Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000532 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000532
Unique NameTCONS_00000532
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1890

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000532 ID=TCONS_00000532|Name=TCONS_00000532|organism=Clytia hemisphaerica|type=transcript|length=1890bp
ATTAACAAATCTTATCAATTTGGCTTTACATAGGAACAGTATTGAAAAAG
TTGGAGATTTCTTTAATCATTTACCGAAGCTGAAATTCTTTGATATGTCT
TTTAACAAATTGACAAGTCTACCAGAGCAATTAAATTTAGGTACTGTACA
CACGTTGAATTTATCTAATAACGAGTTGGCGTCTTTAGGTGATCTAAGTG
GGGCTGTTAATCTTAGTATTTTACACATAGAACACAATGAGCTAGAAGAA
TTACCTACAGGGTTAGTCACCTTAAAACATCTATTAGAAGTGCACGCCAG
CAATAACCTAATAAACACCTTACCTGACGATCTACACACTTTTCCCGCGC
TGAAATTATTTGACGTCTCCGAAAACAAGTTGAAAGAAGTACCACACTCA
ATGTCTCAATGCCAACGTTTGAAGACGCTCAAACTTGAAGGGAACCCCCT
GAAAGATAATCGATTACGTAAGATGACAACACAGTGCAATACTAGAGCTA
TACTGGAATACATTGCCAAGCAGAGTGGTGGAGACGGGGGTAAGAAGggc
aaaaaaggaaagaaagggAAGAATCAACCGGTTAAGGAAGAAGCAGAAGA
GAACGTCAGACGTATCGTGATCACTCCGAACACGGATGATGAGAAGCGTG
TCATATGTGACGCCTCCGTGAAAGACGTACGCCCGTATTTGTGTTGCACC
GTCATAAAGAATCTTGACCTGTCGGATGAAATTGTCTTCAAAAACTTCTT
ATCCCTACAAACGAAACTTCACGAGAATGAATGTGACATGCGCACACGTG
CTACCATTGCAACCCATAATGCAACAGGATTGAAATTCCCGCTTGTTTTC
AAAGCTTCGCATGTGGGTCAGACTGTCATCCATGCATTAGGGAAAAAGAA
ACAATGCAATGCGACAACATTGATACAGAATCTGAAAGATGAAAGAGATG
CATTGAAgcagaaaaagaaaagacaacCGAAAACTGGATTGTACAAGTTT
ATTGAACTGGTGGATGGACAGGAGATGATAGCTTCAGTTCGAAATCAAGA
TGGTGACGTCATTTCGTTGCCTCCGATCACTAATGGTGAAAAAACCaagA
TCGGTGCTTCAGTTGGTGATGTTTTCATTGAAATATCATCACCAGTCAGT
ATCGCACAATGCAAGTACGTTATGGAAGAGTTGATCAAGAAAATGTTCCA
ACAGAATTTCAACTCGGACATGGAAAGTGATGAAGGGCTTTGGATTGAAC
CAATCAGAGTTGtggatgaaaatgaagatttgagaATAGTTTATCCCTCT
AAAATTGATAtcgatttttcaaatattccaGTCAAACGACTGTGAAATGA
TTTGATTGACCGGATTTAGACGATTCTACTACTTCCCAGGTTTTCCATCA
TTGTCTTTGAAGATGATATCATGTATAAGGACTTTGAACTTGGCTTTGAA
GGATTGtacttcaaaataatttgatgttGCATCCTTGACTAGTCAGTCAT
TTGgttgattttcatatttttggtcATCACTCAAAAGGACTGTTGAATTC
TGTCCAACATATATGTCATCAACTGCTGTTTCATTCCACGAAGTTGTATT
TGAAGTTTAGATTTTTTGAacgaatttaaatatttccGAAAACATAAATC
TATAATTAAGTCGATCAAAGACTCTATAACTACCTTTGTTAAATGCCCTA
AATTCTACCAAGGAAATCGAGTGCTATTACGACATTTAGTGTAGTGCCAG
TGTTGATAAACGTTGATCAAAACTCGCCTATCTGTCGCCCATCAGTCAAT
