Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000523 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000523
Unique NameTCONS_00000523
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2034

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000523 ID=TCONS_00000523|Name=TCONS_00000523|organism=Clytia hemisphaerica|type=transcript|length=2034bp
GTTGGTATGGAGAATGGTTTCTTTCGAGCCTATCCTGGACATTTGATGAA
TCCTTCATACGATCCAAGAGCTCGACCATGGTATCGATTGATGATTGCAC
AAAAAGGAATAACTTTAACAACACCCTATCCAGATGCCTTTACCGGTGAA
ATTGTCATGACGCTAGGGAAAGTTCTACTGAAAGGAAAGAAGTCAGTAGA
AAAAGCAGGGAACATTGCTATGGATTTCAAACCACTCTACTTCAAAGAGT
TACTAGAAAGATCGATCAAAGAGTGTGCATCTGGAGCATGTGTTGTGATT
GATCGAAACGGCTTCGTAGTTTATCAATCGAGTTTTATGGAAGAGAATGA
AAATTCAACCCTCGAAAATCAACACATCGTGAAGATGcatGGTAGACTCG
CAAAGACGATGATTGAGAATGGagttatgataaaaaattattgtttgGAA
TTCCGAAACAATGTAACCGTAAAAGAATGGTTTTACTCTCTTGACCACGT
GATAGAAGCGAAATCGTATAGCAAGGGGTGTTTGAAGGATTATCATGTTG
TGCCGATTATCGATTCCAATCTTTTATTGTTGTATATTAATGATCGATGT
GATGTTAAAGAGAAATGTACTTGCAGAGAACCGATAAACGGGgaaagatT
TGGGTATTGTTCGAACGATATCAGCGAAACAAATTGTGAATGTCCTTGCA
TACAACCCGTTACTTGTCTCAGTGATCTTCGAATTACCCCAGGCAGACTT
GAATGCAACCCAGAGGACAAACGAAAAACAGATTTCTCAGAAAAATGGTT
CAAAGGAAACATTTCAGAGCTTACTCTCTGTTTTGACCCTGAATGCAAGA
AACGCGACACATGGGATAATTGTGAAAGTTTCAAACCTGCTTGCAACTGG
TGTTTCAAATTCCCAAATGGAACCCATGTTGCCGACGAGAAAAAGCATTG
TGATTATTCTGACGAAGAATGTTTTCCGACGCCATCACCACCCATCATAA
CGCCTGCACCACCCACAACACCTGACTCGCAAGAAACTGAGGACCTATCA
GATGGTGCTATTGCTGTGATTATACTATTTAGTATAATATTTGTATGCTC
CATACTGGGTGGTATCTACTGGTGGTTCAATAAAAAAGCTAAACGAAGAC
AACGTAATAACAATAACAACGGGAATAATTCTAACACAACACTTACTCCT
CGAGCCAACAGTGGTTTTGATGATGACCAATATCAACCAGGATATCAACC
ATCAGGCCACGCACCAAACGATCGACTAGGATCAGTACCATCACCGACTG
ATACCAAAGATGCTGCAGTAGAGATAACAATGCCAGCAGTGTACGAGGAG
AGACCTGCAGATGAAAATGGTTCAGTTAGTACCACGGCTTAAACCATCGC
ATAGTatgtaaaaattaatttttctgagtactattcaataaacaAAGACT
TAAAAGATTTCATTACATTAAAAGGACATTTCacatcagacacatatttc
atatcaggacagtgtctccctattgttttCTTATACTGATTTAagcaaaa
agatgtttttcttttccttttttctgaccaatcttgctccatatCCGTGT
CAATCCGATGTGATAAAGCTTGTGAGTTGaagttgatgagtaagcaaacg
atatcactcttatttgaaaacaaaagactttttgaaatctgaataagTTT
ACTACGAGTATTATTAGCAAAACGTTTTGCAGTTAGAAGTGtccaaaaat
ataattttatggTGTTGCAAAACCGTAATCTGGAAACATTTTGGGATCCC
TCTCCCTCCCTAGGCCCACTTAATGCAAGTCAAAGTGACTCATAAAAAAG
AGCTTTTttgaagaacaaattagtgggTTGCTTTGAAGGATCTTATATTA
CACGAAGCTGACATTTTGTACTTTCAAGATCCTGCagattctaatttatt
ttttctcgACACATTGTAAATATCTAGCTATTTTATTGTATACACACCTT
TCATTGTATATTTGGGATAgaatttttcaaagtc
Run BLAST on NCBI

transcript from alignment at sc0000002:268592..343583-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000523 ID=TCONS_00000523|Name=TCONS_00000523|organism=Clytia hemisphaerica|type=transcript|length=74992bp|location=Sequence derived from alignment at sc0000002:268592..343583- (Clytia hemisphaerica)
GTTGGTATGGAGAATGGTTTCTTTCGAGCCTATCCTGGACATTTGATGAA CCCTTCGTATGATCCAAGAGCTCGACCATGGTAAGAGATTATGACGTTTT TAATGATGCAGGGGCAGGCAGGGATGCCCGCTTAAAATTAAAATTCTTGG TGTACGCGGGAAAAAAGGGTTAATGAATAAAGAATGAATAAGAACTGATT TTGAACTGATTTGCTCTAATTAATTTTTGGACCTACCTCGGAGGTCCTTT AAATTAACCGATTTTCATCCGTTCGTCTGTTCGTCTGTTACCAGTTTTTC TTGTGATTGGCTCATTAGTAGTAGTAGGGAGGGAATTAAAGTAAGCTTTT ACCTCAAGACGGCAAATCACCGTCAAAAGAGGTCTGCTTTTTTGGGTCGA TTTAAAAATGCTGACGTCAGCAAAAAATGTACCGTCAGCAAAAAATGTGG CGTCAGCAAATAAATTATAACGTCACGCCGCTGCATACCGAGCTCTCAAT CGCGCGTTCAAAAATGCGTCGGAAAATCACAAAATTGTAACTAACCATAG CTTTCACTAAATGCCCCCACATAAAGATCATGTCAAGCACTTATAAAGCT TTAATGCATTAAAGATTAAAACTTTAAAAAATAATCAGGAATAATTGATT GATTTAATTATTGATTGATTGGTTGGTTGATTGATTGATTGATTGATTGA TTGATTGATTGATTGATTGATTGATTGATTGATTGATTGATTGATTGATT TGATTGATTGATTGATTGATTTAGGCATTTGCTTGAGAAAAAAAATTATA TTCTATTAACAAAATACTTGAAGAATTCGCAGCTTGATAATTTAGTAAAA TTTAAGGAAAAGCTGGAAAAGCTTCTCAAAAATATATTTCAAAAATTATG