Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000535 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000535
Unique NameTCONS_00000535
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length7172

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000535 ID=TCONS_00000535|Name=TCONS_00000535|organism=Clytia hemisphaerica|type=transcript|length=7172bp
gttaaaaacaaaattgccatttttaaaTAACAGAATAGACCTTAAAATGA
CATAAATCAAGACAATACCAGTACTTTTTGCAAAACCATCATGGCAGGTG
TGGAGCCACAAAAGCTTATTGTTTACAATAAGCATTTACCCTACAGTATC
AAAAAGGAAGCTGAACGTCAACTGAGTGAAATTAAATACAACTTGTCCAG
AGCTGTCATTCTTCAAGAAATCAATCCTGGTCTGTCAATCTGGTTTGATC
GTTTCATCATATATCTCAGATTGCATGGCCGTAATTTCACAAAAGAGGAC
CATGTCCTTTTCATCAATCTTTTCCTCAATCTTATGGAGATGCCAGAGAT
GGGACCATCTGGTATCAAAGGTATTGCTATGCTGCTTCAAAAGCTGTTAA
AAAAGGAGGAGCTACTCACAAGAAATGATTTGACCATCTCATGGCGACCA
TTGTATGAATTGGTGAAATCCATCAAATATTCAAAACTAACACCAGTTGG
TTTAGAAAGATTTCCAAGCAAATATGTTGAAACCATACTTAGTGTTATAA
AATATGCTAGAAgttatttcCCAGTGGAAGCAACACAGGAGATGCTTTTG
GAATTTCGACCTCTGTTATGTCCAACTGATGCTACAAAAACAAACGCTGC
CCTTTACCTTAGCCTTTTCTTGCCAACCAAAATTGAAAGAGGAACTGAAT
CGAAGACCTATCTacttTGGTTAGATGAGTTGATGGAGTATTGGTTCCAC
TGTACAACCAGCAACGTTGCTAGTGTGTATTTACGGCTGTTTTCAAGACT
AGCTGAAGATAATGCTGGCTATCTTGATTGGAGTAAATATATCAATAGGa
tcttcaatttcttcttctgtAAATTGAGTCTACCTATCAATGGCATGAGA
AGAGGATTCGATTTGAAAGGCACCATGAGCAATTCTGCTGACTTTGCAAA
ATGGTTTGTTTACATGATGGGTGGTGAACAGGGGACTGTCATCTTTGACA
AGCTGGAGAAGTTGTTTGTCACGCTGAAATCCTTTTATCATCCTTCCAAT
TATGATAAACATTCGtcgGTGCTGCTTGGATTTTTGAATGCTTTAACGAG
TGCATTTGTGATGAGGTTGAATCATGAGAGATATCGGAAACCGTCGTGGA
CAGTAGACATtcctgaaaaatcaaaaattactgATGCAGAAATTGAACGT
TATGTAAACATTGTCAAAGAGGTGGCCTTGCTCTCTGTGTACAGCAAACA
AGGAAGTCTACAGGCAGCGTTGACCCTTCAAAACCTAGCTCTTCTCAGGG
CTGATTTGGTCATCCCACAATTACTTCAAAGCACCTTTGAAGCCTTGGAG
ACATTAGTTGAACCCCATCAAGTCACTGCAACTTTGATGTGTATCACTTC
AGTAGCACGTCCTCTTGCTTCAGGAGGGGGCTGTTTCCCATCCGCACCTA
CCAACATTTTACCTCTCTTACGTCTCGTCTTGCCTGGTCTCGATCCGAAC
GATTTCCGTAAAAGCATGTGTGCGTTCAACTTCATTTCGGCTATTGTCAG
TCTAATTCCATTGGTTAATTGTATGCCTGCAGTGCATGCTGGTATCGAAA
TGTCTGAAGTGGAAAAGGAGTTGTGTTTAGCTTCTGAGCAATTTGAAGAC
CTTATTCTCCAATTCTTTGATAGATGTTTCGTGTTGGTTGAAAACAGTAC
TACAGAGAATATCACTCAACAAGACAGTACCCTCGATTCAACAGCCAGTG
CCCAAGACAGCATGCTTGGTAGAAGTCTGGTCTCTACTGTCCAAGTGGTT
TTTATGCAGTGTTCAAAAGCTTTATTCGAGGTAGCATTAGATGCGTTGTT
TCGTTTTGTATCGTCGCGCGTTCTTGAGGTGGACGTGGCAGGAAAATTGG
TTTCTGACATGTGCCGTGGTGCTGTTCGTGCACGGCCAAAAGAAACGTTG
AAAAAGATGCTTCCTTACATCACCAATCGTGTCATCAACTTGGCCACAGT
TGAAGGTGTTCAGAACGAAGAACATGTCGATCCTGAGCTGTTATGGTATC
TAGAGATGCTAAGTGAACTCGGCCGTTGCAATGGTATGGAGTTGTTGCAG
TACAAAGAGGTGTTAAAAGAAGTCATCAAACTTACCATTCACATGAAATG
CAAGAAAGCCTACTCTAGAGCGGCCCAGCTTTTGAAGTCAATCTTATGTT
CTGTATCGGAAGTGTATATTACCGAATGGATGAGCGTACATTATGGTTTT
GATCTCCCTCCAATGGAACACTTCTACATCAGAGACTGGGGAAAGCCATA
CCCTCTTGACGAATTGAATCCTAAATGGCACTCACCTAGCCAGGAAGAAA
TGCAATTCGCAGATGAGTTGTTGAAAGAGTTTCTGGTACCTGAGCTAGAA
TTACTGAAAGAAATCATCAACGGGAGAGTACTTACAAGAGATGAGATCCA
CCAACACTTACAGATCATTGCAACTTGTTTATATGGTGCTGCCAATCTCT
TACCGAATTGGACGGACAAGCGAGTGGAAGGTGTTGCTCTGCCGACGCTT
GTCTCCCGTGAATGTATTTTGAATACAGTTAATCTATCAGATGTTGAAAA
ATTCGTTTGTTGTATCAATCGTAAGGACGTGGTCTATCAAATGCACAACT
TCTTCAATTTCATGTCAAAGACACACGAAGATGATACGAAGTCGTTTCGC
ATGCTGGCTCGTATTTACGACATCTTGGTTCTTCATAACGGTGTCCACTG
GAGTGACTTCAACCTTCGCTGGAAAAGTGCTTCTGCTGTTAAAAAAGCAC
TTGCAGATAGGTTACACGGCAACAAGATGCACGTGCGAGCCGTCCAAATC
GAACGCGTACAACTCCAACATGACATGCGAGTATTAGACCAACACGCTGC
CGCTTTTTCCGTCACCGACAAAGTTGTCATCGATGATCTTCTTTTCATGT
CGACCAGCGAGTATGCTGAAGTTCGGATCCATTCTCAGAAGATTTTATTC
GGTTGTTTAGAAGCTTTTGATGTGGCGACTCGATACGTTTTACCAAAAAT
GCTGGAAAACATTCACCCGAAAGCGCAAGTCTCACACGAGAAATTGAAAG
GTACGCTGTATATTTTACAATATTCTCGCATCGTTTACATGCTGATTCAC
GATTGGAAGTTAATGGNATATTTTACAATATTCTCGTATCGTTTACATGC
TGATTCACGATTGGAAGTTAATGGCGTCGTCATGGATACCTATTGTTCAA
GCTAACCAATCGGAGAAGCCGTCCATTGTAAAACTGTTGAATTATCTGAT
CAGGAAGATTCAATCGAAATTTGAAACCATGAAAATCGAAAGAAAAATTG
GTGAAAGCGCCAGTAAAGTTGCTAAGCAGCTTCTGGAAACGAAATCACCT
GAAGCCAGAACATCTCTCTCTGATTCACCCGCCGATGATTCGGTTTACCC
TTCTGACAAGTTCATGAAAATGGGTCAGGATAAATGTaccaagaaaaatg
aagaaaatttggcaAATTACCGTCGTTTAGAACAAGATTTGAGTAAATTA
CTTCAAGATACCTCAatACACTGGCGATGTTCGGAGATGTGCACAAAGCT
GATGAACTTATTGTTGAATAATGAAGTCAAATCATGTCACGAAGTTATTA
ACACTTTCCTGAATCTGTTAGTCAATGACTCACACTTGCTTAGACAGGTA
AAGATTTATCNCAACACTTTCCTGAATCTGTTAGTTAATGACTCGCACTT
GCTGAGACagTATGCAATCCGTGGCATCATGGCTGTATTGTATCAGTACA
AACCACAATTCGCCAAACGAAAGTTGAATTACCCTGAGCACAATATCGAT
GCCAGTCCAGATGTTTTAATGAAACTAATGCCTGGAGATAACAGAACAGA
CAACCAGTGGCTTCAATATAACGACACAAATCCAATCAATTCTCAAGAGG
ACTTAGAACGGTTTTCATTTATCGATAAAACGCACTGGGGTTACCAGACA
TGGCCTTTAGAACTTGACATCCTATCAAACCAAGCTGACTTTTATACTAA
GATACGTAACAAAGACTGCTTATGCAAAGAAGAGAATTTAATTGTAGACA
CTTTAAATAACAGTGAATATCTTGAAAAATTCATCAAGTTTCATTCAATG
GAAGTCAAGAAAGGTGAAGACCGATTCCAACACATTCACTATACCTTGTT
CAAAGGTTTGTTCCGTAATTACGGGCCATCAATGTTCGAGCTTTTCCGCC
CGGTCGTCAATGATTTATTAGCGGGAAACAACGAGAGTAAACACCGGTTG
GCTATTGAAATCATCGCTGGCATGATTAGAGGCTCCAAACACTGGAATTA
TGAAAGTTTGACGATGTTTTGGGATTTCATGGTTCCTTTGCTACAgaatg
tttttgtttcaaatgtCATGGAAGAGACAGTCAAAGATTGGATCTTAGCA
TTGGTTGTCTCTACCgaAAGTCACGATCCGAACCGTTTCCATCGTCTATT
TACCATGCTTCTGAACAACCCTATCAACGGAGACGGCGGCTCACAAGGTG
ATACCAACCGATTATTTATCATACGAAAAACCCTTGGTCAGCAGGAATGG
AGACTGGCAAATGTCAATCATAACATGATGAAATATCTTCTCCCTCATCT
CACGCACCCGTTTCAAAATGTCCGCGAGAAAGTTGGAAGTTTGGTCTCTT
ACATTCTACTTTTCGACTTGAAATACGCCTCGCACACGCCCACTCTTTCA
CCTCGATGCGAAATGTTTGTTGATTACGTTTACGAAGACATATTGAAACT
TTACCAAATCACACTGGGTGAAATCGAGGCTCACGAACATCAGAACGAGG
CTATGGAAATTGACGGTGTCGGTGTCACAgaagaaacaaagaaattgGAA
AGGATGGCTAAAACTGTATTATCATTCTTGGTCAACAAATCTGCAAACTT
CCAACCAGTCAATAAAGCACTGTACCGCATCATTCCCTTGCTGTTGGTGT
TGGAATCAAGAGAAGATGATCCGGAATTGGTTGGCTTATGCAAATATACG
TTCCCTGCATTAGCATCAAAACAACTTCCAGATGATCTCGCTCAACCTGC
AATACAATCTATTATTCAGGTCTGTTACAACAAGAAATCATGGAATCTCA
GAAGAACCGGGCTTAACTATTTGATGATGATGGTCTTTCACAATTTATAC
ATTTTGGATGACGAAGCGACACGCAACCAACTTCAAGAGATGTTGATTGA
ACGCCTGAAAGACGAGCAAGTCGAGGTTCGTGAAATAGCTTCAAAGCTCT
TGAGTGGTCTGGTGCATTTTGGATATTTCTCAATCACTGAAGAATTACTG
TCAACATTCCACACAATGGCAAAGATCAAGATGAAGAAAAAGAGACATGG
AATTGAACTCACTCAAGCACAAACCGATAAAAACGTATTAGCATTGCAAG
TGAAACATGGCGGAGTCCTCGGTCTCTCAGCATTAGTCTTGGCTTTCCCT
TATGATGTCTGCACGTGGATTCCAGAAGTTGTCATCGATCTTGGCAATTA
TCTACATGAAGTACCACAAATTTCTGCCACAGCCAAGAAGACACTATCAG
AGTTTCGCCGAACACACCACGACAATTGGCACATTCATCAACAACAGTTT
ACTGATGACCAATTGTCTGCGTTGACTGATTTACTCATTTCACCAAGCTA
TTATGCTTAGAAAGATGGCTTGTATTGGAGACGGCGAGATTATGTAATTC