TCCgtgacaaaattatttttaagcaTCTCGTTAAGTAAGTGTGCTCAATT
AAAAGAAACATCTTTAATAAGTTTCTGTTTATCAGTCCca
Run BLAST on NCBI

transcript from alignment at sc0000002:400832..413686-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000532 ID=TCONS_00000532|Name=TCONS_00000532|organism=Clytia hemisphaerica|type=transcript|length=12855bp|location=Sequence derived from alignment at sc0000002:400832..413686- (Clytia hemisphaerica)
ATTAACAAATCTTATCAATTTGGCTTTACATAGGAACAGTATTGAAAAAG TTGGAGATTTCTTTAATCATTTACCGAAGCTGAAATTCTTTGATATGTCT TTTAACAAATTGACAAGTCTACCAGAGCAATTAAATTTAGGTACTGTACA CACGTTGAATTTATCTAATAACGAGTTGGCGTCTTTAGGTGATCTAAGTG GGGCTGTTAATCTTAGTATTTTACACATAGAACACAATGAGCTAGAAGAA TTACCTACAGGGTTAGTCACCTTAAAACATCTATTAGAAGTGCACGCCAG CAATAACCTAATAAACACCTTACCTGACGATCTACACACTTTTCCCGCGC TGAAATTATTTGACGTCTCCGAAAACAAGTTGAAAGAAGTACCACACTCA ATGTCTCAATGCCAACGTTTGAAGACGCTCAAACTTGAAGGGAACCCCCT GAAAGATAATCGATTACGTAAGATGACAACACAGTGCAATACTAGAGCTA TACTGGAATACATTGCCAAGCAGAGTGGTGGAGACGGGGGTAAGAAGGGC AAAAAAGGAAAGAAAGGGAAGAATCAACCGGTTAAGGAAGAAGCAGAAGA GAACGTCAGACGTATCGTGATCACTCCGAACACGGATGATGAGAAGCGTG TCATATGTGACGCCTCCGTGAAAGACGTACGCCCGTATTTGTGTTGCACC GTCATAAAGAATCTTGACCTGTCGGATGAAATTGTCTTCAAAAACTTCTT ATCCCTACAAGTATGCATTTTATTTACTTNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAA GCTTCTGGGCCACCTGGATTTCTCACCTGGGTATCCATAATGGCGGATTT TTGGTCATGTGACCCCCGTAGGCAAAACTGAAAATTCTTCCAACCCGAAT ATAGGCATATCATATATCAATCGATCGGAAATTCGATACTGATTAATTTT GAGATACAAAGTTGAGTCTGAAAACTTTTCTATCTCGAGATATAAATCAC TTTCGTTTTCTCAGGTTTGGCTGCAGTTGTAGGCGGGCTTTCATGGAGTG AGGCAATTCTTTTACTCATATCTCAAGAAATATGCTTTTAAACATATCAA AACTTTATGTGCTCCTAGAAAAGGCATTAAAAATTGTTTGTGCAAATTTT CAATAAGTTTGCAGTAAAAATGTGTATTTTACAGACCAGAGTACAATTTC CTTACCGTTGAAAAAAGATCTTTTTCTCTCATAATTAGCCTTTTTGTCTG AAATGAATGAGTGAAATGTTTCCCAATAGGGTTTAAAACCAATCACTTAT TCGTAATCTCACTCAGAGGGGTACTTAGCAACAAGTAAGGGCTAAATGTA TCCGGTCAGCACTTTATAAGTACCTATGATTTACGGTAAGACATGATCCC AAAAACGGTGAAATTTCCAAATAATTAATGAAAAATTCTCTCATTGCATC TCAACATTAAACGAGAACCTTCTGTTCTTTAGATTGACTAATGCAAAGAA TTATGAATAATGTAAATCGTTACAGTGTGTATTTTTACAGACCAGATTTA AGTGCTTCTAGGAGCTTGTCTTGTTCTAAAACGCTTTGGATTACTACAGA AATTCGCGAACTTGAGAATTTACTGAGTTAATCCGTCAAAATTCGCCAAT