GTATCATTAGCTTACAGGTTTTCACATCTCCTGTTTGTTTTTTTTCTCCT AGTTTCTTTCTTACAACAATATATATCGTGATTATTATTCACTAAATAGA CCTTTTCTGATAATGCCGCAGACATATAGATTGTAGGCAAAATATATAGT GGTGAATAAATCAACAAGGTAACCAATCATAGAAATAGCTTGTTTTTTTC ATTGGCTGCTATATTTCAACAATTCTCTATTGCAACTTTGCCTAATAAAC AATAGTCAAGAGGATACTTTGTATGAATTTTATCAAAAAGTTCTGCGCCA TCTTAAATAGGGTGAAATAGAAACCAATCCTAGTTAAGGCCCGGCCTCCA CTTGCGTACGCAGTGATTGCACTCCTCAAACAAAATCTTCTATTTTTTAT TGGTCAAAAGAAAAATAAAGGAATGCCATTGTGGTCCATTCAGACGTACA GTCGAGAAAAGTTGAAATGCACCTAAATTTTTTTTCAAGTGCATAGTACT TTTTCATGATGCAATCTTTTCTCCAAGCTGAAAGGATTGAAGCCATTAGG ATGATCGCAGCGCAGACAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNCAGGAAGCTAGACTTTTTGAGTTTATAGCTATATAT ACTTTCACTTTATGGTGTTTCTGTATGACTGTCTGTGTACCTAGTCTAAC CACTGTTAAATGCCTTCGGGAAGGTCCGTCCTAACTTGGAAAGAAGGATT GGAGCTATTTCACAAAACCACTGGAGCGTAAGTTATTTAGGCTATCACAA CTGCATGAAAAAGTTGAATGTGCGCATGTAAAGTTAAACGAATGTAAATA AACTTTTTGCAGGCTTTTGAAATAGATTTACCACAGTGAAAAAAACTCTA AGTGAGGTAAATCTATTTTGAAGATATGTGATGGTATTTAAAGCTCGAGA AGCTCTATAAACAATAAAGGTAGTTATAAATAAAATAAAAGACAAAGATA AATTAGAGTTTGAACAAAAATATCAAATGTACATTTGAAAACTTGAGCAA ATTTCTGAAATTTCTTTAAAGATTCCGGAAAAAGAATTGAAATCATTGCT GAAGTAACTTCTGACTAAATTTACAATTTCAAAGACAAGAAACAAAATTT GACATACAAAACACTTTTTCCAGTCAATGAATACATAACCAGTCTGCCAT TTTGTTTGTTTTGATTTGCACAAGTAATATTGTAATTCGTTTTATATCAT ACACTGTTATGATTTGCATTTATAACACTCGCTTCAGCTTTTCAAACCTA AATCAAAACTAAAATTGTAATATGTAATAATGTTAATAGCATATAACGTA ATATGAAAAATGTATACTACCGTCCCGGAAAAAAACCGAACATTTACGGA TGAGACTAACTATGGAGATGCTTGGGCGACAAAACAAACACGCAACAAAA TTTCGAGATTCCAGTCCAATATCTATGCGTGAAACTATGAGTGCCTCCTC GTCGCTACGCTCCTGCGGGGGCAAAAATGTCAGATTCTGAAGTTTTGGTG ATTTTGGAGGAAATTTTGAAATTTTTAAAAAAAGTGAAATTTCAAATTTT GTTTCAACATTTTTGGATGATTTTAAAAATTAGAAAGTCATAAAAAATGG TAGGGGTTGGCCGCTGCATCCCGAAAAATGTCTGTGTATGCGCTAGTAAA TGGGGAAATCGACGCTGGTTGAAACTCATTTTATAATAAAGATGTTCAAG TTTGGTCAAGTTCAAATTACAAGCAAAGAGTTTAACAGCGAATACCATGT ATTTGACGCTATTGACGTGGAGAAGATCCGAATCAGCAAGGGTGGTGTTG CGAATAAGCACGGCACTCGCTATACTACCGGCTACGAGGTCGAGCCAGGG GATATCATTCCGCTCTAGATCAAAACTCCGAGAAACTTCGTCTTTTAAGG GGTTTCTTGGTACAGCGAAAGTTCGCCCTGAAAAATGGGGTTTTAATGTA ATTGGATCAGAAGGCTGGATTCGACAATATGAAGCTATTTCAAAGATGGT TAAAGAGCTTTTGGGTCAAAATTTAGAGGGAGAGCTGTTAAACAACGGCA AGTATGTTAATCTAAAGTTGATTACATGGGACGGTGAAATTAGAACCAGG TTTAGGGGCAATGGATGGAACAAGCCTGAAGAGATTGGCGCCTGTCACGC GACCAGAATTTTGAAGATAGGAATCGTTTATCGCAAGGGCTCGAACTATC ACTTACAGCGACGACGTAGACAGTGGTTATGACACCATTTACTGAGGAGG GCTGAGATATTTGTGAGGGGGGTAACTCACACATGACAAGGCGGCGAACA AGATCGTGATGAACAAATTGATGCACTTGTTTAATAAATGACTGGACCAG AAATTTACCCAGTTGTATTACTTGGATCTTTTGGAGGTTTAGTTGGAATG ATTGGTGGTTGTGTTGTAGGTCTCCATGGGAGAACTCTATGAGCTCAAAC AGGCAAATTTCAAAATCGAAATGGAAAATTCTAATCTCAAAAAAAATCAA AAAAGATCTGGCGAGCATGAGTGAAGACAGTGGCTATGACACCACTGACT AAAGAGGGCTGAGACCATCTGTGAGGGCGTAACTTTCACAAATAATTGTA CTCTGGTGGAGGTTCAAATTTAACGTTGGCAGCCTGGGTAGCTGAAGAAG CGACGATTTTCGCTAAAAAATCCTTTTTGCACTCTTCTCGGGCTTGTGCT AGGATTGACTCGCGCTGCTCAGCGGTAATCTTGTCGACTGCCTTTTTGAA CTTGGTTCTGGTCTGCTCCTTCATGGTATGCTATAGTGTTCAATCTCTTT TAGTATGAACTGGTACTTTTCTTGGGAAATGTGGGCGTCTTCGATGGCTT TTGATACAAACTCTGAGATCGAGTCGAGCTTGATCTTATCGTGCTTTTTG GCCTTAGACTTGAAGATTCTTTGAGTTAGGTGGGTGACTACAGAGGCAAC ACCAAAGAAGAGACCAGTTGGGGCTAGAACGAAGCTGATAGGTATTCCCA CGCCTGTCGCCAAGGTCACGATTGATGCGATCTTAAGTGTGGTGATCGTC GAGATGACTCCTCTATCACTGATCGTTGTAGCTATCGCTCGTCGCTTGAA TTCTTTTTCTCATTTTGTGTCTCGTTTTTATTTCTTCTCGCAAGAACTTT TCGTTCTATTCGATCTTTTTGAGGCGATAACTTTGTGCCTGCTCTAACTC TCGCGGCACGGAAGATGACACTTTAGGGTACAGCTTTTCTGCGTAAACGC TCGTCATTTATTGTTCAAAGGGAATTTCATTTCCGAGATCATCTTTGATT CTAATGTGCAGTTTTCTGTCGTTGTTATTTTTAAAAGATCTTGAAGGTAG TAAAATTGGTAATTTTCGATGTTTTCAAAAGGCAACATAGCTAGAACATC ACCATATTCTTGTATCCCGAATAGACGGGAGGAGGGGGTCTGAATAAGGA GGTAGTAATAAGGGGGTAGGAAAATTTTCTAAATTCTAATAAGCGGGGGG GGGGAATAAGAGGGGGGAGACAGAATTTTTAAACTTATATCAATTTCAAC AACAAAAAAGAAACTTTAACAAATGAACACGTAAAATAAGAACCAGCGTT