HSP 1 Score: 337.806 bits (865), Expect = 1.615e-107
Identity = 192/477 (40.25%), Postives = 319/477 (66.88%), Query Frame = 2
Query:  143 NDDVLKQAIANACLWESRLGTVEVAKNEYRDTTRTLLHENEKLQTQVSQTEKETVDVLSFLRDEDIKKNNTINKLQLMIXXXXXXXXXXXQGFIDDYTKQIETLQTSLTDKTNEVKLMQSELKLVKEFRRKRALMQKEIDDIKDNLFMNEKQHENALEKIERKFFDEKIRMQQEANRKISELAERAHNEAISNLDDTTKSVYKENVRLNEALTYHIKAGEELSQHKENLEEQNKKLSSEKEMNSLXXXXXXXXXXXXXXANSSLQQKVDDLEKALTEVMSENNQKKTSLVQKHNQEQEGNKMEIARLQRIIELKNKEMSRVKKLAKNILDQRSDVEKFFIESLEMVKTEIIRNRAQYRRDAEVAYNKRMTEAHSGHSDYPKVRTFRHLKNSTNSVYADLRAAERWDGFDASVDLSELTWEQREQVLRLLFAKMNGQKTSKVSKSILPPIN----SKMDETKAHQPKPPSVQKAFLTE 1561
            ++ V+ +A ANA LWE+RL   E+++ +YRDT+R L   NE L+ +  + EK+ + VLS+L+ +D +K+N I KL+  + + K+  ++EK      YT+QI  L+     K  E+ ++ +ELK V++F++++  +++E+DD+K+NL   E+ H+  L ++E +FF+EK R++QEA +KI  LAERAH+EAI  L+D  ++V+KEN  L +AL YH+K  + L ++ + L+E +  L  +KE+N L+V+EK+++  + +    +LQ+KV +LE AL+ +  E   +   L Q    E +  ++EI +LQ ++++K++EM+RVKKLAKNILD+R++VE+FF+++L  VK +I+ +R  Y++ A+ A+N +M  A +G ++YPK+RTF   ++STNSV  DL  AE+W   + +VD+ +LTWEQ+E+VLRLLFAKMNG  + K ++S  PP+     S   ETK    +     K F+T+
Sbjct:   25 DESVVDRAKANASLWEARLEVTELSRIKYRDTSRILAKSNEDLKKKQCKMEKDIMSVLSYLKKQDQEKDNMIEKLKQQLNETKEKAQEEKDKLEQKYTRQINELEGQFHQKAKEIGMIHTELKAVRQFQKRKIQVERELDDLKENLRNTERIHQETLRRLESRFFEEKHRLEQEAEKKIIMLAERAHHEAIVQLNDAGRNVFKENDYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKKLAKNILDERTEVERFFLDALHQVKQQILISRKHYKQIAQAAFNLKMRAACTGRTEYPKIRTFDGREHSTNSVNQDLLEAEKWTHIEGNVDIGDLTWEQKEKVLRLLFAKMNGCPSRKYNQSSRPPVPDYVVSDSGETKEFGDESKLQDKIFITQ 501          
The following BLAST results are available for this feature:
BLAST of TCONS_00000545 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
BBOF11.615e-10740.25Basal body-orientation factor 1 OS=Homo sapiens GN... [more]
back to top