TCCTTTATCTTTATTGTTCATGCATGAAACGAGATTTAGAGGGCTTAGAA TCTGTGTTGTCTGTAGGGCCAAAAAATGTCGGCCTAATATGGCTTCGAGA GGCGATAATCCTAGGCCATTGTAGGAAGCCTAGTGATGGAGCCATTTTTG TGAACCTGCTTGGGGCTATTCTGGTTACTGTTACAATTATAAGAGGCGTA TAATGGTCCAATGCATCATTGTATATCCGCTTTAACTACATGAATGCAAC ACAACGCCTTCAGCTAGTTGAATAAGTCAGACTGTGGGAATTTTAACTAA AAGCACTTTAAAGAAGTTATTGCCATACAAAATAATGCTTTAAGCTACAT GTCCAAAATATCCCCGTTTTCTTACAAAAATCTTAGTATAATATTAAGCA ATCTTGATTTTAAAATTCTTATTTGTTTCGGACATGGCTTGCTGATGACG GTGATCCCATTTTCCTTTCCCCTCATGAGGTTTTGTCAGAACATGAACAA ACGACGGGACATCCTTCTCCTTCGTAAGCACTGCTAGCTTCGTTGCCGCC TCGTTAAAACATAAAATGAAACAATAGGTTTTGATGATCTACCTTGGGAA TACCTTGCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNTGTTGTTCTACTCTTCTCCAGTCTTTTATCTATATCATAACAA AGATAACAGATGCGAAATCATCGTCATTTTTCTAAACTCCGATGAAATAA TATCGAGTATATAGGATTGAGAGCATAGGATTCAAATTATGATATTCTTA TGACACAGGCTCACAACTTTGGCATACCTTTTTTTTTTCAAGTCAATAAA AAAACTAATTGGAATGACAAAAGTGATTCAAAAGTATACACACAGTTGAA ATTCTCCATTTCAGCGTATAAAAAAAATTGAAAATAATTATTTTGTGACT TGAGAGAAACTAGCCGTATGCGCAGCGTCGCACGCTGCATGTCCCAATCC AGCAAATCACATCTAAAAAAAACCCAACGGAAAAAGGATTGCTGCTGATT GATGATAAGATTTTGATTTTATAAAAGAAAGGAGAAAAAAGTTCAACGCC ATGAAGAGGAGGCTTTGTAGAGCTTTGTTAGATTTTCGAAAACNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACGTTGTAAACACACACG TTTTAGCATATTAATATATAGATTTTCAAACTATCAAGCTATCTATCAAT CATTTTACCTAAGTAATTCAAAGAAATAGCATTGTGATGGAATATCAACG GATTTTTTATACCAATTTTAAAATACAGGCGGCTACAAAGACACCATGGA AGATAGACGTCCAGTTATGATTTATCCCATGTGAAGGTGCAGTAGTGTAC CAAGTATTGACCGTCGTCTAGGAGATCAGGACTAACTCCAACTCGGTGCT GTGTTTCACTTAATGAAAAGTAAATGCTACTTTNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCTCAAAGAC AGGCTACACAGATTTCTCGTTACATGCATGAATAATAAAGATATAGGAAT TAGAGGATCTTGACGGATTTTACTCAGTAAGATTCTCCAGCTCCGGATTT TCCATGGTAAGTCTAAACATTTTAGGGTAATATAACCACCTAGAAGCACT TAATTCTGGTCTGTAAAATACACACAGCGATTTACATGTATTCTTGATTC TTTGCATGTGTCAAACTAAAGAATAAGGTTCNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNCAACTTTGTTTAATGTCGAGATACAATGAG AGACTTTGTCAAATATTTGAGTAATAGCTTGGAAGTTTCACCGTTTTTTG GATCAAATCTTACCAAAAAAACATACTGATAAAGTGCTGACCAGACACAT TTAGCCCTTATATATTTCCCAGGTACCTCTCGAATATAATATGAAGAATC GAGTGGCTCTAAACCTTATTAAGCATCATTTTACTAATTCATTTCAGACA AAAAGGCCAATTTTGAGTAGTCTAGCAAGCTAGAAGACTAATTCAGATAT AGTAGAAATAAAACAAAAAGTAATGGAGGGAACAAATTTTAGTCGTCTAG