GCAGGAAGGGTAAGCATGGATTTATTATACGCTGGTTCATGGCTGGATAT ACAGGGTGTCCCTAATAAAAGTATCGAGTTTGAACATGCGATTGAGTAAA AATGTTTGTGTGTGTTATCGCTAAAATATAAGAACGTTCTCCATCACATA GGCTCATTACAAAAGGTAGTTACAACGTATAAATTAATCGTAATGACAAA GAAAAAAGAGGGAGAGCTTAAAATACAATTTTGTGAACACACTTAAAACT TTCTACTCAATCGCATGTTCAAACTCGATACTTTTATTAGGGACACCCTG TACAAGTAACAGATTTTTGCCGATTTCTCGTGTACTAGCTATGTCCGCAG TAATGATATTATTGTTCACTCTCCTTCCCTCATTAAATGATTTTTTGAAG CATTTTCATTGCATTTTTTATCAAAAATCACTCATCCAATTCCCAAAAGA GACTTCATCATCATCATCCTTCGACCGTTTGGTCGGAAATAGAAAAAGAG ACTTAAAACTTTGCTGTGAGAGTCAAATTCTTCCTCTTAATTGCTAATTA TAAGTCGTTATGACGTTTCAAGCTGTGAGAAAGATGCAAAAGATGTGTTG TGTATAAGAAATTTAATGTTGACACCGGAAATTTTCAAACTTCAACCTCA AAAAAACCACTTTGCCACCACGTGCCTCCAAAGGATTTTCATACCACAGT GGAGCCAAGACACTCAAGTCTTATGTATGTTAATTCCACCTCTTCTGGGG ACAGTCTTGGAAAGATATTTCCAATTGAAAATTTCGTGTCACTATAAGCA TTTTGTCTGAATTTCTTGTCTATGTAATGATGTTTTTCTCACATTACATT TCACAAATGTATCCACCTCGGAATGCTAGCCTTACTTTCAAACTTTTTTT CTACAAATGTACAAAAAAAGAGCTAGAGAACTTTTTAAAAATAAGACTGA TAAACATTTCCAAAAATCAGACATCTTCGAGCCGCCATGACAGTTGTCCT TTGCGGACAAAGCTAGTACATCAATTGTTTTCTGAAACAATGAAAATACA ACGATCGCTCTCCATCGTTTTCTGAGTCGTTTATCCTGTATAATAAATCT TTGGGGTAAGGAAGATCCACACATGTTCTGAGGCTGCAATGAAGGTTTTC TTCAGGAAGTTAAAGATGCCAGCGATGATAGAGCCGACGATTCCTGAAAT CGCAGCTGCTGCCTTTGCCGCGAGTCGACCTTGTTTTTGACCCATTCTTT GACTGAGTTTGGATTTTCGGCGGGAGTTTGGAGATCCCACTGCAGGACCA CCTGTCAAGGAGGTGACGATGGTTGAAATAAGCAGCCCGACAGCGGTCAA AGGAATGTGAACTTGCCAGAGTGCTTGCGTAGCTAGCCACGCTTTTACAA CTTTTAACGGCTTTTTTGATGCGTTGCGAAGCAATTTGATGGCTTTGTGA CCCGTTCATAAATTTTCTGGCTTGTAATAGATTTTACCCAATTCTTTGTT GTTCATCTATTTGATCAACTGGTGGCAACTTTGTTGCCCGTTGGTCATGT TGATGCTGCATAAGGCCTTCAGTGTGGTTTACCGTATGCTCTGCGATCAA CAGGGGTGCCAAAAATCTACCAAACTTTCCCACAATAAGAGCTCCTACGT CAGCAAACGATTCTTTGATGATCGTTTCGCTGTTGATGTGTTTTCAGAGC CGCTCCACATTGTCAATCTTGAGGAGACTCGAGACACCCTTAGAATACAT ACTGATCACGTGGGCGCGCAAGGCTTTCCCTGTCTTCTCAGCTTTGAGCC TGGCGTCAGCCTGGAGATACTCGTGGTGTAATTTTTCAATGACCTTGTCT GTGGCTTTCCGCAGCCGTTTTACCGTCCAAGGTGTCTTGCCAGGAATTTC TGACATCGTTTTTATTACATGGCGGAAGCGCCAAAAAAATTCCAAAAATT AAAAGATAAAGAGGAAAAACCAACAACAAACACAATGACATTTTTTTTCT TTATTTTGATAAACAAACGAAAACTCTGATCGAGACCAGAGAACCCGTAG GTTTTTACGTGCAACTTTTCATGTTTCCTCGGTCCAACCGGCACTCCACC CCAGCTTCTCAGACTTGCGTCTCCACCGGCTCTGAGCTCTACCCCTGAAC CTTAGACTTTTTTTGTCATTTCTTTCTTTCGACCGGGCTCGGTCTTTTTG TTGAGTTTTGACGTGTACTCTTCACGTTTGATGTTTCTCAAGTGTTGCCG ACGGCGATTTTGGAGTTATTTTTGATTTACAGGACACCATGCCGTCTTTA ACGCCTCACATCACGGACTTATGGGACGCTATGACACGTCAGAGGTCCTT TCGACATTTTTGTAATCTTTGAAACTTTTCGTGAGAACTTTCAGAGGCCG TTCAGCTCACAGATTACATGCAACTAAGATCAGAACCTCGTACGCGTTAA CGAACTTTCAGAGGATGTTAGCTAGAGTCACTACCTGAGATTCATTTCGT GGGTGTGACCGGTCTACTCAGCGCCTCAGGGGTTGGCTTTTTTTGAGCTG AACACCGTCACACCGCCGTATAAGCTCATTATTTCCACCTATATTCTATA TTACCTTTCCACTGTATGTTTCAAACAGTTTTGTATTTTTTTCGCTTGTG GTTTACAAAAATATTGTTTGGGTTTTTCCATCTTCCCAGAAATCTTTTCT CTCTGCTGTCATGGTAAAATATTTGAACATGATTTTTTGAAAACATTTCT GTTTTCAAAAAATTTTTCACTTTCGCTCAGGGGAGGCAAGCAGTTAATAC ACAACACCTATGACAATTAGTACGGTGGTGGGTCCTTTTCTGAAATTTGC AAATTGCAGTTAATACACCAGTGTATTAACTGTCAAAGGGGGTGGTGTTA AGACAATTTTAGAACTCAAAAAGTGTATTAACTGCAACTAAATGTAAAAC TAAAATTTGCTAGAACTCAACATCAAGCTGCATCAAGCCAGATCAAACCC AAGTTTTTATGTCTTATCTCAGCATAACATTTTGTAAACATTTGATTCCT TTCAATCAAACGTTCGATTTAATTAAAAACGTTCGAAAATGATGTTCTAA TCTAGTCTCGATCTAGACGATGTTATCGTCCGTTTACAGTGATAATAAAG GCGGGGAAAATGGCGGTATGGCGTTATGGCGGTATACGGAAAAAAATCGG CGGGAGAGTTTCGAAGAAACTGTAAACATCTCCGCCACTGCTTACTCCAC CCGAATTTATCACGCCTCTCCTAAACTATTCCCTTTTTTAGTGATCTTGT GTAGACGATAGGATCGTCTAGTCTCGATCGGGAGAAAAAAACAAAAACAA AAAAGCAAGATGGTAGAAAGAAAAAAATTGAGGTCAATTCTGATCGCATC TGATTGCATGAAGAGATCTTTAAAATTATGTTTTGGCACTTCCTATAAAT TTAAAACTAAGCAACCATTCAACTGGAAAACCTCAAAACCTTTTTCTGCT TAACTCAAAATCTAAAACTTTAACTTTTGCATTGCTTAGATAAAACTGTC TGGCAAGGGATTTGCACCCCGACTTACAAAAACTTAATTTAAATTTTCTA