TAAATATGTTTTGTGATGGCGTTATCATAGCCAAAGGTAGATTGCATCAT
TAGTCTGGCAAACCCTTTGGGTGGACCAGCACGCTTCGGAGTGTCATACT
GTATGCTTCAAAGTAGTCTATACTAGTAGCTACGATTGATTTGTTTGTTA
TAGGAAAGTGTGTTAGACAGTGATTTATTGACTCAAGGAAAAATATTTCC
TGATATATATTTTTGGTTGTCAAATTAGCCAAGACTTTAGTAGCTTTTAA
ATTCATGATTAGATTTACGATTTTAGGTTTCACAATACTCCTTTCATGAG
GTAGAGAAAAACATATGTTGGCCTCGCTTCCACAATAATGAGAACTTTAC
TGACAGCTCTGCATGCAAGTTACTTACCCTCGTTAAAAGGAAAATGACGA
TAAAGATATCTTCAGAAGGAGGCCAAgaagttttctttttattgggcttt
tccagaattTTTCCGTAAACGCCCTATTGAGCACATTCATTTTCCAGTTC
CACaatcccctggatatcctacctGAAAAAATCACCCCTCGATATCCATG
CATTTTCTCCTGTACCCTTTGAATATACAGCATTTTGTTCTGtgccccct
ggatatccagacatTTTGTCTTGTACCACCTGGAACCATTTCCATCCTTT
AAGGTCCTACGCCCTGGATATCCAGATAATATTGAACCCCCTGGTTCAAC
ACCCCATCCGATATCCTCCATAGGGGGGACACAAACTATTTCTGGAAAGG
CCCATTTCAAGATAATTTTATTCACTATTTTGTATTAAGTGTTGGTATGG
TTTGAAAAAAGGGTTGTGTGGAAGCTTTCTACTTGACAATAATAATTTTG
TATGAAGAAAACAATAGAGCTATATtactattttatttatttttaggtAA
ATTTCCCTTAAATTAATATAGTTATTAATTTTAGtgcacttttctttttt
tctagatcttttaatttacaattttatagttttttaaaagCTAGTCCTAA
TTTTTATGAAGATACGCTTAGTAGATCTGTCCTTTTTAAAGACCTTTTTT
GTGTTCATTTTGATAATGTATGGATCTTCAGTTGAAAACATATCGTTTTG
TTTCTGACTTTTGTTTGCTTTGGGAATGAACAGAAACTAACTTGGATTAC
TATGGAGATTTATCACtacattttaattttcatttaaaaccGTTTTAATT
GTTCTCGTTTATATAGTCTTTAGGTAGATCTTTCAGCATTTATTGTTAAT
AGTATAGGCTTTTCTTTAGGGTAGCCTTGGTTATATACCTCTTAACTTTG
AAGCGTTTATCAAAACACTTgagattgtatattttttaattacttcaatt
tttgtttgatttttttgagtaattttctttgtctagttggtgatttcttt
tgattgttttttcctattgcac
Run BLAST on NCBI

transcript from alignment at sc0000002:418855..442205-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000535 ID=TCONS_00000535|Name=TCONS_00000535|organism=Clytia hemisphaerica|type=transcript|length=23351bp|location=Sequence derived from alignment at sc0000002:418855..442205- (Clytia hemisphaerica)
GTTAAAAACAAAATTGCCATTTTTAAATAACAGAATAGACCTTAAAATGA CATAAATCAAGACAATACCAGTACTTTTTGCAAAACCATCATGGCAGGTG TGGAGCCACAAAAGCTTATTGTTTACAATAAGCATTTACCCTACAGTATC AAAAAGGAAGCTGAACGTCAACTGAGTGAAATTAAATACAACTTGTCCAG AGCTGTCATTCTTCAAGAAATCAATCCTGGTCTGTCAATCTGGTTTGATC GTTTCATCATGTGAGTATTGTGGTTGAAAAGCTTAGCGATAATAGCTTTT TTATTGCAATCAGGCTCTAATATTTGTAGTTTATAGGGAGAAGGACTGAC TTATTTCATGTTGTTAAACTTCCCCTTTTTGTGGCACTTCTTAGATCCTG TTTTGAAGGCAAAACTTGGGATATTATATTTATAAACACCCTCTATGAAA ATTCCAAAATTGCCACATTTTAGTAATTTTTCATTGCCTTTATTATTTTA GATATCTCAGATTGCATGGCCGTAATTTCACAAAAGAGGACCATGTCCTT TTCATCAATCTTTTCCTCAATCTTATGGAGATGCCAGAGATGGGACCATC TGGTATCAAAGGTATTGCTATGCTGCTTCAAAAGCTGTTAAAGTGAGTGA ATATCCATGATGCATGGTACATCTTATATATGTTTTACATTTTACTGAGT CAATTATAACCTCTATCTAATTAATAATTGCAGTTCTTGTGTTTGTTGCT TTCCCGCCATCAATTACCTTGATCGCATTGGGAACTTTACGACCCTCGTA TAGCAAATTTTTCTTATAAAATCATACAATTTTTATAATTAAGTATAATC ATAACAAATATTTTCTTGGTGATTGACAGAAAGGAGGAGCTACTCACAAG AAATGATTTGACCATCTCATGGCGACCATTGTATGAANGCGATAATAGCT TTTTTATTGCAATCAGGCTCTAATATTTGTAGTTTATAGGGAGAAGGACT GACTTATTTCATGTTGTTAAACTTCCCCTTTTTGTGGCACTTCTTAGATC CTGTTTTGAAGGCAAAACTTGGGATATTATATTTATAAACACCCTCTATG AAAATTCCAAAATTGCCACATTTTAGTAATTTTTCATTGCCTTTATTATT TTAGATATCTCAGATTGCATGGCCGTAATTTCACAAAAGAGGACCATGTC CTTTTCATCAATCTTTTCCTCAATCTTATGGAGATGCCAGAGATGGGACC ATCTGGTATCAAAGGTATTGCTATGCTGCTTCAAAAGCTGTTAAAGTGAG TGAATATCCATGATGCATGGTACATCTTATATATGTTTTACATTTTACTG AGTCAATTATAACCTCTATCTAATTAATAATTGCAGTTCTTGTGTTTGTT GCTTTCCCGCCATCAATTACCTTGATCGCATTGGGAACTTTACGACCCTT GTATAGCAAATTTTTCTTATAAAATCATACAATTTTTAATTAAGTATAAT CATAACAAATATTTTCTTGGTGATTGACAGAAAGGAGGAGCTACTCACAA GAAATGATTTGACCATCTCATGGCGACCATTGTATGAATTGGTGAAATCC ATCAAATATTCAAAACTAACACCAGTTGGTTTAGAAAGATTTCCAAGGTT TGCATTTCTGTCAGAAAAGTTAATCACAAACTTCAAAAAACCCAAATCAT AAAGTATATGTAAACAAAACAAATAGCTTAATTTGTTATAACGGGTATTA GCGTTACATTGTAAATTTATTATTATCAATTTTTTTAATTTTCTAAACTT GATTTACAGGACATTTTTATTTTTATTTTCTCATTTGGTGTTGATGCTCT TTCAAACTGATCCCATAACATCTTTCTTTGTCTTTTAGCAAATATGTTGA AACCATACTTAGTGTTATAAAATATGCTAGAAGGTAAGAAATATTATAAT GTTTCACTTTTCTGTACAAAGCACGGTTTTTCTTTGTTATTTTACTTTTG TTATTTTACATGAAGGGTTTTCCCAACTCATCAGTTTATCATAAAGTGGT TTGTATTATTTTGAAGGGATTTTTAAACAACATTTGAAACAATGAAAATG ACGATAAATTACCTCGTTACCTCAGACATTACCCTCAGGAACAGGAGAGA TTTGTTTATAAATCTCTCTGAAATTTCCTATCCAAATTTTTCAGTAGTAA TTTATATAATATTGTGATATCAAATTTTTCAGTTATTTCCCAGTGGAAGC AACACAGGAGATGCTTTTGGAATTTCGACCTCTGTTATGTCCAACTGATG CTACAAAAACAAACGCTGCCCTTTACCTTAGCCTTTTCTTGCCAACCAAA ATTGAAAGAGGAACTGAATCGAAGACCTATCTGTAAGTATCACAGTTAGC AATTTTGACTATAGATTATTGTGGCCTGTAGCTCAGTTGGTTGAGCGTTC ACATTATAATCCCAGGGTTGTGGGGTCAATCCCCGGTCACCGCCGAGTTT TGAGCTTTGATTGGGTGATCTGATCTACATTAAAGGAAGAAATTTTGGTG GATTTGGTGAATTTGGTCAAAATGCCTTCCAAATTAAGTTCCCACCAAAT TTAATTTTTTCTGTCATCCTCCAAATTAAATTCCCGCCAGATTCAAGTTA GTCTATTTATTCTCCCAAATGTGTGCTATTTCAGGCTTTAAAACAGGTTT TTCTTTGCTTTAAAAACTTATCTTTTTTTGAAGGGAGTGACAATTCAGCT CAACGCCTTGACTTCAGCAACTTAATTGTCTATTTGATTTTAATATTTTA GACTTTGGTTAGATGAGTTGATGGAGTATTGGTTCCACTGTACAACCAGC AACGTTGCTAGTGTAATTCTAACTTGCTGATTTGACTTTTTTTTATTTTT TTTGATCACTTTGAAGTTTCCTTAAATTCTTGAGAAAGGTCGGACCCCCC CTCATTCCAGTAACATTACTAACTTGACTTTTTGAAATTTGAAAAAGAAT GCCCCCATTCTCAGCCTGGCTTTTGCCTCATTATCATCATAACTCTGTAT ATATTGAGGCTTAATACAGCTTGTCTTTCTCTTTCAGGTGTATTTACGGC TGTTTTCAAGACTAGCTGAAGATAATGCTGGCTATCTTGATTGGAGTAAA TATATCAATAGGGTAAGTAAGCAAATCCTTTAAACCTTGAACAAGAAAAT AATTTAAAAATTTCCAGCGTAGTAAAAACCATTTTAAAATCATTGTTCCA TTTTTTTAGTCAGTGAGACAGAAATCTGCCTAGCTAAAGATTTCTTGTAA GGATTTCTGTCCTGTGATAGTGAATGCTTGATAAAGGCAGAAGCTGAAGG TGGCAACAATAAGACGATGTCTTTATGATTATTTAAGAATCAACACAAAT CGCCCTAGGAATTTAATTTATTAACTGTTTATTTTCAGATCTTCAATTTC TTCTTCTGTAAATTGAGTCTACCTATCAATGGCATGAGAAGAGGATTCGA TTTGAAAGGCACCATGAGCAATTCTGCTGACTTTGCAAAATGGTTTGTTT ACATGATGGGTGGTGAACAGGGGACTGTCATCTTTGACAAGCTGGAGAAG TTGTTTGTCACGCTGAAATCCTTTTATCATCCTTCCAATTATGATAAACA TTCGGTAAGGACTGGGTTACTCCAAAACATTATTTTCAGCAGCGTATTGG CACCTCTTGTCCTTTCAGTACCCCCCCAAAAAAAAAAACAAAAAACAGCC ACCATGCTACTACACCAGAGTAAAACATGTTTTATCAAAAGTTTTAAAAT TGAGAAAGATTTACTATGGAATGTTAGACTGTAGATAAATCCTGGTAAGA ATTGATAATTTTGTATGATATAAATAAAACTTTGTCAATTCGAAAACTTT TCTCGTAAAGATTTTGGTAAGCTTTTTGGAGACATGTTAAGACGATATGT TGTCTTTTTAAATTTTAGTCGGTGCTGCTTGGATTTTTGAATGCTTTAAC GAGTGCATTTGTGATGAGGTTGAATCATGAGAGATATCGGAAACCGTCGT GGACAGTAGACATTCCTGAAAAATCAAAAATTACTGATGCAGAAATTGAA CGTTATGTAAACATTGTCAAAGAGGTGGCCTTGCTCTCTGTGTACAGCAA ACAAGGAAGTCTACAGGCAGCGTTGACCCTTCAAAACCTAGCTCTTCTCA GGGCTGATTTGGTCATCCCACAATTACTTCAAAGGTAATGATTTATCTGA CTCTCCTTTCTCTTTGTTTTGATTGATTGATTTTCAGTTCAGCATTTTTG TGGCGATTTTCAAATAAGTTTCAACCAGCCCTCCAAATACCACGAACGTT TAGATTTTTTGTTAGGGTACTAAATTGTATTCAATAACTTCCCGATTAAT