AAACCTTTGTGCAAGCCAAAAGCTTCATATTAATATTGCTTTGCTATTGT TAATGAAAAAAAAATCTAGGGGGCTTGTTCGGAAAAAAACGGTTTGTTTT GATTTCGTAAATCGATTTAATTGGTTTAGAAAAAACAATCGAGACGCACA CCATTGGTCGAAATACATAAAAAGAGAAATCAGAACACACAACAATTTTC TTTCTCGAAAAATTTTTCTCGTTTGTTTTAAACTAACTCCAAACAAAAGA AAAGTGTCATGTCAATATTGCAATTATAATTTTTCTTCCCGCTCAAAAAA AATTTTCTTTAAAAAAAAAGTGTGTTGATTTGTTGTGTGTTAAATTTTAT TTTATTTTTCGTCTTTCATTTTGTTTTGAGAGTTTGTTGTTGCTTGATCA AAAATTAATTTCTCCTTACCTTTCGCGCGCCAAATTCTTACGGAAGCACC CCTGTCCGAGAAAAGCTTTCTTTTGTTTTCAGAAAAAACNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNCCCGTAACAATTATCGTATTATCATATAACGCCT ATACTACTGTATTACACGCATTATAAACGACTCCAGTCTAAATTTTGAGA AAAAAAGATCTTTTTTCGACGGTAAGGAAATTGTACTCTGGTCTGTAAAA TACACATTTTTACTTCAAAATTTTTGAAAATTTGCACAAACAATTTTTAG TGCCTTTTCTAAGAGCACATAAAGTTTTGATATGTTTAAAAGCATATTTC TTGAGATATGACTAAAAGAATTGCCTCACTCCATGAAAGCCCGCCTACAA CTGCAGCCAAACCTGAGAAAACGAAAGTGATTTATATCTCGAGATAGGAA AGATTTCAGACCCAACTTTGTATCTCAAAATTAATCAGTATCAAATTTCC GATCGATTGATATATGATATGCCTATATTCGGGTTGGAAGAATTTTCAGT TTTGCCTACGGGGGTCACATGACCAAAAATCCGCCATTATGGATACCCAG GTGAGAAATCCAGGTGGCCCAGAAGCTTAANNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNCTTATGTGCATGTTTTGAGTGTATTTT TAAGCAATCTAGAGCTCAAATTTTCAAAATTTCCCCCCTCGGGCCAAACC ATGGTTGGCCCTTGCGGTGTCACTAAACTTCAGCCCCCCCAATATGAAAA TGCTTCCTACGGCACTGCCTCAAGGAAACTAATTTTAGCGGGAACTAAAT TTCGCGGTCGAAAAAAAATATGGAAGAAATGACTTTGGAATTAATTTTCG CGGTTTTGCCCTATTTTGGAGATTATTTTTTATTTTCCGAGCGTTTTTCA AATTTTTCGATGGAAAATGGTCGAATTTACGGAAATTAGTTCTTGCGAAA ATTTGTTCCCTTAAGGTAACTGAAAGTTTGACAAAAGTGATGCTAAAATC AGGTTTAAATTATATTTCTCTTTCTTTACAGACGAAACTTCACGAGAATG AATGTGACATGCGCACACGTGCTACCATTGCAACCCATAATGCAACAGGA TTGAAATTCCCGCTTGTTTTCAAAGCTTCGCATGTGGGTCAGACTGTCAT CCATGCATTAGGGAAAAAGAAACAATGCAATGCGACAACATTGATACAGA ATCTGAAAGATGAAAGAGATGCATTGAAGCAGAAAAAGAAAAGACAACCG AAAACTGGATTGTACAAGTAAGGGATATTCATTCTCTCGAGACCTATTTC ATATAACAGATGCGAAAGGTTGCTTGACATTTTTTTGTGAAGTGTAACGG ATGTTTGTTGATTTGAGGAGTGAGCGAAAAATATCGAAGAAATTCTCAAA TACCTATTCATGACATTTGACAACCAATAGGGGGCTTACCTGAATTTATC AACAAGGACTCGTTTAGCCTGATTCGCAGACCTCTACAAAACCGCAGATA GTATAAGAGCACGAATCCGTCAGGGGATGCCAGCAGCCTAGGATTTATGT TTTAGTAGATCTTTATGATCTAATGAAGTGGAGCGTATAAAGGTAGAGCA