ATGACATAAATCTGTGACATAAGCCCGGAGGGGTACTTAGGCAAATGAAG GGTATGGTATGTGCCGCCCTTAAGGGTACCTCTTGAAAACGTCGTTATCC GCCTGCCTGCGAGCATCAGCTACTTCTTGTGGAAACTATGCAAACGGTAC TGGAGAAACTGATGAAAAGCTGTCACTTTCAGCCCGTGTTCACTTGAGAA GAGTGTGTAAATTAGGAGCTTTCGGGTATTAATCAAACCACACAGCTTAC GCGTGCCGGGAATTCGCTTTCTGTAGGTTGATTCATGCGTATAATCTGGT CATTAGGTATCTCCGTAACAACAAACAGCGGAGGAATTTCGCTGAATTTG TCATGCAGCTCTGATGGAACCTCTATGTCAACTTATGCGAATCCAAACAA CCAATCACTCTGAACACCTCGTGTTAACATTTCGAGGTTGTGTTTTGCTT CCGGTGTAGGAACCTTGAAGAGCTTCTCCTTTCCACATGAAAAATCCACC ATTAACATACTAGGGTAGAGCATATTCGCATCGAACCCTAAGACGGTCTT ACAAAAGTTTTGGGTTCTCGTACACGTGAGATCTTATGCCTGTGACATCC CGCTTGTGATACCTGGACAAAAACAATAGCGGACCACCCACCATGCCCGT TTGCAACAATTCGTATGCTTCGTTTTTCGTGCATTTTATACATGAATTCT GAACCTTATTGCTATATAACTTTTACCATCAGGTTGGTCCATTTAGCATC TAGCTTGTTATATTTTATTTGAACCTTTATAATACGAAATGTGAATTTGA ACTTATTATTATTATTAACCTTCTATACATCTAGGTATCGATTGATGATT GCACAAAAAGGAATCACGTTGACAACACCCTATCCAGATGCCTTTACCGG TGAAAATGTCATGACCCTCGGGAAAGTTCTACTGAAGTAAGAAACGATAT ATCCAAACTCAATAGATCTTATCGGGGTTTTTGATTTTTCTAAAAANNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNGGGATTGTTTCGGGAGTATTACAATAGGATTCCCTCG AGGAATTCCTAAAAGATTTCTATTGTAATACTCCTGAAACAATCCCACAA TGCATTGCTCAAAAACTCCTATAAGATATATTCTATCGACCTGTTTCTAA GATGTGTTGATGTGTACATCTCTGAAACCTCGGAGGCAGGGGTAATCGAG GCTGGGATGAGTGTTGGATATGCGAGATCGGTATTAATCATTTTTACGAC CTTCCAAAGTCTCTTTAAGGGTTAAAACAGTAAGATGAAACAGCCAATCA AAAATTTCGTTTTCTTTTTTTTATTAAGGGGGGGGGGGGGNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTATGTTCCCAA TAGATCGAACTAAAAAAGTGTCTTGGGATTTTTTTTGGAATTGACTTTAA CTCTTTAAATCCTAAATTCTGTAAAAATATCGATAAAAAAGTGAATTTAA ATGTGTTTTTTTTCAGTTATCTGTAAATTGAGGAAAAACAACTCGGTTAG AAATAAAATCCTAAGACACTTTTTAAGTTTGATCTTTTGGGAATCTCATA AAAAAAGAATGAAGTCGGTATCTAAATGCTATGGGTGACTTTAACTTCGT TAAAAGTAGTATGGTGTTGTAAAATTTCGTTTTTTCCTACATTAATTTGA AATTTTTAACGAGATGATTGCTGTTTATTTGAGTAATCAGTGAAATGTGT CAAAAATATTACTATTCAATAGAGGTGAGAATAAACATCAGCTGAATTCT CTCTTTTCTCTTTGTTGTTTCCGAAACAGACAATTATTTGAGTAAATAAT CCATCATGAGACGAACTTAGTTTTGAAATTTAAATGGTTATAACTCTGGA TCAAAAAAAGATTTTAAGATCGCGATTTTACCAAAATGAAATCCAGTAAC TTTTCTTCCACTTTGACTGAAAAAATTTTTTTTGACAAAAAATCGGAAAA AAGGTGTACACATACCTTAAGGAGGTCATTTTTTTAAAGTTCAAACCTTC GCCTGGTTTTTACTAGAAATCTGACTGACCCCGCTGTATTTTCCTGATTT TATCATGGTTTCCGATGACGATGCATAAATTCTTTTTGGATTAGCTCAAA GTTTTATTTTTATTTTAAAATTTTTGATTTTAAACTGTACTTCAATATAA TTTGTAAAGAAATCAGGAACAACAAGACCCTTGACAACAATTTCTGGAGG GGGGATTGTTTTCTTGACTTGTCCAAAAGATAATGTCTATTTAGAGTTTT CTTGAGAAGGAGTAAGGTAATTAGGGCACTTAGCAAATATTTGTATGACC ATTTGATGGCAGTTACGAGCATTCCTAGATCAGTTCGGGAAATTGCATAG ATCTGCAGCGTTGCGAAATTTCGCATTTTTTGCGTTGTCATATTCCGTAG CGCTGCAAAATTCCGCAGCTTTACTGATAGATAATTTCGCAGCCCTGACC TATGGACCAAAACCAGGGTACAAAATAATGTGCATTTTGAAGAACAACCC AAAAGAGGAAACTTTTCATCCAAGCATTTTAATTTCCTCCCTAGCGGTTA TTCACAATCATTCTTGGAAGAAATGCTACTTTGTTCAAATATGCCAGGTT TGCCTCATTTTGCTTATATTTAAGAAAATTGGTCGTCATAGTTGGTGTTC ATAATCACACACTTCCATTGGGAACGTTGCGAAAAATTGCAGCGCACGCT GAGGGATGCGTTACGAAAAAAGCAACATTGCAGAATTTTGTAACGTTATG CGGATCTATGCAATTTCCCGAACTGAGATGTGAAATGTATTGATCAAGAA TATTGAAATCAATCATATTTTCAGTCATCATTGCGTTGTGATTGATCGAA ACGGTTTCGTGGTTTATCAATCGAGTTTTATGGAAAAGAATAAAAATCCA ACTCTCGAAAATCAACACATCGTAAAGATGGTAAGCTTCCATCTTGAATT GGTGCTTCAAAATTCCAAAATTGTTTTTAAAGTTTTCTACTAGCTGAGAA TTCAGGCAAAATATTAAGTAATATCTTAGATCGCTAACTCGTGTTATAAC CATAGATTTATAAAGCCCGAAAGGCTAGATGTCGTGCTTTACGCCATCGC AGGCAAAAAAAGTGAATATAGGAAAACATGTTGTTGCTATTGTTTTCGAA AACCTGCGAAGCTTCTGATTGGTCAAGCGCTGAAATTCTATTGTAATGTC ACGTGACCTAGGTAGGATTTCCTACCTAACCACGGCACACTTTTCAGCAA AAGTACGCCATCTAGCCCTTCGGGCTTTATAAATTTATGGTTATAGCCAA GCTATAAACCTTTTGGATATTGTCTTATTGTCACTCGACGGACAATAAAG TTAAGGAATTTTAAACATTTAGACGTGTTCAAGATAATTATCAACAGTAA ATTCTCTATCCCACTGCAAACAATTGATTGAATATTATTAATAAATTCTA TGCCCAAGTACAGCCCCATCTCACAGACCCACTGGGACCCCTTCCCACTG GAAAAAATGTCCAAAATATCGTCCACGCTGGAAAATGATTCTACAATTTT