CTTTCTGATCCTATTTTTATCGTTACAGCACCTTTGAAGCCTTGGAGACA TTAGTTGAACCCCATCAAGTCACTGCAACTTTGATGTGTATCACTTCAGT AGCACGTCCTCTTGCTTCAGGAGGGGGCTGTTTCCCATCCGCACCTACCA ACATTTTACCTCTCTTACGTCTCGTCTTGCCTGGTCTCGATCCGAACGAT TTCCGTAAAAGCATGTGTGCGTTCAACTTCATTTCGGCTATTGTCAGTCT AATTCCATTGGTTAATTGTATGCCTGCAGTGCATGCTGGTATCGAAATGT CTGAAGTGGAAAAGGAGTTGTGTTTAGCTTCTGAGCAATTTGAAGACCTT ATTCTCCAATTCTTTGATAGGTAAAGAAGTCTGTTTGAACTGAGGATGCC AGGGTTTAGAAAAGAACCAAAAAGGTTTTTTCCTTACATACATCTATCAG TCTCTTTTCAAGCTAAAAGCGCTACATTAAAATATTTTTAATCTGAGATT TTCTTGGTAAGAAAAAAAAGAGAGATCAACATTTGTTTAAAAATGAAGCA AAAACTTTTTGGTCTTATTATGCCATAATCGGTTTTATAGATACTTTTAT TAACTATAGCACTGACGATTTTCTTGGTAGTTTTCTGGTTCCTTTTTGGT TAAAATTTTGTTTTTAATAATGTTTCAAATTTGAAATAAGTCATCAAGTA TCCATTCGAAGTTTAACCATACCGATCCCTCCTCTTTTCAGATGTTTCGT GTTGGTTGAAAACAGTACTACAGAGAATATCACTCAACAAGACAGTACCC TCGATTCAACAGCCAGTGCCCAAGACAGCATGCTTGGTAGAAGTCTGGTC TCTACTGTCCAAGTGGTTTTTATGCAGTGTTCAAAAGCTTTATTCGAGGT ACACAGTTTTTTTAGGGAATTGCGTTTGCCATCGTAATTAAAATGGAGTT TCTATAACTCAACACATAAGGGGAACGAAGGGGAACACTGTCCGGTGTAT TTTTTTGATGATGTTTTTTTTAGAAATTTGGTACCCTACCGTAAGTTGCT CTAATGTCGACATTCCTCTTCTAATTTCGACATCCTTCTTTAGAGACAGG AATAATAAGAAGGTTGGAATCACTGATGGACTCAACTGATTGTTAAGCGA AGAAAATTAGTTTCAATCAGCAATTCCGACCTTCCTATTATTCCTATCTC TAATTAAGGGTGTCGAAATTAGAAGAGGGGTGTCGACATTAGACCAACTT ACGGTAATTGTTGCAATACTTATGGTGGATGCTGATTTTGTGATCCGATA TTCATACGTATCGGTAGATGGATATATTTTTTTAAAACCCCATAATCAAA TAATAGTAGATATAACATAGTCCAGGGTTTTATTAAATAAAGATCAGTGT ATCATGAACAACCTTCTCCTTCCAGGTAGCATTAGATGCGTTGTTTCGTT TTGTATCGTCGCGCGTTCTTGAGGTGGACGTGGCAGGAAAATTGGTTTCT GACATGTGCCGTGGTGCTGTTCGTGCACGGCCAAAAGAAACGTTGAAAAA GATGCTTCCTTACATCACCAATCGTGTCATCAACTTGGCCACAGGTACGT TAGAATCGTATATGTGAAAGACTAGAGTCTGCTTCTGGCCTCTGAAGGAA ACACGGAGTGTTTAGCGAGGTCGCCATTTTGAAAGAAAAGTACAAAAATT CCAAACAACAAAACATCAAAATATTTAAGAATCTACTTGGAGTTGAAAAA TATAATTAAGATGTGAGCTTTTTCGGCCGCTGGAAACTGCAAGTAAAAAT TCCGATAGTATTCGGCCGCTGGCGTAGGTTTTCGTTCATTGGCGGAAAGA CATCTGCTGTGGCGTCTCCTACTGGTGGAGTCCTGTCAGAAAAGAACGTG ACGTAATGCATCCTTTCCCCTTGGATGACTGTTGATATTGTTCAATATCT TCTATATTCTAGTTGAAGGTGTTCAGAACGAAGAACATGTCGATCCTGAG CTGTTATGGTATCTAGAGATGCTAAGTGAACTCGGCCGTTGCAATGGTAT GGAGTTGTTGCAGTACAAAGAGGTGTTAAAAGAAGTCATCAAACTTACCA TTCACATGAAATGCAAGAAAGCCTACTCTAGAGCGGCCCAGGTAGTGTAT TATTTTCGCTCTCTTGAAATTATTGGAAATATTCTGCCTGTAGAAGTTCA AATTGAAGATTTCTGACTAGGCTTTCTGACCCAGTGAAAAGGGAGAGCAA AATCTATTTCTTATTTTGAGCTTTCCGTCTAGATTAACCAAGAGTTGCTA TTACTATTGTATCAAAGTGACCGAAAAATCTTTTTGATCTATTTCTACGA GTGCAGAAAAAGTTGAACTTGGTTTGCATTTCGATTCTCATCAAAATGAT CTAAAACTGGTTGCCCTAACTTTAATCTTATGCACAGTATCAAAACATAT AAGAATACTTCCACCATATCAATGACTTTCATCCATTTTGCTTGAACGAA CGTTTATCAGTGCTGAAAATATTGATTTGTGACAAATTATTTTGTCTGAG GTGTTCTGTAGGCCCATTTATCATAAAAGATACCATATTTATTTAATTTC AGCTTTTGAAGTCAATCTTATGTTCTGTATCGGAAGTGTATATTACCGAA TGGATGAGCGTACATTATGGTTTTGATCTCCCTCCAATGGAACACTTCTA CATCAGAGACTGGGGAAAGCCATACCCTCTTGACGAATTGAATCCTAAAT GGCACTCACCTAGCCAGGAAGAAATGCAATTCGCAGATGAGTTGTTGAAA GAGTTTCTGGTACCTGAGCTAGAATTACTGAAAGAAATCATCAACGGGAG AGTACTTACAAGGTAAAGATTTACTTTTTGCATATTACGGTCTTTTTTAC CGGTTTTGCCGGCCAACTTTCTTCTTTGTATTACTCTAAGCTTAAGATGC AATTTTAGCGGAGATAGATTTTGCGGATCTCGCTGTTAGCCTAAAATTAC ATGTTTTGACATGTTCTGATTTCGCTCAGAACCAAAGTATCATTCTACAG GAAAAAGACCTCAAACCATCTGATTATTCCTTTAGACAGTGTAGTGTCTG CCAAGCTTCTTTAGTTCACTAAGACACTTTTTTTCTTTCCACAGAGATGA GATCCACCAACACTTACAGATCATTGCAACTTGTTTATATGGTGCTGCCA ATCTCTTACCGAATTGGACGGACAAGCGAGTGGAAGGTGTTGCTCTGCCG ACGCTTGTCTCCCGTGAATGTATTTTGAATACAGTTAATCTATCAGATGT TGAAAAATTCGTTTGTTGTATCAATCGTAAGGACGTGGTCTATCAAATGC ACAACTTCTTCAGTAAGTTCGTTTGAGAAGACAAAAGGGCAAGTTTAAAA ATTAGTATCTTATGTAGGCTGCGTAAAAGCAATGAGACAGAACAGGTTCA ACCTGTCATCCCAGAAAAGGTGCAAATCTCATGGTGCGGCTTAATTTNGA GACAGGACAGGTTCAACCTGTCATCCCTGAAGCGATGCCAATCTTATGAG GCTTCAATTTTTTCTTGCTTAATAAAGGTTGATTACTCCCCTCTATCATT CGGCTTTAAACTCAATGGTCTTAGCTGAATGGAGCTAAAGGAGCGAGGTT TTTAATCAAAGGTTGGGCACTATTTTATGGCAATTGTCAATTGGTCAATT ACAAGTCTAGTCTAGAAATCTTAGCTAGTTTGACTCAGTCACTAGGATAA ATCTGATAATAAGTTGTGACAGTATTCTAAGGCAAACTTAAAATCCGTAA ATATATAAAATCTTTAAAGCACCGAAAACACTATATTGCTATTTAGCCGT GTGTCACAGCCTTGTGAATACGGGCTTCGTTGGCTAGGCTATTACAAGTC TTCATTATATATTGCTGTTCTTCTTCTTGAAGATTTCATGTCAAAGACAC ACGAAGATGATACGAAGTCGTTTCGCATGCTGGCTCGTATTTACGACATC TTGGTTCTTCATAACGGTGTCCACTGGAGTGACTTCAACCTTCGCTGGAA AAGTGCTTCTGCTGTTAAAAAAGCACTTGCAGATAGGGTAAAGATTGGTT TCTAAAACTATTGAACACTGAAAACGCAACTAGGATTAGGTGGATATTAC AGGGCCCACGGGCGCCAAGCCTATCAGTGAGAGGCCCATGGGCCCTGTAA TGTCAACCTGATCCCTCGACTAATAAGTTTTTATACAGGCGAATCTAACG TTTCCATATTTTTATAAATATGAGAGTTTGTACCACTAATACCAGCTCGG CCAATTGTATAGAATCTGCAGCACTGCGAAATTCCGCAATTTTAGTGTTA TCAAATTCCTTAACGTTGTTAAATTTCGCAGCCTTTCCGTGGCAAAATTT GACAACGCTTGCCTTTGAACCACAAATAGGGTCGCATGGTGACGAACGGG GTTAAAAAATTATGTGCAAACCCAAAAGTAAACTTTTCAACTCAGGATTT TAATTTCCAACCTAGGGATTTTTCACAATCATTTTTGACAGTAAGGCTAC TTTGTTCAAAAAAAGTGAGATTATATTCCTGATTATGGTCGAGTCTTTGA CTTTGACTTTTAATTTTAAATTACAAGCTTCATTTGGAAGCGTTGAATCG AATATCAGAGCAACTTTGTGGAAACGTTTTGGAATATTACAGCGCTGCGG AACTATGTAACTTGCTGTATCAGATACTCTTTTCGAGATAAATCAAATCA ATCTTAACCTCATTAAAAAAACAAAAAACTATAATCGATGTTTAACATAG TTGGTTATATGTTTCCTGCAATTGTTTTTCATCGATTTGATGTCGAATTA TTATGACAACAATGGTTTGAAAACAATGTTTGCAATGATTTTATGCTTTT CGAAAAAAGTGCCAAATGCCTCAGTTAAAATTCACGTATTTTTCTTTACA GTTACACGGCAACAAGATGCACGTGCGAGCCGTCCAAATCGAACGCGTAC AACTCCAACATGACATGCGAGTATTAGACCAACACGCTGCCGCTTTTTCC GTCACCGACAAAGTTGTCATCGATGATCTTCTTTTCATGTCGACCAGCGA GTATGCTGAAGTTCGGATCCATTCTCAGAAGATTTTATTCGGTTGTTTAG AAGCTTTTGATGTGGCGACTCGATACGTTTTACCAAAAATGCTGGAAAAC ATTCACCCGAAAGCGCAAGTCTCACACGAGAAATTGAAAGGTACGCTGTA TATTTTACAATATTCTCGCATCGTTTACATGCTGATTCACGATTGGAAGT TAATGGNATATTTTACAATATTCTCGTATCGTTTACATGCTGATTCACGA TTGGAAGTTAATGGCGTCGTCATGGATACCTATTGTTCAAGCTAACCAAT CGGAGAAGCCGTCCATTGTAAAACTGTTGAATTATCTGATCAGGAAGATT CAATCGAAATTTGAAACCATGAAAATCGAAAGAAAAGTAAGCGATTTTTT AATTTGTCTCTAGTTCCACGCGTATAATTTTGAGCAGACCATTTATACCT CCTGTACAAAATATTTTCTGGTCTTGGACAGAAAGAGATAGAAACGAGAA CAATTTTATATGATTCAAAACAGAGTTACAGCAGAGCTTGTACATCCGTT TAGTCAACCATGAAAAATCAATCTTAATTGAATTTCCTTACAGTTATAGT AGTTGTTTCATATTTTCAATGTTCAGATTGGTGAAAGCGCCAGTAAAGTT GCTAAGCAGCTTCTGGAAACGAAATCACCTGAAGCCAGAACATCTCTCTC TGATTCACCCGCCGATGATTCGGTTTACCCTTCTGACAAGTTCATGAAAA TGGGTCAGGATAAATGTACCAAGAAAAATGAAGAAAATTTGGCGTAAGAA ATTCTTTTATTTTATTGGTTTTTCTTCTCTTTCCGCCTTGTATNAAAAAT GAAGAAAATTTGGCGTAAGAAATTCTTTTATTTTATTGGTTTTTCTTCTC TTTACGCCTTGTATCTTCCGATATCTATCCTTGGTTGATTTGGTCTCCCG CTATGTACTGCAAGTTCCCTGAATACTGTGAAGCCCCTTGTCCCTGTGGT