Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000541 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000541
Unique NameTCONS_00000541
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length459

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000541 ID=TCONS_00000541|Name=TCONS_00000541|organism=Clytia hemisphaerica|type=transcript|length=459bp
gttaaaaacaaaattgccatttttaaaTAACAGAATAGACCTTAAAATGA
CATAAATCAAGACAATACCAGTACTTTTTGCAAAACCATCATGGCAGGTG
TGGAGCCACAAAAGCTTATTGTTTACAATAAGCATTTACCCTACAGTATC
AAAAAGGAAGCTGAACGTCAACTGAGTGAAATTAAATACAACTTGTCCAG
AGCTGTCATTCTTCAAGAAATCAATCCTGGTCTGTCAATCTGGTTTGATC
GTTTCATCATATATCTCAGATTGCATGGCCGTAATTTCACAAAAGAGGAC
CATGTCCTTTTCATCAATCTTTTCCTCAATCTTATGGAGATGCCAGAGAT
GGGACCATCTGGTATCAAAGGTATTGCTATGCTGCTTCAAAAGCTGTTAA
AAAAGGAGGAGCTACTCACAAGAAATGATTTGACCATCTCATGGCGACCA
TTGTATGAA
Run BLAST on NCBI

transcript from alignment at sc0000002:441269..442205-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000541 ID=TCONS_00000541|Name=TCONS_00000541|organism=Clytia hemisphaerica|type=transcript|length=937bp|location=Sequence derived from alignment at sc0000002:441269..442205- (Clytia hemisphaerica)
GTTAAAAACAAAATTGCCATTTTTAAATAACAGAATAGACCTTAAAATGA CATAAATCAAGACAATACCAGTACTTTTTGCAAAACCATCATGGCAGGTG TGGAGCCACAAAAGCTTATTGTTTACAATAAGCATTTACCCTACAGTATC AAAAAGGAAGCTGAACGTCAACTGAGTGAAATTAAATACAACTTGTCCAG AGCTGTCATTCTTCAAGAAATCAATCCTGGTCTGTCAATCTGGTTTGATC GTTTCATCATGTGAGTATTGTGGTTGAAAAGCTTAGCGATAATAGCTTTT TTATTGCAATCAGGCTCTAATATTTGTAGTTTATAGGGAGAAGGACTGAC TTATTTCATGTTGTTAAACTTCCCCTTTTTGTGGCACTTCTTAGATCCTG TTTTGAAGGCAAAACTTGGGATATTATATTTATAAACACCCTCTATGAAA ATTCCAAAATTGCCACATTTTAGTAATTTTTCATTGCCTTTATTATTTTA GATATCTCAGATTGCATGGCCGTAATTTCACAAAAGAGGACCATGTCCTT TTCATCAATCTTTTCCTCAATCTTATGGAGATGCCAGAGATGGGACCATC TGGTATCAAAGGTATTGCTATGCTGCTTCAAAAGCTGTTAAAGTGAGTGA ATATCCATGATGCATGGTACATCTTATATATGTTTTACATTTTACTGAGT CAATTATAACCTCTATCTAATTAATAATTGCAGTTCTTGTGTTTGTTGCT TTCCCGCCATCAATTACCTTGATCGCATTGGGAACTTTACGACCCTCGTA TAGCAAATTTTTCTTATAAAATCATACAATTTTTATAATTAAGTATAATC ATAACAAATATTTTCTTGGTGATTGACAGAAAGGAGGAGCTACTCACAAG AAATGATTTGACCATCTCATGGCGACCATTGTATGAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000326XLOC_000326Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000541-exon-sc0000002-1575043694:441946..442205TCONS_00000541-exon-sc0000002-1575043694:441946..442205Clytia hemisphaericaexon
TCONS_00000541-exon-sc0000002-1575043694:441564..441704TCONS_00000541-exon-sc0000002-1575043694:441564..441704Clytia hemisphaericaexon
TCONS_00000541-exon-sc0000002-1575043694:441269..441326TCONS_00000541-exon-sc0000002-1575043694:441269..441326Clytia hemisphaericaexon
TCONS_00000541-exon-sc0000002-1510915933:441946..442205TCONS_00000541-exon-sc0000002-1510915933:441946..442205Clytia hemisphaericaexon
TCONS_00000541-exon-sc0000002-1510915933:441564..441704TCONS_00000541-exon-sc0000002-1510915933:441564..441704Clytia hemisphaericaexon
TCONS_00000541-exon-sc0000002-1510915933:441269..441326TCONS_00000541-exon-sc0000002-1510915933:441269..441326Clytia hemisphaericaexon
TCONS_00000541-exon-sc0000002-1491911889:441946..442205TCONS_00000541-exon-sc0000002-1491911889:441946..442205Clytia hemisphaericaexon
TCONS_00000541-exon-sc0000002-1491911889:441564..441704TCONS_00000541-exon-sc0000002-1491911889:441564..441704Clytia hemisphaericaexon
TCONS_00000541-exon-sc0000002-1491911889:441269..441326TCONS_00000541-exon-sc0000002-1491911889:441269..441326Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:441269..442205 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.509678 0.214511 0.293351 0.140934 0 0.582875 0 0.0876792 0 3.05889 2.68357 4.24068 0 0 1.0178 3.86865 0.951403 2.67845e-09 0 2.47424 1.77951 3.25992 0 1.1812 0 0 0 0 0 0.186413
Blast
BLAST of TCONS_00000541 vs. Swiss-Prot (Human)
Match: PSME4 (Proteasome activator complex subunit 4 OS=Homo sapiens GN=PSME4 PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 4.288e-26
Identity = 65/120 (54.17%), Postives = 85/120 (70.83%), Query Frame = 1
Query:  106 PQKLIVYNKHLPYSIKKEAER--QLSEIKYNLSRAVILQEINPGLSIWFDRFIIYLRLHGRNFTKEDHVLFINLFLNLMEMPEMGPSGIKGIAMXXXXXXXXXXXXTRNDLTISWRPLYE 459
            PQK IVYNK LPY+ + +AE   QL++IK NL RAV LQE+ PG   W  +   Y+RL+GR F+KEDHVLFI L   L+ +P++  S ++G A LL  LLKK+ELL+R DL + WRPLY+
Sbjct:   28 PQKEIVYNKLLPYAERLDAESDLQLAQIKCNLGRAVQLQELWPGGLFWTRKLSTYIRLYGRKFSKEDHVLFIKLLYELVSIPKLEISMMQGFARLLINLLKKKELLSRADLELPWRPLYD 147          
The following BLAST results are available for this feature:
BLAST of TCONS_00000541 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PSME44.288e-2654.17Proteasome activator complex subunit 4 OS=Homo sap... [more]
back to top