TGTCCCCACTTAAAATAATCAAATAAACCGATCCTCACTCTCTTTTTCCC CATCCCCACTAAATTTTCTGGCTTGAAAACAAAAGAATTGAAATCCCCAA CCATAAAAATTATGGGAATATTAATCCCCATTGTGTTTTAGTCGGTAATT TTTATCCCCATTGGCTGAAAAATCCTACCAGGTCTGCGAGAAGGGGGTGT CCAAGTTCTTACGGTTCATCAATTATACTGTAGAAAAAGTTCTTATTATT TTAGCATGGCGTGGTTGCGAAGAGTATGATAGAAGAGGGAGTGATGATAA AGAATTATTGTTTGGAAATCAGAAATAATATAACCATCAAGGAATGGTTT TATTCCGTAAGTTTCTTTAATATCACATTTTTTGAAAATTATTTACGGTA GACGAGGGATCTGTAAAATTCAAAGCCAAACATTTCTTTTTCTTTGTAAG TTTGAAAAATTACGTATTCTTTATTAAAATTAATTCTCACTCTTGGGATC CTGATAGACGGGGATTGTGATAAAGAGGTGAAGGCACGGTGATCTTTCTG TGGAACATTTAGAAGATCGGGATTATTTTGGCTAGTTTACCCTGATCTCC AAATGTCCATACCTTCTCGGGGAAAATTTCGTCGAGGAAAATTTTCGTCG GGAAAAATTTTCGTCACTTGCTGGTAGTTGGTAAACGCATTAAGGCCGGG GAAAATTTTCGTCGGGGACAAATATTCGTCACTTGGCCAAAATTTCGTCA CTTTTGCCCGACGAAGTTTTCCCCGATAAGGTATAGAGATGAAATTTTGC ACACAAAGTCACCTCATAGAAAGTCAAAAGTAGAAAAAAGAAGTTTTTGA TACATCCACCAGATCATAGGTTCCGGGACACTTTCGTTTTTGAGAGATCC CTCTATCGCATCCTCATCCCGGGTGGGATCCCTCTAAATCAGAATCAAGA TAATAACGGATTAAAAAAAGCTAGAAACTTAAAATTTTGAGAGAATGTGC TCTTTTATGCTCTTATGGGGTGGCAAATTTTAATTAAACCATTACCGAGA GGTTTAAAAATTGTACCCTTGAAAGTATAGACTGTATATAATCAAGCAAA TTGGAGCAAAAATGAGGAACTTTATACATCGTCATGACTTTTTTTTATCA TTTTTCTATTTCAGCTTGACCACGTGACAGAATCAAAGAAATATCAATCG AGTCGAAGTAGTTTGGATTATCGAGTTGTACCTATAATTGGCTCCAATCT ATTATTGCTATATATTAACGGTATTAACGATTGTAGTGGTCTAGAAAGCT GCAATTGTCAAGACCCTACTGATGGAGTAAGTTTTATCAACATTTCAGTA GAGGGTATTTTAATGCCTCAATGATTTCAATATTACTCTCGAGTACCTAA TAGTCGGAGGGAGTTGGAATAAGCGGGAGGGAGGGTTGAAAAAAATCTCA AAGCTTAGTAAGCGGGGGGGGGGGGGGGGGGGGGAAAAAAAATCAGAAGT AGTGGGGAGGGGGGGGGGGGGGTGTTGGAATAAAAATGTCCTGGGTGGAA AATTTTGAAAAGGAGGCTAATACAGCAGGATTAAGGCAAAAGAGGGAACT TTTAAAAACATTTTCCCAAAAGTTAATAAGTGGGGGTTGGAATATGAATG TTCTGGGTGAAAAATTAATTAGCGGGGGGCGCTTATTAGGTACCCAAGAG TATGTGTTGTAGAGCTAGTCTTTCACGATCCTACTGGTGGGGCCAAGTCA AGAATTCGCTTGCTTCCACACAATGGTAAGAAAAAGGTGTTTACATTGCT CTTTTACTTAGGTCTTGTTATTTTTGTGGTAAGATTAGATCCAGGTTGAA ATAGTCTCAGATAAAAATGAGAGTTTTTTCAAATAATATATACAAAAGTC CAAAATTTCCGACCCAACGGTATTTGCAAATATCAACCTTAAGGTGATTT TTCGGAGGGGCCAAAATGGGGTAATTTCCGATTTTTGCCCACAAAAAGGT TTCCCGGGCCTAATTCGCGTTCTCCCTCTCACCTCTCAAAAATATCTTAT AGTATATACTGTTCTTTCGGATGGACTAAAAATGGCTAGGTCGTAAAAAA GATGTCACGGAACTCCAGGCTTTGCCCACTACTTTGCCCACAANGTAAAA AAGATGTCACGAAACTCCAGGCTTTGCCCCTACTTTAATTATGTGGTTAC AATGCTTCATTTTTTTACCAAGAAGGTAAAAAGTGAATTCTACATTTTAT CATTTTTCAGGAAATATTTGGGTATTGTTCGAACGATATCAGCGAAACAA ATTGTGAATGTCCTTGTATACAACCCGTTACTTGTTTGAATGAGCTAGAT GATACGTAAGAGTTTTTTATAACCCTTTTGTTTCCCCTATTCTGAAATCA ATATCGAGCTTCATCCAGGGGGGGGGGGTACTAGGGTTGGCTTGAACAAA GTTGTGTTCATCGTGCACTTTTGAGTTATGGAGACTCCACTATTTTCACC TTTCAGGGGCTTTTCATATTTTTAGGACCAAACTTCAATGNTTTATAACC CCTTTGTTTCCCCTATTCTGAAATCAATATCGAGCTTCATCCAGGGGGGG GGTACTAGGGTTGGCGGATGAGGGGTATGTGCAGACGTCCGAAAACCGAC CCATAGAGTGACTGATTTTTGCTGAAAAGGTGACCCTTTCCTAAAATTGT GAACTTTTCCCATTTTAGCCCCACTTGCCTTATAAACCTTACTCCACAAC TTGAACAAAGTTGTGTTCCCCGTGCGTGTTCAAGTTATAGAGACTCCACT GTTGTCATCTTTCAGAGACTTTTCACATTTTTAGGACCAAACTTCAATGT TATCCAGAAGACAAACGTAAAACGGACTTTTCAGGGAGATGGTATAAAGG AGATCTTTCTTCTTTACCACTCTGTTTTGATCCAGAATGTAAAACACGGT AAATGCTTTTGTGTCATTTTAAAATTTTATTCTTTATACAAATAAATTTA TTCTTTTTGGGTACACGTTTTTTTATAAGATGGTGTAAATCCATTTCATC ATGTATATTCTTAACTTTTTTGGGAAAATCACCCTACAATATTCTTACAG CATTCTTAGGCTAGGATCCTAATTCAGACTAGATTTAACATTTAGTACAT AGCGTCTCAAGCCTAAAATGGTATTTTTGTGAAAGGAGTGAGCTTTTCTT GGGGGTAATTGACAATTGAAAATTGAAAATGCTCTAAAAATGGCATTCTT AGCTTGAGTAGCATCATGGCAATATTCTTAGCATTATTCTTAATTTTTTT GCCATTTTCCTCATGGACATTCTTATAAAGAGTATTCTTATTAAAAAAGC GTGTATCTTTTGTTTTGGATTGCTTGTATTTTGTCCTGAAAAACAAAGTT GAGAAACTGAAAAACTTTTTGTCGCAGAAATTCATATGTTTGCTTTTTCA ACGTGTAAGATTTAAGTATTTCGAGGAAAAAACAAACTCTATGGTTTAAC TCACTAAAACTTTTATTGATTGAACATGTACAATTAATCTTTAGTGAGTT AAACCATAGAGCTCTGTTTCCGTCCACTGATGTTTTTCCGTGACAAGGAA