TTTCTATTATTCACCCATGCGGACTTATGTTTCATGCCTAAATGGTCTTC ACTCATAAATTTCTTAATTAAATTTCTTCTATTTCAATATTTTTTTTTCT CATAGAAATTACCGTCGTTTAGAACAAGATTTGAGTAAATTACTTCAAGA TACCTCAATGTAAGTTTGTTTGTTTATGTTTTCTTTAAAGTTGACGTAAA GTAGCTCGAGGCTAATCAGTATCAATATTAATTACAATCTTATCAAGTAA AGTAACGAAATCGTTAAATCGCGATCCGTGGCGTAATGGTAAAGTATTCG ACAACGGCGTGCATGAGTGGGTTCTAGCCTGGGTCATATCAAAGATTCCC AAAATAGTACTTGATGGCTCTCTGCTTTCTGCTCATTAATTAAGGAAAAG GGTAAAGGGTGGATGAGAAACCCAGGGAAAGAAGTGGCACTCTCTCCTAC CTTCGGGTAGACAGCTAGAGGAGGCACTCTGTTGCCCTCGACTGCTGTTG CAAACTTCTTACTATTTAAATGAATATTGTATCATTCTCTACCATCATGA GTATGCCATATCATATTTATTCACTATGATTGTTATGTCTGCTACTTGGA TTCCCTCTGTCATTAGGGATAAACTATCGAATAAAAGTATCTTGGCAACG ATACTTTAAGAAAGAGACCTGCAACGATTTTGTGCTTTTTGAGAAGTGTG TACTTAGACAATGAGCTATTCCATTAAAATTAAAAATCCATACAGGGGGC TGGATGAACCTTTTCATGTCAAAATAATATTCTTGGAAATGCGAGGATAA CACTCTTTTAAACCCCCTGAAAATTGTTTTCAAGTAACCCGGCCTGGAAA TGNTGAGGATACCCCCTGGAAAATTGCAAATTTTCCAAGAATACCCTGAA AAAATTATTTTTATACTTAAAAGTGACGGTGGACAAACTGAAACCTGTCT TTTACCCTCTGGAAATTTTAGAATAACTTTTACCCCCTGGAAAATGGAAA AAAACACTCTTTTAGACCCCCTGAAATTTTTTTTCAAGAAACCCGGCCTG GAAATGTTCGTCCACCCCCCTGTGAGGAGATAAAATGGAATTAACCGTTC TATTTATCTCTTTCACCGCAAATTTTCCAAGAGTACCCTGAACAAATTAC TTAAAAGTGACGGTGCACAAACTGAAACCTGTCTTTTACCCCCTGGAAAT TTTAGAATAACTTTTACCCCCTGGAAAATGGAAAAACACTCTTTTAGACC CCCTGAAAATTGTTTTCAAGTAACCCGGCCTGGAAATGTTCGTCCACCCC CCTGTGAGGAGATAAAATGGAATGGCCCAATGCACTTACTATTATTTATC TCTTTAACCGTTCTATTTTAGACACTGGCGATGTTCGGAGATGTGCACAA AGCTGATGAACTTATTGTTGAATAATGAAGTCAAATCATGTCACGAAGTT ATTAACACTTTCCTGAATCTGTTAGTCAATGACTCACACTTGCTTAGACA GGTAAAGATTTATCNCAACACTTTCCTGAATCTGTTAGTTAATGACTCGC ACTTGCTGAGACAGGTAAAATTTATCAAAACATCTTCGGAAACATTGTTC TTCAGTTTTCAGCCTAAACTGCTAATTTGTGTATGCGTAATTGATTGATC TCTTTAACTCGAACCCCTATAACTCGTACAGGGATTTTTCTAAGCACTTT TTTATGTCCGTATACCTGCCAAAATACTCAATCTAAGATTGAGTTTAGGA AACTCCATTCAAAATATAAAAGTTTTTTTTTTAAGCAAAATTCAACTTGT TTGTTGTTTACAAACAAAAATCTCTAATATTATCCACATATTCAAAATAT TTTTGGGAGCTTCGCCCTCTGAACACGTCGGTCGACCAAACCCCAAGCTT CATCAATATACAGCTTTGCTGAGAAAATACCTTTTCAGGCATATTAGAAA CTCAATCTAAGTTTACAAAAACGGCCCAAGCTCAAAGTGCTTGGAAAAAT CCCTGCTCGAATGTCTCCTTAAATTCGAACAGCTTGTATTATTCCTTCAG TTTGCAATGCCCGATGAACCTTACCACCCCATAACCAGAAATTTCCGAAC AAATTAGTTTCCCTGTGCGTGTTGAAGTTATAGAAACTCCACTGTAATAC GATTTCTGGATTACGGGAGAGTTCATGTAGTGCATGTATTCAGCCAAAAC ACTTTACACTAAAACACGCATTTCTCGTCGTTCATTCTACCGTGAATTTT AACATTAATTTTAAATTTACGAAAGTTTCGCTGTATAATGATATTTGATT ATACAATATAATTTATAAAAAGTGTCTAGTTTTCTTCCTGACTGACATCG CTCTACACATGTATCGAGCACTGTAAAAAAACTGAAGAAATACTTAATAC ATTAATTTATAATTGATTTTTGATATAGTATGCAATCCGTGGCATCATGG CTGTATTGTATCAGTACAAACCACAATTCGCCAAACGAAAGTTGAATTAC CCTGAGCACAATATCGATGCCAGTCCAGATGTTTTAATGAAACTAATGCC TGGAGATAACAGAACAGACAACCAGTGGCTTCAATATAACGACACAAATC CAATCAATTCTCAAGAGGACTTAGAACGGTTTTCATTTATCGATAAAACG CACTGGGGTTACCAGACATGGCCTTTAGAACTTGACATCCTATCAAACCA AGCTGACTTTTATACTAAGATACGTAACAAAGACTGCTTATGCAAAGAAG AGAATTTAATTGTAGACACTTTAAATAACAGTGAATATCTTGAAAAATTC ATCAAGTTTCATTCAATGGAAGTCAAGAAAGGTGAAGACCGATTCCAACA CATTCACTATACCTTGTTCAAAGGTTTGTTCCGTAATTACGGGCCATCAA TGTTCGAGCTTTTCCGCCCGGTCGTCAATGATTTATTAGCGGGAAACAAC GAGAGTAAACACCGGTTGGCTATTGAAATCATCGCTGGCATGATTAGAGG CTCCAAACACTGGAATTATGAAAGTTTGACGATGTTTTGGGATTTCATGG TTCCTTTGCTACAGAATGTTTTTGTTTCAAATGTCATGGAAGAGACAGTC AAAGATTGGATCTTAGCATTGGTTGTCTCTACCGTGAGTATCTTTTGATT TTTTATTGATAATTTGAGTGGTGATTGGTAGTATGAAGGTTTCGATCACA GACTTGCAACGCAATAGAATGTGTTCGAATCCCAAGCACTTCCAGGCAGA GTGTTAGGGAAACATGGTGACATTGACTCTCTACATTCACTCGTATAATT TGATTGGGTTGCTGAATCATTTTAATAGGCCAATGCGACAAAAATTAGAG GGATATTAACCTTTGAATCTTTGGGGTTGAAAGTCGACAATCCCCTGACA AAGTTATGTCTTGGGTTGTATAAAGTAGCCAAATGTCAAAAGATAAATTG TACTAATAATTAAATTTGAACATCTTTTCCTTACTGTAAATATGTCAGGA CTACCTCTTTTCGTTAGGAAGTGTTTTAACTACAAAGTAGCTGCCATTCA TAACCCTGCTAGATAGAAATAGGTTTGCGATGCTAATACATTTCATAATA TTTTTTAATAGGAAAGTCACGATCCGAACCGTTTCCATCGTCTATTTACC ATGCTTCTGAACAACCCTATCAACGGAGACGGCGGCTCACAAGGTGATAC CAACCGATTATTTATCATACGAAAAACCCTTGGTCAGCAGGAATGGAGAC TGGCAAATGTCAATCATAACATGATGAAATATCTTCTCCCTCATCTCACG CACCCGTTTCAAAATGTCCGCGAGAAAGTTGGAAGGTTTGTCAAAATCTT AATTTACAAATAAAATTTGACAAAAAATCTCAGAAAAACTGAATGCTGGT TGTAACGTACCAAGTACTTCAATAAAGGTAGAATCGACTGGACTTTGCCT TGCTTGCGACTTGCCAGACTGTGCCAGAAAAGAAAAAAAAGCTACACAAA TGACCTTCTCTTTAATTTGATTTTCAAAATAAAAAAGTGTTTTCGAATTT AGATTATTATTCTAATTTTTTGAAATTCCTTTCTTCTGTTCAGTTTGGTC TCTTACATTCTACTTTTCGACTTGAAATACGCCTCGCACACGCCCACTCT TTCACCTCGATGCGAAATGTTTGTTGATTACGTTTACGAAGACATATTGA AACTTTACCAAATCACACTGGGTGAAATCGAGGCTCACGAACATCAGAAC GAGGCTATGGAAATTGACGGTGTCGGTGTCACAGAAGAAACAAAGAAATT GGAAAGGATGGCTAAAACTGGTTTGATACTAATTTTTCTATACGAATAGT TCTCGGCTCTCCTTAATAATTTTTTTGTGTTGCTTAAAATTCCGAAATCT TTGAAGAAATTAAAGCGCATCCACCATTTAACGCCATCTTTAGCATTTTT GCTTATACAATATTTTTAAGCGCCTCCCACACCGCCCATTTCAATTCAAT TCTGCTTTGTCAGCCTAAGAGCCGCGTCTTCTTTGTCTATCAGAAAATAA AAACAATGGCTGGGGTCTTCCCAGAATCCGGTGTTTACCAGTATTCCTTT TTTGACAGGAAAAAGACCGAATTGAAGGCTGAATCCTTGGTTTTCCGGTA CTAGTCGGAATATTTTCGACCGGTATCATATAAATTTTTGGCCGGTAACC GGTATTTAATTAAAATATCACCGGTAGTCCGGTATTTTGTACCCTCGCAA GCCCCCCCTCCCTACTTTAAAGGGTGAGCTTAAGTATATCTTTTCCACAG ATAGCTAGTAGAATGTAATGTTTATGTCAAAAGAATTTTAACTTGTTCTT TCAGTATTATCATTCTTGGTCAACAAATCTGCAAACTTCCAACCAGTCAA TAAAGCACTGTACCGCATCATTCCCTTGGTAAGAGCAGGCTGACTACATA ATTATACATTAAGAAATTTTAAAAATCTACTGAAAGGACACTGTATAATG TATTGGGTGTCAGAAATGAGTTACTTCTTCAGTTTGTATGAAATTTCAAA AATCAAACATTTTATCATTGGAAAGAGGAAACTTTAATAGACGATATCGG CTTCACATGAAAACTCAGATTTGACCCCCGAGAATTCCCCACGATGCTTT GTGCGGAAAAAATTTCAAGGTTAACTTTTTTCCACGCAAAGCATTGTGGG CAATTTTTGGAGGTCAAATCTGAGTTTTCACGTGATGCCGATATTGTCTA TTCTGTTGGGTCATTTTTCTGAAATTGCTCAGAATCGTCGAAAATGGTTA CCCAGTGTTTTAATATAAGATATCTGTGAATGTTATTTTAGCTGTTGGTG TTGGAATCAAGAGAAGATGATCCGGAATTGGTTGGCTTATGCAAATATGT AAGTTTTTTTANATCATTGGAAAGAGGAAACTTTAATAGACGATATCGGC TTCACATGAAAACTCAGATTTGACCCCCGAGAATTCCCCACGATGCTTTG TGCGGAAAAAATTTCAAGGTTAACTTTTTTCCACGCAAAGCATTGTGGGC AATTTTCGGAGGTCAAAACTGAGTTTTCACGTGAAGCCGATATTGTCTAT TCTGTTGGGTCATTCTTCTTAAATTGCTCAGAATCGTCGAAAATGGTTAC CCAGTGTTTTAATATAAGATATCTGTGAATGTTATTTTAGCTGTTGGTGT TGGAATCAAGAGAAGATGATCCGGAATTGGTTGGCTTATGCAAATATGTA AGTTTTTTAATTCCTTACTGTTTCCTTATTTTAACACAAACCAACAAAAT TGTTTAGTTTGTTCCATGCGTTATTCTTTTAGGTAATCCTTATATACTGG AGTCTCGAGAACTCGAACTTCTACTCCACTACTAGAATGTCTTCTTAACT CGAACAAGTTTTCAGGTCCCTTCACTTAACAATGCCTTATAAACCTACCT CCATAACTCGCAATTTCCATAATTCGAACAAATCTGTTTTCCCCGTGCCA TTTCTAGTTATGGAGACTCCACTAAGCAAAACATTGATAGCATTCAAATC GATCATGGAAGCTTTAGTCTGTATAATAATGATAATAATAAAAAACACTG