TTCGTCTACGGTGCGCAAGGTCGCGGGTTCAATCCTCGGTCTGATCATAA CCAAAGACTTCGTACACTGTACAAAATGGTACTTAAGGACTCTCTGCTCC TTACTCAGCAATTAAGAGAAGGAGTATTAAGAGTGGAACCCTACCTACCT TCGGATAAATAACTACCGAAAGATGAGTGCTCAGGTCGCTGCCGTCTGTG GTTGCAAGCCTTACTTATTATAGATCTCTAATCAATTTGTTTCACTTTCT TCTGAAGGTTTATTGAACTGGTGGATGGACAGGAGATGATAGCTTCAGTT CGAAATCAAGATGGTGACGTCATTTCGTTGCCTCCGATCACTAATGGTGA AAAAACCAAGGTATTTTTTTTTTCCGATACTAGTATAGTACCTGTTTCAA CTTGATAAAGGCAAACCGTCGAGACGTCGAATACAAAACTGTGTGTTTTT AATGTTCACCTTTTCCTGCTTTAGATAGAGAGAGGAGAACCTATTTTTTT TTCTCGATTCAGATTTTACCAAAATCTCAGTCAAAACTTCTGGAAATCAT TTAAATTGATTTTTCCTAACTTCAAGATGTAAAAAAAGGTACACTTATGC CTCGTTACGCAGCGTCCTTCCCCTCATGAGTTTTTGGACCTACTTCGGAG TTCGTCCGTCCGTCTGTTACCAGCTTTTCTCTAGATTGGCTCATCAGTTT TTTCTGATTTTTAGCACAAGGATGCAAAATGGCAATGCCCAAAATGTGAC GGAACCCGATTTTCGAAAAAAAAAACTTTCCACCGGAAAAACTGTTTTTT TTGTTTTTTTTCGAGATTTTATTTTTTGCTCAAAGATGCGTATTAACAAT GCCCTAAACATGGCCGAGTCCGATTTTTGAGAAAAATTTTTTTCCGGCCG AAAATGCCGGAAATATGCCGGAAATCGCTGTTTTTCTGGATTTTCATTGG ATTTTTTTCTTAAAATTGCTTGTTTTTTCATTCAAAAACATTATTAATAG CAATGCCCACCATCAAGCATGTTTTAATTTTCAAAAAATTTGATTTTTGA AGCCGGAACTATTCAAAAATCGCCGGAACAACCTATTTTCGCCGGAAAGA CAGTATTTCTTGAATTTAATGAGCTGTGCTTAATATTTTTTAATTAAATT TTGCACACTGATGCAAAATGACAATACCTAAAATGTGACGGAGCCTGATT TTCGAAAAACATTTTTTTCTGGCCGAAAATGCCGGAAAAACCGGTTTTGT CTGATTTTTTGCAGAAAGATGCGTATTCGCAATACTAAAAACATGACCGA GTTTGTTTTTTTTGAGAAAAATTCTTTTCCGGCTGAAAATGCCGGAAATA TGCTGGTAATTACTGTTTTTGCAGATTGTCATTTGACTTTTCCCTCATTC TTTGTTTTTTCACACAAAAACATTTGCCCACCATTAAGCATGATTAAATT GTCAATAAAACTGATTTTTGCAACTGGAACTTGCTATTTCTATTTTTTCC CTACTCCCCTTCCCTCTTCCCCCATCAACAATCAATTATAAAATTGAATG TGTTATGCATTTTTGCAAAACGCTATATCGTCTGACTGATTGTTTTCATT TTTCTCCTTATTGCTATCTAGCTTTCATCATCAGGTAGGTCCATTCAGCA TGTTGCTTGTTGAAATATTTAGACTAGATTTCATAATTATTCCCTTTTTT TCTTTTCCCTACAGATCGGTGCTTCAGTTGGTGATGTTTTCATTGAAATA TCATCACCAGTCAGTATCGCACAATGCAAGTACGTTATGGAAGAGTTGAT CAAGAAAATGTTCCAACAGAATTTCAACTCGGACATGGAAAGTGATGAAG GGCTTTGGATTGAACCAATCAGAGTTGTGGATGAAAATGAAGATTTGAGA ATAGTTTATCCCTCTAAAATTGATATCGATTTTTCAAATATTCCAGTCAA ACGACTGTGAAATGATTTGATTGACCGGATTTAGACGATTCTACTACTTC CCAGGTTTTCCATCATTGTCTTTGAAGATGATATCATGTATAAGGACTTT GAACTTGGCTTTGAAGGATTGTACTTCAAAATAATTTGATGTTGCATCCT TGACTAGTCAGTCATTTGGTTGATTTTCATATTTTTGGTCATCACTCAAA