TCTTTCTTTATAGTCCGGATGTTTTTCATTGAAGCAGTGAAAGCTACTTA ACAATTTCTTTACTAGGAAAAGTTCTGGTCAGTGTAATCGTTTCAAATCT GGTTGCAATTGGTGTCATAAATATCCAAACGGAACATCCGCGATTGACGA TCACAAATATTGTGAATACTCCGACAAAACATGTTTCCCAGATTTAATTC CTTTACGACGAAAGAAACACCATACTGGCAATAACCCACTTACATTGGAA TATATCATCATAATATCAGTTCTCAGTTTTATATTATTCATATGTTCGAT ATTGGTTGGCATTTACTTTTGTCGAAAACGAAAAAATAACCGCAGAAGAC AATCGCCTACTTCATCAACCGAAAGTCAAGATTACCAAAATCCAAATTTC TATAATGATGAGGATCCTGATTACTTTACGCCCTCAGGACCACCCCAACG CCCACCAGAAACCCCCGAATTACCTACGGTGGAAGTAGGAGCGGCTCGTG ATGTAGTCTTTCATATGCGAGTTGACGATGCACAGTCACCAGCGTCAAGT AACGGAAATTTTTTCCCAGATTTTAATAGAAAGTATCAAGGTAACGTGGA GATCATTGAAGTATAAGGTGTTTTTTGATTTTATAAATAGCCCTTATGTA TTCGAATGAAGAGGTTCCCTATGGGCAAGCAACGGACGATGGACGTCAAT GGACGGCTTTAAGACCTTTGGACGTCCTAAAAACGTACATTAGAGGTCCA AAAGACGTTTGTGCCCATTGGGTTCGTTCTAGTGGTTGGTCAGAAGACAA CATGAGAGCGACTGTATTCACTTCATTTTAATTAAAGTCTGTCCAGATAT AATTGGCAGTGGAAACAAGAATGCCTGTAACTTTTGATAGTCAAATATAA TTATGGAAATTTGTTTTGCTTGTTTTAGAGNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NAACAGAAAAGTCCTTCGGAAGATATGGGACCCGAAATACCCCTTGGTAG CACTTTTCTGTGAAATATCAAATCTCCAACTTATTGCTAAAAACGGGGGT AGTGATACGATTGATAAAACAGTTTTTCGATCATAACACATTTTACGATC TCTTTAATGACCTCATAGCCAAACTGTATTTAGTGTTTTGGGAATTAGCA AAGTTCTTTAATGACTTAGAAATAACAAAGGCAATACTTTAGTTAAATTT TTTCTATTGCTGGAACATTGGAGAACATTGGAGAATATTATATTTTTTGA CGAAACGGTCATTAACCATATCAGAACACTTTTTAATTTGACAAAAGTTT TTTTCATATCAGAAATTTGATATATATTTTGACGGGGTAAATTATTGATG TAGATCTTTATATCCAGCGTAAGTATTTCTTAGAGTCTGTTAAATTGCGC GCCCTGCGCGCCTTCTAAAAAGTGGCGTTTCTTGCGCACCTGCGCTCCCA GCGCGCCTTCTATTTTTTGTGTGCCTTTAATTTTCAGCCTTCGATTTTCT GTGTGTCCTGAAAAGCTTCTAGACAGAGATTTTAAACGCTGTATAAAAAT ACTACAAAAAATCTTTTTGATTACCATACTACAGTTAGTCTGAATCGCAG ACCTCTACAAAACCACAGGTAGTATAGGTCTGCTTAATGATCTACCAACC GCTTTCCGGTTCGCAAAGGAAATCTTGGCGAGTAATTTGNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNAGGAAATCTTGGCGAGTAATTTGATTGACATTGATGTGC GCGCAAAAACGATCGTTTCGAACGTTTTCAATGGAATGTTTACATTTGAA ATTCGAATCCAGGACCAGAAAAACAAAACAGAAAAAAGATAAAAAACAAT CTGATGCGCGCATTATGTACAGTCTGTAGATTTGTTTTTGACTTTTGCTT TTATAAAATATCTGGTCTGTAAATTTATCAAAACTTTTCCATCAGCTCTT CGGTCGAAGCTCAAAAAATACAAATATGAACACAAAAGTGAAAGAAAANN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACAAAGGCCAC ACAGTATTAAAAAGTGAAATGCCAAAGCTGAAGAAAAGTTCTTTGTTTGT TTTAACATTTAAAGGCCCTTGTTGAAGGAACAACAACAGGAACACTTCCT TTTGTAGAATCATAAAGAAGTAATGTCAGAAATATTCAATACAACCCCCA AAATGTACTGTATATACATAACTAGAATACCTTGAAATAANNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNTATCGGCTAAAGGCGGCAAATCTCTGGACAA AGGAAATATAGCTTATTAAGCATCCTCTATAAGGAGCACGAATCCGTTAG TGGATGCCAGCAGCCTATACTACAGTATGTATGACAATCGGTTTTGCAAC GGTAGAATACTACATTATTTTGACCATTAAGAGTATTTAAAAGGAACTAA ATGGTTCCGAGTAACTTGTGTCATTTTTTCGACTAGCCATTTTGATTTTT GATTTTTAAAGCACACCTCAGTGTTGTCATTTCTTTTGTATTTCGATCTT GTTATTGATTTTGTAAAATTTTGAAATCTTTTGATTCAGACTTTACGAGT TAGTATTTTATTATTTGTTCAAATTCGATTCTACTTTTTGATTTTGATAT GCAAAACTGCATGCACCATTATCTATAAGCGCGCCAGAATTTGAATAATT GAAAACATTTAACCATTTGTGCGCCAGGGCCCTTTTTTGTGGGCTTTTTT GGTAAAATGAGCTAGATCAAACTTTACACGTCATTCGGCATTTTTTTTAC TTCAATGGCCAAAATCTCTCAAAAAAGACCGAATTTACAACTTTTTTGTG TTGATTTTGAAAGTGCATTTCATTTGCATCAACTTAGGCTAAAAATGAAG AATTCAAATCGAAAATGGGTCTGACAGGAAGGCTTTGCCCTCCTGCTCCT GCATACCCAGCCATTATTGTAATTTCGTTTAAATTTTTTAAATGAAATTT AGCAAATATTTTCTAATAATTTGGAGAAAAGTCTAAAATTTATCCCCAAA AGCATGACACTTGTTAAATCAGAAACGCGTAAAAAATTATAAGGCGCGCA AAAATTAGGGCGCGCCAAAAAATAGAAGGCACGCAAAGGCTCCCAAAAAA GATTAAGGCGGGCAAGGAGCGCAGGCGCGCTGGGAGCGCAAGGAGCACCA CTTTTTAGAATGCGCGCAGGGCGAGCAATTTAACAGACTATATTTCTTAT CATTAATTAGTTTTGTATAGCTACAAAAAAATGTTTTTCATCGCCAGGAA TTTTTTTGTCCATTTTGCACAATGGGGATTTCAGAATAATTTTTAAAATG TTCTAAATTTCGTTAATCTAGCAAACTTGAACCGAAGTCCCTTAGTTCGA TATTTCACGATTCTAATGGCGCTCACGAAAGATGACTTTTAAGTGCAAGC ATCCTCTAACGAATTCGTGCTTCTATACTACCAACGGTTTTTGTCTGCGG