TTACTTTTTCTCATAGACGTTCCCTGCATTAGCATCAAAACAACTTCCAG ATGATCTCGCTCAACCTGCAATACAATCTATTATTCAGGTAACCTACCAA AGTTTATCAGTAGAGGGCATCCTTTAATTTCGGTACATAAACATTCTTCG GTCTTTTATACCGCATTGTAACTGTGACTTAGAGCAGGAGTAATATGCTA CATGATATGCTAACCATGGACACGTAACTGTAAATTTTCTTATTTGTGAG CATTTGAAGGTCGAAATATAAATAAATCATTTTTTCATTCCTCAGGTCTG TTACAACAAGAAATCATGGAATCTCAGAAGAACCGGGCTTAACTATTTGA TGGTAATTTTTTACAAGCTTGCTATGGTTTTAAGGTCAAAATTTTGGATC TCGTAGCCAATGGAATTCCACTTAAGCTTTTTTTCGACCGATCATCAGGA CTTGATGATATGTTGTCTAGTATGCTTGACGACTATTTCAGAGAAATTAA AAAACGAGTAAGAAAAATTGGGAGAAACAAATTTTTATATAAACTAATTA TTATTACACTTATCGTATTACCATATAACTGTATTGCACGGATTATAGAC GACTCAAGTCTAGCTGATAATGTGATATATATTTTAGATACTATCTATAT AAATTTGGAATTGTATTTTAGATGATGGTCTTTCACAATTTATACATTTT GGATGACGAAGCGACACGCAACCAACTTCAAGAGATGTTGATTGAACGCC TGAAAGACGAGCAAGTCGAGGTAGACAAAAAAGAAAATTAAATTTTTAAC ATCAATGTGAAATTCACTTATTGAATAAACATCTCTAATAAAGAGATCTT TACACAAAATCTTTAAAACATCTTTAAGCCAAGTTCAAGCAGAAAACCAA GCTAAACATCTCTAAATGGGCTTTTCCAGAAATAGTCCGTGCCCCCTGTT GAGGATATCGGATATCCAGGGGGGGGTTAACTATCTACAAGGGAGTGGAT ATCCAGGGGTTAAATTGTCTTTTCAAGTAAAAAATACGATATCCAGGGGT AAGCATCTTTATAAGAGAGGCTATCCAGGGGGTTGAGTATAATATAGTAT ATTATCCCACTCAATGGCATTTAGAGCAAGCATGATTCCTCTCTCATCAG CCCTAGTAAAATCCCAAACGAAAAATTTGGGATTTTACTAGGGCTGATGA GAGGGGAATCATGCTTGCTCTAAATGCCATTGAGTGGGACACTTCTTTTC GAGGTCTAAATGTGGATGAGCGTGTTGCCCTTCTTTCTGAATATATCTTA AACATTTTTTCCAATTTTGTTCCCAATAAAATAATTACAATCAGGGATAA GGATGCGTTGTGGATGACTCCTGAGCTTAAACAAATGCTCCTCGACAAAG CTAAAATTTATCGCCGGTGGAAAAAGCGGGGGGATCCCTTGGATAAACAG ACACTCGATGACATCTCCAGAAGATCTAGACTGGCTATCAAAGAAGCCAA GGAAAACTATTTTACTCGTCTTGGTAATTCTCTTAACGATCCGAACATTG GAAGTAAGAAATACTGGTCTACCCTTAAACAATTCTTAGGCATGCGCAAA ACACCAAAAATCCCACCCATACGCGATGACAGAGACATTCTGATATCTGA TGTTTCTGAGAAAGCCAGCATCCTTAACTCTTTTTTCGCCGGACAATGTT CTCTTATTGAAACTGGCAGTGTTCTGCCAGCTGAACAATTCCTTACTGAC CTGAGGTTGGAAAACTTAGAATTTGACGAAGATAAGATTGAGTCTTTAAT AAAATCTTTAAACATAAACAAGGCTCATGGATGGGACGATATTTCTACAC GTATGGTTAGGATTTGCGGTAAATCCCTAGTCAAACCTTTGTGCAGTATT TTCAATCTTTCAATTCACTTAGGTATCTTCCCTTCCCAATGGAAGAAAGG CAATGTTGTTCCTGATTATAAAAAGGGGGACAAAAGCATTGCTAAAAACT ACAGACCAGTGTCTCTTCTTCCAGTGTTTAGCAAATTATTTGAAAAGTAC ATTTATGATGTACTTTACAAGTATTTTGCAAGCAACAATCTTTTTACTTC GTGCTAGTCAGGTTTTCGGGAGGGTGATTCTTGTTTCTCTCAGTTGTTGT CCATAACGCATGACATCTTTACAGGGTTTGACACTGATCCACCTTCGGAC ACGAGGGGAGTGTTTCTTGATATNACCAAGAAAATCTCTGCTTACTTTAT ACAAATCTTACATTAGACCACATTTAGACTATGAGGATATTATATACGAC CATCCTGGAAATTCGACTTTTGTTCGTAAGCTTGAATCCATCCAATATAA TGCCTGCCTTGCTATAACTGGCAGCTTTCGTGGAACGTCTCAAGAACAAC TTTATTCTGAACTTGGTCTCGAGAGTCTTGCTGATCGTCGATTTAGTAGA AGAATGATCTTCTTCTACAAAATTTTAAACAATTTAGCCNCGAGGGTCTA ATTTACAAACTCCAATCCTGCGGGGTAACTGGTCCCTTACTTTCCCTTTT GAGAAATTTTCTATCAGGTAGGTATCAGAGGGTTGTTTTGAATGGGAAAA ACTCTGAGTGGAAACAAATCAAGGCAGGAGTTCCTCAAGGCTCAATTCTT GGTCCTTTGTTTTTTCTAATCTACATCAACGACCTTCACGACAATCTCGA GACCAAGGCTAAAATCTTCGCTGATGACACGTATTTATTTTCATTAGTGA TTGACCAACTTTTGAGCAGTGAGGAATTAAACAGAGATCTTGCAAGAATA AGTGAGTGGGCTCGTCAATGGAAGATGTCTTTNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTCCATCGAAA ACTCTCAACACTTATATTTTTAAGAGTGGTTATCCAGGGGGGTTCGATAC TTCGAAAAATCAATATCCTCAACAGTGGGGGTATATTTTTTTCTGGAAAA GCCCAATAGATCACAGATAATTTTGTCACTTATCGCGAGGTTTTACCTGG TAAAATTTGATTGGAGATTTAGAGAATCAGTTGATAAGATAGACTCGTCC AACCAAAGTGTATCGCTCCTAATGTTTTAGACTTTTAAACTCAAAGTGAT AAATTTCATTTGTTGGAAGAGACTGTCTAATGTCTGTGTTTTTATGAATT CTCTTCATTGGGAATTCGGGGGGAAATTTGTAAAAGTCGTAGCATTTTCT CGTATTCAAATGATTTTTCTGCTTTTTTACAAGGTTCGTGAAATAGCTTC AAAGCTCTTGAGTGGTCTGGTGCATTTTGGATATTTCTCAATCACTGAAG AATTACTGGTAAGTTGGAAATTTCAGTCCATATTAGAACGCCTTGAGGAA AATAAACACCATAGAAAATTTAGCAAAAATTATGAAAAGCTGAATATTCT AAGTTGTTCTTTTCTGGACAAGTCGTTTTATTTTTATTTAAAGATTACTA GTAGTTTTTAAACTGACCGTCTACAGACATAGGTACTTTTTTAAATGCAA TTTGAAACAATAAATTTGTTTAAGTTATGGAAATTTCGAGTTACATACTA ATTCATAAGGTATTGTTAACTGAAAGGGCCAACAAACTTGTTCGAGTTAT GGGGACCTTCACTGTATATTTATTTTCTCTTGTTATTCTTCATTCAGTCA ACATTCCACACAATGGCAAAGATCAAGATGAAGAAAAAGAGACATGGAAT TGAACTCACTCAAGCACAAACCGATAAAAGTATCTTTTTTGTTATGCCTT GCTCGAATTGAACTAACCACAGTGTCAATGATTCGACCTTAATCAACCTC TTATTTAGTATCCCTTTCTAAATAGCACCACGCCTAAAACTTAAAACTTA AAGAGAGCCCATCAGACCTCTGATAAGCCTTCTAGTAAGCAATACCTTTA AAGGAAACGTATCAAAAGCTGAAGACGGTGCAGGGGAAAAGGCAGTTTTC ACCCAATTCATGAAATGCGCCATTGCAATGTTTTCGGTGGACCCAACAGC TGATTGGTTGAGAGTGACGTATTGACTGATCACTTACAACCAATCAGCTG TTGGGTCCGTGATGTAATGTCAGAAGGCATTGTAATGGTACATATCATGA ATACAGCCTGCCAGAACCTCATTAATTTCTCCTATATTTCTCGTTTCAGA CGTATTAGCATTGCAAGTGAAACATGGCGGAGTCCTCGGTCTCTCAGCAT TAGTCTTGGCTTTCCCTTATGATGTCTGCACGTGGATTCCAGAAGTTGTC ATCGATCTTGGCAATTATCTACATGAAGTACCACAAATTTCTGTATGTGT ACTAATTTTAAAGTGTTCTTTCTTTTTATGTTATGTCATCGAAAGCGTGA TGGATTAAGCTTCATTTGTTTTTCCAAGCACTTATTATTTAAACCTTTAA AATCCAATACGGTTCCTGATTTCTAAAATACAACAAAGTCATATCCTATA ACCACATCAAAATCAGACAATTGCTCATATTATTTTTCCTTCTTTCTGTA CCAGGCCACAGCCAAGAAGACACTATCAGAGTTTCGCCGAACACACCACG ACAATTGGCACATTCATCAACAACAGTTTACTGATGACCAATTGTCTGCG TTGACTGATTTACTCATTTCACCAAGCTATTATGCTTAGAAAGATGGCTT GTATTGGAGACGGCGAGATTATGTAATTCTAAATATGTTTTGTGATGGCG TTATCATAGCCAAAGGTAGATTGCATCATTAGTCTGGCAAACCCTTTGGG TGGACCAGCACGCTTCGGAGTGTCATACTGTATGCTTCAAAGTAGTCTAT ACTAGTAGCTACGATTGATTTGTTTGTTATAGGAAAGTGTGTTAGACAGT GATTTATTGACTCAAGGAAAAATATTTCCTGATATATATTTTTGGTTGTC AAATTAGCCAAGACTTTAGTAGCTTTTAAATTCATGATTAGATTTACGAT TTTAGGTTTCACAATACTCCTTTCATGAGGTAGAGAAAAACATATGTTGG CCTCGCTTCCACAATAATGAGAACTTTACTGACAGCTCTGCATGCAAGTT ACTTACCCTCGTTAAAAGGAAAATGACGATAAAGATATCTTCAGAAGGAG GCCAAGAAGTTTTCTTTTTATTGGGCTTTTCCAGAATTTTTCCGTAAACG CCCTATTGAGCACATTCATTTTCCAGTTCCACAATCCCCTGGATATCCTA CCTGAAAAAATCACCCCTCGATATCCATGCATTTTCTCCTGTACCCTTTG AATATACAGCATTTTGTTCTGTGCCCCCTGGATATCCAGACATTTTGTCT TGTACCACCTGGAACCATTTCCATCCTTTAAGGTCCTACGCCCTGGATAT CCAGATAATATTGAACCCCCTGGTTCAACACCCCATCCGATATCCTCCAT AGGGGGGACACAAACTATTTCTGGAAAGGCCCATTTCAAGATAATTTTAT TCACTATTTTGTATTAAGTGTTGGTATGGTTTGAAAAAAGGGTTGTGTGG AAGCTTTCTACTTGACAATAATAATTTTGTATGAAGAAAACAATAGAGCT ATATTACTATTTTATTTATTTTTAGGTAAATTTCCCTTAAATTAATATAG TTATTAATTTTAGTGCACTTTTCTTTTTTTCTAGATCTTTTAATTTACAA TTTTATAGTTTTTTAAAAGCTAGTCCTAATTTTTATGAAGATACGCTTAG TAGATCTGTCCTTTTTAAAGACCTTTTTTGTGTTCATTTTGATAATGTAT GGATCTTCAGTTGAAAACATATCGTTTTGTTTCTGACTTTTGTTTGCTTT GGGAATGAACAGAAACTAACTTGGATTACTATGGAGATTTATCACTACAT TTTAATTTTCATTTAAAACCGTTTTAATTGTTCTCGTTTATATAGTCTTT AGGTAGATCTTTCAGCATTTATTGTTAATAGTATAGGCTTTTCTTTAGGG TAGCCTTGGTTATATACCTCTTAACTTTGAAGCGTTTATCAAAACACTTG AGATTGTATATTTTTTAATTACTTCAATTTTTGTTTGATTTTTTTGAGTA ATTTTCTTTGTCTAGTTGGTGATTTCTTTTGATTGTTTTTTCCTATTGCA C