AGGACTGTTGAATTCTGTCCAACATATATGTCATCAACTGCTGTTTCATT CCACGAAGTTGTATTTGAAGTTTAGATTTTTTGAACGAATTTAAATATTT CCGAAAACATAAATCTATAATTAAGTCGATCAAAGACTCTATAACTACCT TTGTTAAATGCCCTAAATTCTACCAAGGAAATCGAGTGCTATTACGACAT TTAGTGTAGTGCCAGTGTTGATAAACGTTGATCAAAACTCGCCTATCTGT CGCCCATCAGTCAATTCCGTGACAAAATTATTTTTAAGCATCTCGTTAAG TAAGTGTGCTCAATTAAAAGAAACATCTTTAATAAGTTTCTGTTTATCAG TCCCA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000325XLOC_000325Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000532-exon-sc0000002-1575043694:412927..413686TCONS_00000532-exon-sc0000002-1575043694:412927..413686Clytia hemisphaericaexon
TCONS_00000532-exon-sc0000002-1575043694:403670..403905TCONS_00000532-exon-sc0000002-1575043694:403670..403905Clytia hemisphaericaexon
TCONS_00000532-exon-sc0000002-1575043694:402977..403079TCONS_00000532-exon-sc0000002-1575043694:402977..403079Clytia hemisphaericaexon
TCONS_00000532-exon-sc0000002-1575043694:400832..401622TCONS_00000532-exon-sc0000002-1575043694:400832..401622Clytia hemisphaericaexon
TCONS_00000532-exon-sc0000002-1510915933:412927..413686TCONS_00000532-exon-sc0000002-1510915933:412927..413686Clytia hemisphaericaexon
TCONS_00000532-exon-sc0000002-1510915933:403670..403905TCONS_00000532-exon-sc0000002-1510915933:403670..403905Clytia hemisphaericaexon
TCONS_00000532-exon-sc0000002-1510915933:402977..403079TCONS_00000532-exon-sc0000002-1510915933:402977..403079Clytia hemisphaericaexon
TCONS_00000532-exon-sc0000002-1510915933:400832..401622TCONS_00000532-exon-sc0000002-1510915933:400832..401622Clytia hemisphaericaexon
TCONS_00000532-exon-sc0000002-1491911889:412927..413686TCONS_00000532-exon-sc0000002-1491911889:412927..413686Clytia hemisphaericaexon
TCONS_00000532-exon-sc0000002-1491911889:403670..403905TCONS_00000532-exon-sc0000002-1491911889:403670..403905Clytia hemisphaericaexon
TCONS_00000532-exon-sc0000002-1491911889:402977..403079TCONS_00000532-exon-sc0000002-1491911889:402977..403079Clytia hemisphaericaexon
TCONS_00000532-exon-sc0000002-1491911889:400832..401622TCONS_00000532-exon-sc0000002-1491911889:400832..401622Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:400832..413686 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 2.88475 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.0223 4.69116 0 0 0 0