GTACGAGATTCAGAGATTCAGAAACTGGATTAAACTTGTTCATTCGTATT TATATTTTTGGTGCATATGATTTGGTATTAAGATTTAAGCTGATTATGTC TTACATGCAAATATTGTGTAGGTATAAAAGGAGTTAAGAGTATTAAGATT TATAATGCGAGCTTTCCTTTTCTTAACTAGCAATATTCAAATAATGAAGC TGCCAAGACAGACTTTTTAAAATGATGATTCTCACAAAAAAAATCACTCC TGGTTATTTTAAACTTAGTTTGTCCGAAAAAAAAAATTGTTTATATAAAC TATAAAGAAAAATCCTCAAAATAAGACGCTTCATCAATTTTTTTCCATGC ATATTTTTAACTTTTTGACAAAAATTATCCTAAAATATTCTTAACGGTAT TCTGAGCTCAACCTAACTAAATGTAACATTAATACATATACCTGGTCCGG ACATATCCAATATTCCCCAACCTTAGTACTCCCCCGGGAACTTTTCAGAC GTATTTTGTGGGTTTGAGACTATACAGAGTATGACATTAAGTATTTAAGC ATGAGATAATAATCTTAAAGTTTTTTTTATATCTCGGTTTTATGGTATAT CATGCATATCATGAGACTTTGGAATTGCTAGCTGTACTTATAAGAATGTA TTTTTTAGTTACGGTATTAAGAATAAAAATTTCTGTCCGAGGAAAGTTTC ATACTGGAATCTTTCATGGAAATTCAATCCTGAAATTGCTTTAATTTGAT AATTAAAGTTTGAAGTTTGTTGGCATGTATATACTAAACATTCAAATTTT TATTCATGATGAGGTAATTACAAAAGTATGTTTAAGAAAAGTGTAAATGT TTCCAAAAATGCATTAGATAGCCCCCTCCCCTAGCGGTAAGTCTGGTCAC GATATCACGTAATTTCTGTCTTCACAATTACGAAAATCAGCAAAGACAAT CGCATCACGACTCAAAAATCTTTCAAATCATGATCACGTTTTGACATCTA ATCACGCAATCACGAAGAAAAAATGTCCAAACCATGTTATCACGCAAGAA AAAGGTCCTTATCACGCCATTACGAAAACCGAGGATGTTTGGGGGTTTTA AAAACTAATTCGTTTTACAATATTTTTTTGCTGGGTTACAGAGACAGGGG GTTTATAACTTCCATACGTTGTAGATGACATCAAGAAAACATTATTTGAC AGCTAGGGGCATTTTATAGGATTGTCTGTTAAGATACTTTATAAACCCTT TAATCTTAAAAAAGGAGATATCATCATGAGGTATTTGAGGTATTTTTCCT TCTTTTCTCAGAAAAAAATAGCAAAAAGTTTTTAGTTTTTTTAATGAATA TTACATATTATGTTTTATAAATTTTTATTGACCAAGCTGTAGAAATGCGT GTGTGAGGACGGTTATTCGGGATACGATAAATGATATATAATTTTCATGT TATAATAGTTGTGGCTGCTGTCAATTAAAATCTTAAATGGTAATTGCAAT TGGTACTTGGCACTATCATGGAGTATCATTATGTCATCATTGTGTTACTT TCATTTCATTGGTCAAACGTGAATGGACAAAATAACCAAGTTAATTTCCT AGATTTATTGAAAGATGATGCCAAAACTTTTCAACAAGAATTGACAAAAC TCGTCAATGAGAACCTTGGTCATGAAACTTTGCAGGTATAAATGTAATTT ACAGTGGCGGTGAAAGGGTGTTTGTGGGCGCTTCAAAATCCTTTAAGGGT ACCAGTGAAGAATATGATTTGAAATCGCATAAAAGAAATATATTTTAAAA TGCTCATTCTTTGCAGGAGAGAAACTCATCATACACATTTTTTCTTTATA AGAACAAACTATATAAGAACGTAAGGCTTCCATGGGTAAAATATCAAGAG CAAGTACACCCCTGTGTCACAAACCCACTGGGACCTCAGGCCCACTGGAA AATTTGGTCAAAATTTGGTCCCCGGTGGGAATAATCCTGGAATTTCAGCC CCACTCGGAAAATGACTTTGATTTCATCCCTATTCGGCATTCAATGTTTT AAAATATTGTACTCCAAAACTATCCCCACTGGATTTTTTAACATTGGAAC AATAGAATTTCTATCCCTATCAGGAATTCAATAGGAATGTTTATCCCCAC TGAGGAAAAAGGTTCCAGTGGGGCTGTGAGACAGGGGTGTGCAAGTTAAG CACATTTTAAGGCTTTGTAGTCTCTAAAACACCTGATTTTTTAGGAAGAT GGACTAAAATCCTCTCAATTTGGTTAAGATAAGATTATGTTAAGAACATT TTAGGTTTAAAACTCAGAAAGTTAAGGCTTCAAAAAAATTTGGATGTCCT TTAATAAAGATATTTTATAGTCATTCTTTGCTATCTTCATATGTATGTTT TTTCAGCAAAACCTTAATGATATGTCTGAAGATGATGCAACTAGCTTTGA TGACCAGGCCACCCTCGATAATGTAAGTCGACTCTCGTGTTATATCGTCC GTAACCTAAATCCATTCGCTTCAAGTATGTAGTTTTCCTTCCCCCCATTT TGAAACCAGAGTCGACTTAAGTCGACTTGAAATGACATTGAAACTGTGCC TTTTTAATTTATTTCGTGTATCTGTTGCATGCTACCCTATTCAATTTACA AGGGAAAAAATGCACAAATATGTGAAGATTTCCTTCGAGGTTGAATAAAA TGATTCAATTGACTTCCAAATTCAACAAAAACTCTTTTCTATTGCTGCTG CCTTTTTGTAAAACCTATATCTCAATTCGCAAAAGTGTTCAACCATAAAA AGTTGATGACTGCAGTGACGTAGAAAAAAATCATGTACGAAAAACACGAA TTCTATGAAATAGGGTATTGAAAATATGAAAAGGAGATTATCGACCCGAA ATTTATAGAATCAAATTATTGTCTCACGAATTTCAGTTTGTCAAAGACCT TGCGGGAAAGACGACCATAGCCGAAAACGTATTGAACGAAATGTCGAGTC ACATTTTGGACGATTATAAAACGAACAACGGTGATCAAAGACCCATCGAA AGTTGTTGTCAATTTGATGATTCAAAACTGGGATTTGTTTCAGTCTTTGG TGAAAACGTATTCAGATAATTTTCATTTAACTTTTCATAAAAGTTTTAGA TTTTTTGATTTTTTTTGAAGATAGGCCCCCAAGCGGTTTGCATGATGTCA TGATAGGGACTTTTTTCTAGCGTGATTACGTGATTTGGAATTTTTTTTCA TGATAGCGTGATCAGAGGTCAAAGCGTGATCGTGATTTGATTGAAAATTT TTTGTGCCTTTATATGAGATTTGGACTATTTCAAAGGGATGTGTGATTAT CTAATATTTTTTGCTGATTTGCTCGATCGTAATAGACGATATCGCGTTTA GATAAATGCAATGCATTCTGGTTTCTCGGGGACCCTGAAGGGAATTATAA TCTATTCCAGATCATTATATAATCGACATTATAATTTCTTTGAGAGTCCC CGAGAAACCAGAATGCATTGCATTTATTTAAACGCGATATCGTCTATTGA AAACAAAAGTTTGCGTGATATCGTGATGGGAATCGTGATCAGTGTTACCA CTGGGGGGCGGGGGCTCTTTGAAGAATATGAGAATTTTCCTTTTGCACTC