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000326XLOC_000326Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000535-exon-sc0000002-1575043694:441946..442205TCONS_00000535-exon-sc0000002-1575043694:441946..442205Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:441564..441704TCONS_00000535-exon-sc0000002-1575043694:441564..441704Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:440559..440675TCONS_00000535-exon-sc0000002-1575043694:440559..440675Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:440273..440317TCONS_00000535-exon-sc0000002-1575043694:440273..440317Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:439824..439973TCONS_00000535-exon-sc0000002-1575043694:439824..439973Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:439344..439404TCONS_00000535-exon-sc0000002-1575043694:439344..439404Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:439044..439118TCONS_00000535-exon-sc0000002-1575043694:439044..439118Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:438552..438767TCONS_00000535-exon-sc0000002-1575043694:438552..438767Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:437972..438237TCONS_00000535-exon-sc0000002-1575043694:437972..438237Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:437436..437777TCONS_00000535-exon-sc0000002-1575043694:437436..437777Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:436908..437064TCONS_00000535-exon-sc0000002-1575043694:436908..437064Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:436212..436380TCONS_00000535-exon-sc0000002-1575043694:436212..436380Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:435665..435843TCONS_00000535-exon-sc0000002-1575043694:435665..435843Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:434944..435203TCONS_00000535-exon-sc0000002-1575043694:434944..435203Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:434444..434661TCONS_00000535-exon-sc0000002-1575043694:434444..434661Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:433719..433873TCONS_00000535-exon-sc0000002-1575043694:433719..433873Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:432320..432854TCONS_00000535-exon-sc0000002-1575043694:432320..432854Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:431913..432079TCONS_00000535-exon-sc0000002-1575043694:431913..432079Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:431547..431600TCONS_00000535-exon-sc0000002-1575043694:431547..431600Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:430142..430334TCONS_00000535-exon-sc0000002-1575043694:430142..430334Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:428573..429277TCONS_00000535-exon-sc0000002-1575043694:428573..429277Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:427871..428094TCONS_00000535-exon-sc0000002-1575043694:427871..428094Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:427386..427612TCONS_00000535-exon-sc0000002-1575043694:427386..427612Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:426778..426851TCONS_00000535-exon-sc0000002-1575043694:426778..426851Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:426308..426364TCONS_00000535-exon-sc0000002-1575043694:426308..426364Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:425518..425589TCONS_00000535-exon-sc0000002-1575043694:425518..425589Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:425254..425310TCONS_00000535-exon-sc0000002-1575043694:425254..425310Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:424836..424934TCONS_00000535-exon-sc0000002-1575043694:424836..424934Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:421648..421722TCONS_00000535-exon-sc0000002-1575043694:421648..421722Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:421227..421308TCONS_00000535-exon-sc0000002-1575043694:421227..421308Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:420664..420806TCONS_00000535-exon-sc0000002-1575043694:420664..420806Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1575043694:418855..420451TCONS_00000535-exon-sc0000002-1575043694:418855..420451Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:441946..442205TCONS_00000535-exon-sc0000002-1510915933:441946..442205Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:441564..441704TCONS_00000535-exon-sc0000002-1510915933:441564..441704Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:440559..440675TCONS_00000535-exon-sc0000002-1510915933:440559..440675Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:440273..440317TCONS_00000535-exon-sc0000002-1510915933:440273..440317Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:439824..439973TCONS_00000535-exon-sc0000002-1510915933:439824..439973Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:439344..439404TCONS_00000535-exon-sc0000002-1510915933:439344..439404Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:439044..439118TCONS_00000535-exon-sc0000002-1510915933:439044..439118Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:438552..438767TCONS_00000535-exon-sc0000002-1510915933:438552..438767Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:437972..438237TCONS_00000535-exon-sc0000002-1510915933:437972..438237Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:437436..437777TCONS_00000535-exon-sc0000002-1510915933:437436..437777Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:436908..437064TCONS_00000535-exon-sc0000002-1510915933:436908..437064Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:436212..436380TCONS_00000535-exon-sc0000002-1510915933:436212..436380Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:435665..435843TCONS_00000535-exon-sc0000002-1510915933:435665..435843Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:434944..435203TCONS_00000535-exon-sc0000002-1510915933:434944..435203Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:434444..434661TCONS_00000535-exon-sc0000002-1510915933:434444..434661Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:433719..433873TCONS_00000535-exon-sc0000002-1510915933:433719..433873Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:432320..432854TCONS_00000535-exon-sc0000002-1510915933:432320..432854Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:431913..432079TCONS_00000535-exon-sc0000002-1510915933:431913..432079Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:431547..431600TCONS_00000535-exon-sc0000002-1510915933:431547..431600Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:430142..430334TCONS_00000535-exon-sc0000002-1510915933:430142..430334Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:428573..429277TCONS_00000535-exon-sc0000002-1510915933:428573..429277Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:427871..428094TCONS_00000535-exon-sc0000002-1510915933:427871..428094Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:427386..427612TCONS_00000535-exon-sc0000002-1510915933:427386..427612Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:426778..426851TCONS_00000535-exon-sc0000002-1510915933:426778..426851Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:426308..426364TCONS_00000535-exon-sc0000002-1510915933:426308..426364Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:425518..425589TCONS_00000535-exon-sc0000002-1510915933:425518..425589Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:425254..425310TCONS_00000535-exon-sc0000002-1510915933:425254..425310Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:424836..424934TCONS_00000535-exon-sc0000002-1510915933:424836..424934Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:421648..421722TCONS_00000535-exon-sc0000002-1510915933:421648..421722Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:421227..421308TCONS_00000535-exon-sc0000002-1510915933:421227..421308Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:420664..420806TCONS_00000535-exon-sc0000002-1510915933:420664..420806Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1510915933:418855..420451TCONS_00000535-exon-sc0000002-1510915933:418855..420451Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:441946..442205TCONS_00000535-exon-sc0000002-1491911889:441946..442205Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:441564..441704TCONS_00000535-exon-sc0000002-1491911889:441564..441704Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:440559..440675TCONS_00000535-exon-sc0000002-1491911889:440559..440675Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:440273..440317TCONS_00000535-exon-sc0000002-1491911889:440273..440317Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:439824..439973TCONS_00000535-exon-sc0000002-1491911889:439824..439973Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:439344..439404TCONS_00000535-exon-sc0000002-1491911889:439344..439404Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:439044..439118TCONS_00000535-exon-sc0000002-1491911889:439044..439118Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:438552..438767TCONS_00000535-exon-sc0000002-1491911889:438552..438767Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:437972..438237TCONS_00000535-exon-sc0000002-1491911889:437972..438237Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:437436..437777TCONS_00000535-exon-sc0000002-1491911889:437436..437777Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:436908..437064TCONS_00000535-exon-sc0000002-1491911889:436908..437064Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:436212..436380TCONS_00000535-exon-sc0000002-1491911889:436212..436380Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:435665..435843TCONS_00000535-exon-sc0000002-1491911889:435665..435843Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:434944..435203TCONS_00000535-exon-sc0000002-1491911889:434944..435203Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:434444..434661TCONS_00000535-exon-sc0000002-1491911889:434444..434661Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:433719..433873TCONS_00000535-exon-sc0000002-1491911889:433719..433873Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:432320..432854TCONS_00000535-exon-sc0000002-1491911889:432320..432854Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:431913..432079TCONS_00000535-exon-sc0000002-1491911889:431913..432079Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:431547..431600TCONS_00000535-exon-sc0000002-1491911889:431547..431600Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:430142..430334TCONS_00000535-exon-sc0000002-1491911889:430142..430334Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:428573..429277TCONS_00000535-exon-sc0000002-1491911889:428573..429277Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:427871..428094TCONS_00000535-exon-sc0000002-1491911889:427871..428094Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:427386..427612TCONS_00000535-exon-sc0000002-1491911889:427386..427612Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:426778..426851TCONS_00000535-exon-sc0000002-1491911889:426778..426851Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:426308..426364TCONS_00000535-exon-sc0000002-1491911889:426308..426364Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:425518..425589TCONS_00000535-exon-sc0000002-1491911889:425518..425589Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:425254..425310TCONS_00000535-exon-sc0000002-1491911889:425254..425310Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:424836..424934TCONS_00000535-exon-sc0000002-1491911889:424836..424934Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:421648..421722TCONS_00000535-exon-sc0000002-1491911889:421648..421722Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:421227..421308TCONS_00000535-exon-sc0000002-1491911889:421227..421308Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:420664..420806TCONS_00000535-exon-sc0000002-1491911889:420664..420806Clytia hemisphaericaexon
TCONS_00000535-exon-sc0000002-1491911889:418855..420451TCONS_00000535-exon-sc0000002-1491911889:418855..420451Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:418855..442205 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.378303 0.183574 0 0 7.64266 3.24346 3.3913 6.65311 2.64515 8.84252 3.58379 2.74668 2.71265 3.09913 0.989666 0.844028 1.1436 1.23608 0.48497 1.03195 0.922926 0.77365 0.777361 0.384838 5.82586 8.83086 0.345274 0.576877 0.256204 0.669726
Blast
BLAST of TCONS_00000535 vs. Swiss-Prot (Human)
Match: PSME4 (Proteasome activator complex subunit 4 OS=Homo sapiens GN=PSME4 PE=1 SV=2)