Blast
BLAST of TCONS_00000532 vs. Swiss-Prot (Human)
Match: LRC47 (Leucine-rich repeat-containing protein 47 OS=Homo sapiens GN=LRRC47 PE=1 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.121e-62
Identity = 169/504 (33.53%), Postives = 252/504 (50.00%), Query Frame = 2
Query:    2 LTNLINLALHRNSI-EKVGDFFNHLPKLKFFDMSFNKLTSLPEQLNLGT--------VHTLNLSNNELASL-GDLS-GAVNXXXXXXXXXXXXXXPTGLV---TLKHLLEVHASNNLINTLPDDLHTFPALKLFDVSENKLKEVPHSMSQCQRLKTLKLEGNPLKDNRLRKMTTQCNTRAILEYIAKQSXXXXXXXXXXXXXXXNQPVKEEAEENVRRIVITPNTDDEKRVICDAS-----------------------VKDVRPYLCCTVIKNLDLSDEIVFKNFLSLQTKLHENECDMRTRATIATHNATGLKFPLVFKASHVGQTVIHALGKKKQCNATTLIQNLKDERDALKQKKKRQPKTGLYKFIELVDGQEMIASVRNQDGDVISLPPITNGEKTKIGASVGDVFIEISSPVSIAQCKYVMEELIKKMFQ----------QNFNSDMESD-----------------EG---LWIEPIRVVDENEDLRIVYPSKIDI 1312
            L  L +L L RN++   +      LP L+  D+S N L +LP    LG         + +LNLS N L  L  DL+  A  L  L++  N L+  P  L     L  L E+ A++N +  L  D+    +LK  D+S N+L E+P  ++ C +LK +   GN L+D RL KM + C TR+ILEY+       G   GK   + +    +E   +   R       D E++ + DA                        V+DVRPY+   V++ +DL      K FL+ QTKLHE+ C+ RT AT+ATH    +K PL++ A       I  LG+K +  A  L++ L+ E +  +++KKRQ  +GL++++ L+DG E    + + DGDVIS PPITN EKTK+  +  D+F+E++S  S+  CK VM+ LI KM +          +   SD E+D                 +G   L +E +RVVD    L++VYPSK D+
Sbjct:   74 LPQLHSLVLRRNALGPGLSPELGPLPALRVLDLSGNALEALPPGQGLGPAEPPGLPQLQSLNLSGNRLRELPADLARCAPRLQSLNLTGNCLDSFPAELFRPGALPLLSELAAADNCLRELSPDIAHLASLKTLDLSNNQLSEIPAELADCPKLKEINFRGNKLRDKRLEKMVSGCQTRSILEYL----RVGGRGGGKGKGRAEGSEKEESRRKRRERKQRREGGDGEEQDVGDAGRLLLRVLHVSENPVPLTVRVSPEVRDVRPYIVGAVVRGMDLQPGNALKRFLTSQTKLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRK-EAKAKELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEKTKVKKTTSDLFLEVTSATSLQICKDVMDALILKMAEMKKYTLENKEEGSLSDTEADAVSGQLPDPTTNPSAGKDGPSLLVVEQVRVVDLEGSLKVVYPSKADL 572          
The following BLAST results are available for this feature:
BLAST of TCONS_00000532 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
LRC471.121e-6233.53Leucine-rich repeat-containing protein 47 OS=Homo ... [more]
back to top