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 433/1028 (42.12%), Postives = 631/1028 (61.38%), Query Frame = 1
Query:  106 PQKLIVYNKHLPYSIKKEAER--QLSEIKYNLSRAVILQEINPGLSIWFDRFIIYLRLHGRNFTKEDHVLFINLFLNLMEMPEMGPSGIKGIAMXXXXXXXXXXXXTRNDLTISWRPLYELVKSIKYSKLTPVGLERFPSKYVETILSVIKYARSYFPVEATQEMLLEFRPLLCPTDATKTNAALYLSLFLPTKIERGTESKTYLLWLDELMEYWFHCTT-SNVASVYLRLFSRLAEDNAGYLDWSKYINRIFNFFFCKLSLPINGMRRGFDLKGTMSNSADFAK---WFVYMMGGEQGTVIFDKLEKLFVTLKSFYHPSNYDKHSSVLLGFLNALTSAFVMRLNHERYRKPSWTVDIPEKSKITDAEIERYVNIVKEVALLSVYSKQGSXXXXXXXXXXXXXXXXXVIPQLLQSTFEALETLVEPHQVTATLMCITSVARPLASGGGCFPSAXXXXXXXXXXXXXXXXXNDFRKSMCAFNFISAIVSLIPLVNCMPAVHAGIEMSEVEKELCLASEQFEDLILQFFDRCFVLVENSTTENITQQDSTLDSTASAQDSMLGRSLVSTVQVVFMQCSKALFEVALDALFRFVSSRVLEVDVAGKLVSDMCRGAVRARPKETLKKMLPYITNRVINLATVEGVQNEEHVDPELLWYLEMLSELGRCNGMELLQYKEVLKEVIKLTIHMKCKKAYSRAAQLLKSILCSVSEVYITEWMSVHYGFDLPPMEHFYIRDWGKPYPLDELNPKWHSPSQEEMQFADELLKEFLVPELELLKEIINGRV-LTRDEIHQHLQIIATCLYGAANLLPNWTDKRVEGVALPTLVSRECILNTVNLSDVEKFVCCINRKDVVYQ-MHNFFNFMSKTHEDDTKSFRMLARIYDILVLHNGVHWSDFNLRWKSASAVKKALADRLHGNKMHVRAVQIERVQLQHDMRVLDQHAAAFSVTDKVVIDDLLFMSTSEYAEVRIHSQKILFGCLEAFDVATRYVLPKMLENIHPKAQ-VSHEKLKGTLYIL--QYSRIVYMLIHDW 3156
            PQK IVYNK LPY+ + +AE   QL++IK NL RAV LQE+ PG   W  +   Y+RL+GR F+KEDHVLFI L   L+ +P++  S ++G A LL  LLKK+ELL+R DL + WRPLY++V+ I YSK   +GL  FP+     + +++K  R YFP +AT EML E+RPL+CP D T   A  Y  +FLPT +      K + LW DEL+  W             + LF+RLA DN GY+DW  Y+ +IF      L+LP+   +    +   ++N+ D      W   MMGG    ++   L  LF ++ SFYHPSN  +  + L+  L  L ++ V RL+ ERY+KPSW   +P+  K+TD ++  +V  + +  LL+++SK GSL+AA  LQNLAL+R +LVIP +L+ T+ ALETL EPHQ+TATL C+  VAR L SGG  FP  PT++LPLL   LPG+DPNDF K M  F FI+   +L+PLV+C   +    +++EVE+ELC A+ +FED +LQF DRCF L+E+ST E   ++  T     +  +S++   L ST   +  QCSK +F VAL  +F F +S + E  VAG++V+DMCR AV+  P+E+LK  +P+  + +  L   + V N+E +D ELLW L++LSE+ R +G +LL Y+E L ++++ T+H+ CK+ Y+ +  LL  +L S + +Y TE+ SV  GFD PP E+F I+DWGKP  L  L  +WH PS EE+ FA  LL  FL PEL  L+   +G++ ++RD+I Q L I+  CL G+ NLLP    + V  + +P++VS E    T   + +E  +   N ++V+   +    N +    EDDTKS  ++ +I   L+   G H  +F+ RWKS + VKK++ +RLHG K H+RA+ I+RV LQH++R L      +    + +I DLL +STS Y++VR  +Q+  F  L A++   R ++P +LE + P  Q V+ ++ KG LY L   +S +    +HDW
Sbjct:   28 PQKEIVYNKLLPYAERLDAESDLQLAQIKCNLGRAVQLQELWPGGLFWTRKLSTYIRLYGRKFSKEDHVLFIKLLYELVSIPKLEISMMQGFARLLINLLKKKELLSRADLELPWRPLYDMVERILYSKTEHLGLNWFPNSVENILKTLVKSCRPYFPADATAEMLEEWRPLMCPFDVTMQKAITYFEIFLPTSLPPELHHKGFKLWFDELIGLWVSVQNLPQWEGQLVNLFARLATDNIGYIDWDPYVPKIFTRILRSLNLPVGSSQ--VLVPRFLTNAYDIGHAVIWITAMMGGP-SKLVQKHLAGLFNSITSFYHPSNNGRWLNKLMKLLQRLPNSVVRRLHRERYKKPSWLTPVPDSHKLTDQDVTDFVQCIIQPVLLAMFSKTGSLEAAQALQNLALMRPELVIPPVLERTYPALETLTEPHQLTATLSCVIGVARSLVSGGRWFPEGPTHMLPLLMRALPGVDPNDFSKCMITFQFIATFSTLVPLVDCSSVLQERNDLTEVERELCSATAEFEDFVLQFMDRCFGLIESSTLEQTREETET--EKMTHLESLVELGLSSTFSTILTQCSKEIFMVALQKVFNFSTSHIFETRVAGRMVADMCRAAVKCCPEESLKLFVPHCCSVITQLTMNDDVLNDEELDKELLWNLQLLSEITRVDGRKLLLYREQLVKILQRTLHLTCKQGYTLSCNLLHHLLRSTTLIYPTEYCSVPGGFDKPPSEYFPIKDWGKPGDLWNLGIQWHVPSSEEVSFAFYLLDSFLQPELVKLQHCGDGKLEMSRDDILQSLTIVHNCLIGSGNLLPPLKGEPVTNL-VPSMVSLE---ETKLYTGLEYDLSRENHREVIATVIRKLLNHILDNSEDDTKSLFLIIKIIGDLLQFQGSHKHEFDSRWKSFNLVKKSMENRLHGKKQHIRALLIDRVMLQHELRTLTVEGCEYKKIHQDMIRDLLRLSTSSYSQVRNKAQQTFFAALGAYNFCCRDIIPLVLEFLRPDRQGVTQQQFKGALYCLLGNHSGVCLANLHDW 1046          

HSP 2 Score: 461.07 bits (1185), Expect = 4.424e-132
Identity = 290/854 (33.96%), Postives = 467/854 (54.68%), Query Frame = 2
Query: 3179 YSRIVYMLIHDWKLMASSWIPIV-----QANQSEKPSIVKLLNYLIRKIQSKFETMKIERKIGESASKVAKQLLETKSPEARTSLSDSPADDSVYPSDKFMKMGQDKCTKKNEENLANYRRLEQDLSKLLQDTSIHWRCSEMCTKLMNLLLNNEVKSCHEVINTFLNLLVNDSHL-LRQVKIYXNTFLNLLVNDSHLLRQYAIRGIMAVLYQYKPQFAKRKLNYPEHNIDASPDVLMKLMPGDNRTDNQWLQYNDTNPINSQEDLERFSFIDKTHWGYQTWPLELDILSNQADFYTKIRNKDCLCKEENLIVDTLNNSEYLEKFIKFHSMEVKKGEDRFQHIHYTLFKGLFRNYGPSMFELFRPVVNDLLAGNNESKHRLAIEIIAGMIRGSKHWNYESLTMFWDFMVPLLQNVFVSNVMEETVKDWILALVVSTESHDPNRFHRLFTMLLNNPINGDGGSQGDTNRLFIIRKTLGQQEWRLANVNHNMMKYLLPHLTHPFQNVREKVGSLVSYILLFDLKYASHTPTLSPRCEMFVDYVYEDILKLYQITLGEIEAHEHQNEAMEIDGVGVTEETKKLERMAKTVLSFLVNKSA-NFQPVNKALYRIIPLLLVLESREDD---PELVGLCKYTFPALASKQLPDDLAQPAIQSIIQVCYNKKSWNLRRTGLNYLMMMVFHNLYI-LDDEATRNQLQEMLIERLKDEQVEVREIASKLLSGLVHFGYFSITEELLSTFHTMAKIKMKKKRHGIELTQAQTDKNVLALQVKHXXXXXXXXXXXXFPYDVCTWIPEVVIDLGNYLHEVPQISATAKKTLSEFRRTHHDNWHIHQQQFTDDQLSALTDLLISPSYYA 5707
            +S +    +HDW  +  +W  IV     QA   EKPSIV+L + L  KI  ++ET+ ++  I +S  ++A+ L ++K+P            + +  S + +K G  +  +KN + L NY  L   L   ++  ++ W+                    H  I     LL +D  L LR ++     F+  L +D+ ++R+ AI  +  +L Q K    K  +N  E  I   P    +++ GD R DN WL Y+      ++++ E   F++KTHWGY TWP  + + +   +     R+++ + + E +I D  ++ +++E+ I F S+E +KG+D+F    + LFKG+FRN+  +   + +P +  L+A ++ES  R   EIIAG+IRGSKHW +E +   W+ + PLL+   +SN+  ET  DW   +  S ES DP + H LF +LL +P++G+GGS  D  RL++++  L QQEWR+  + H ++KYL P LT  ++NVRE++GS+++YI + D+   + TPT+SP    F   + E +  L  +        E QN  ME +G+G  +E  +  ++ KT+L +L+  +  +F        +++PL   +   E+D    EL    K    +L S+ L      P +  +++      SW+ R T L YL  MVF+NL+I L++E     ++ ++I  L+DEQ+EVRE+A+  LSGL+   + ++   +   F  + K K+ KKR     +   T  +   L  +H GVLGL A VL+ PYDV TW+P+++++L  +L++   I  T KKTLS FRRTHHDNW  H+QQFTDDQL  LTDLL+SP YYA
Sbjct: 1035 HSGVCLANLHDWDCIVQTWPAIVSSGLSQAMSLEKPSIVRLFDDLAEKIHRQYETIGLDFTIPKSCVEIAELLQQSKNPSI----------NQILLSPEKIKEGIKRQQEKNADALRNYENLVDTLLDGVEQRNLPWKFE------------------HIGIGLLSLLLRDDRVLPLRAIRF----FVENLNHDAIVVRKMAISAVAGILKQLKRTHKKLTINPCE--ISGCPKP-TQIIAGD-RPDNHWLHYDSKTIPRTKKEWESSCFVEKTHWGYYTWPKNMVVYAGVEEQPKLGRSREDMTEAEQIIFDHFSDPKFVEQLITFLSLEDRKGKDKFNPRRFCLFKGIFRNFDDAFLPVLKPHLEHLVADSHESTQRCVAEIIAGLIRGSKHWTFEKVEKLWELLCPLLRTA-LSNITVETYNDWGACIATSCESRDPRKLHWLFELLLESPLSGEGGSFVDACRLYVLQGGLAQQEWRVPELLHRLLKYLEPKLTQVYKNVRERIGSVLTYIFMIDVSLPNTTPTISPHVPEFTARILEKLKPLMDVD------EEIQNHVMEENGIGEEDERTQGIKLLKTILKWLMASAGRSFSTAVTEQLQLLPLFFKIAPVENDNSYDELKRDAKLCL-SLMSQGLLYPHQVPLVLQVLKQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNEDAVKDIRWLVISLLEDEQLEVREMAATTLSGLLQCNFLTMDSPMQIHFEQLCKTKLPKKRKRDPGSVGDTIPSA-ELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHDNWQEHKQQFTDDQLLVLTDLLVSPCYYA 1843          
The following BLAST results are available for this feature:
BLAST of TCONS_00000535 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PSME44.424e-13242.12Proteasome activator complex subunit 4 OS=Homo sap... [more]
back to top