CTCCACATCTATTATTTCTTGCTTGGTGTCATTTATTGCTAAAAGAAATC CCTTTCTTGACAGGTTTCGATGAGCGACATTTGTGAGCAAACACCTCCAA GCAATTCGAAAGTCTGTCCCTCTCTTGGAAGTCCTCCATCAGAATCCATT CACTACCTAAAGAAAGAGGATTTGGTCACGAAATGCAAGGATGTTTATAA AGAAGCCAAAGGCGAAGCAAGGAACATTCAATACGACTCTTTAGATGGTT ATTCGTTCACTTATCCTGCTTATCAAGATCCTTCACCAATGGAATGCACA TGCGCACAAAGGGATCCCAGATTCAGGTTTGATAATCTTTTTTTTCAACT CAATTTTAAGCCATACAACGTGTTTTTGTAATGGTATAGTGAAGTCTCTA TAACTCAAACACTCGCCAGAGAACACAAGTTTGTTCAAGCGAAGTGGTGC AGTGGTAGAGCATCCTGCTACGGTACGCAAAGTTGTGGGTTCAACCTCTA GCGGGGTCATACCAAAGATTTCCAAAATGGTACTTGATGTTTCTCTGCTT GATGCTCAGTAATTAAGAGAAGGAGCGAGGGTAAGTGGAGTAACCCAGGG AGAAAGAGTGGCACCCTCCCCTACCTTCGGGTAGATAGCTATCGAAAGAG GAGCCTTTGGATCGCCTACGACTGCGATCGCAGCCTTACTTTCTTGTTCG AGTTAAAGAGACATTTGAATTATAGAGGTTCGATTTATTATGAAAACTCA ACTATAGTAAAAATAAAGGCTCAGATTTCGAAAAACACGGATTTAAAGAC GCTTTAAAAACTCTTAGATGAATAAAGAAGATCTTTGGGATATCTTCGAA GTCGCTCAGACAAAGCTCGGTAAAAGAATCGGTACATTTTTTTTTCAAAT CATTTTCTTCATACAGTTCGCGATTGGCAGAAACTTTAGCAGGTAACAAA GGTAGACATTTTTTGATTGTTCTCGATTACTCAGAGAAAATTCAAAACAC CATTGCCATCATGAGGAAAGTTGCAACGACATTGCTTAAACTGGTTACTT CCAAAGATATGGTATGATACATTATTTATTTAATGTCAGGGATTTTTCAA TTTTTCAAAGTACCTCATTACACGAATACTAGGTAAGTATTGAAATTTGG ACGATCTGAAATAAACTTTTTCAAGGAAACATCGGCTGGTTTTAATCAAG GGGGTTTTTATTAATACGAAATTTTTCAATTCGTGTTAATAAAATGACTA GTTATATTCGTGTAATAAGGTAGCTTTGAATACACCTTTTTTATAAGTTT TTAGAGCCTGGAAATATTTTTGAGATGTTCTTATTTACAGNGGCGCTAAC CACCTTAGTCATTATATTTTTGCTGGCCCCCTCACTTTCAAAATCGTGGC TCGGGCCCTGGATACAAGAGTGGGGGGAGATATCCCTGACTCTGTGGTGT GGTTGCTAATACTTGTCAGGTTCGACCATGTGAGGATACACTGTCCTCCT GAGCTGTTCGAGTATAGTAACTATACGCCAGCAGCTCTGTGTGTCGCGAG CACGATTCAGGTAAGCGCAGTGATTTTTCCATCCTAGAATAGTAAATGCT ACCTTTGATAAGGTCTGTTGCGTTCATCAGAAGGACTATATCCTATCCAC AAAAAGGAAGTCACTGTTCAACCCCGGGGGTAATAATGTCCCCTTTTCTT TACCCCCTAACTAGACAGTCCTTTGGGTGAGTGAGACAGGAGTGTGCACT ACATACTATAATTTTCTTCATACAGTTCACGATTGGCAGAAACTTTAGCA GGCAACGAAGGCAGACATTTTGTGATTGTGCTCGATTATTCCGAGAAAAT TCAAAACACAATTGACATCATGAGGAAAGTTGCAACGACATTGTTTAAAC TTTTTACATCCAAAGATATGGTAAATTGCTAAATGCTAATTTTGTTGAAT TTCACAATGACTAATTTCAAAACATTCATTCATATGCCATTCATATATTC CTGATTATAAAAAAAATTCTGGCGTTACCATTCCGGCGGTTTCAGAAGTT TTTCTGTCAACGCCCCTGTGTCACAGACCCGCTAGGACCCCAGCTCTGTC CCCGGTGGGAAAATACCCTGTAATTTCAGCCTCTCTTGGAAATCGACTTT GATTTGATCTCCATTCGAAATTCAAATCAAATTGCACTCCAAAACCATCC CCACCTTGGAACAATAGAATTTTTATCTCCACATTGGGATTTCAATAGGA ATTTTTATCCCCACTGAAGGAAAAAGCTCCACTGGGCGTCTGTCAGTTTT CTTTCATTTTCTCTTATCATCACTGTGTACCAAGTTTCAAGTATCAGTCA GAAAAAATATCAGTCAAATCGAACAATTCAAACAGTTAATTTACGGTTTT GGTCAAGTTTACATTCTGGTCTGTAAAATGCCAACCACATAGATGGCTGA ACCAAAATTTTGTCAATTATCCATATCTACTTCAAGATCATGGCACTTTT CAACCTTCTTTAAGACTGAGATTTTAAGGGAGTGTTACTAATAATATTAC CATATAGCCAGGCCACTAAAGTCTATCGAATCAGCCATAAGTAGACATTG CGCTAAATCTGACCCTGAGATATTTCCACAAGGAATGTTGCCATAGATTC TGCCCATTTTCATCTTTATAGATTTCAGTGAAATTTTATCACGAGGATAA TTTGGTACCAGCGGACAAAACAGCAGATTGTTTGAAAATTTCATCACAAG CTACTCCTTATATCAAAGATAAAATTCTCGGAGAGATTGAGACTAAACAG CCAAAAGGTAAGGAAAATAATTATTGATGAACTGGCTTGTGGCAGCCAAG CGTTCATAGCTTCGTTACTTTTTGATCCTTCGATGTCGGCTCTTCCTATC ATCGTGAAGCAGAAAATATTGTAAACTTATTTTCAAGGGAAATGTGCTCT CAAGTATCTAAAGGATGGGTGATCTGCTAAATGTGAAATGCTAAAAAAAA AGTCTTTAGCTGAAGACTGGAGTTAGAATGGATGTGATTTGGTTGGAAAG GAATTTTCAAAACAAATAATAGGATAAGTTATTTTCAAAAACCTCTTCTA CTCTGACACCACTAATACAAAATTTCTTATCCTTGCAGGAGACGCAGCAA GCTATTCCAAGGTTTTCCGCGAATCTTTTACTGCTCTCAAGAATGATAAC AGCAATCAAACTGGTAGGTGAATTAGTATATGGTCTTCAAGACTAACTGA TGTAAAACTTTTTTCTAAAATTGAAGGTTCTTAATAAATTCTTCGCATGT GCTGGTTTGATCTTTTTTAGAGAAACATTTCATCTTTGTCACAAGTGGTC ATTACATTGATAATTGGTCAGAGATTGACCAAGTCTTCAAAGAAAGGAGA AAAACGAATTCAGAATGCAATGATATGTACTTTTCGTTGTTATTAATAAA TGGTAAGTCACTTTAAATCAGGCACATGCGCAGTAGTTTCGCTCAATATT TTTTGGTACAATTACTTTGACAGGTAAAGCTGGAACTCACCACAAATCAT CTTTGGACAAAACAAGAATTTGAGAATCTGATTTACGCTGTCAATTCGGC AAAACTAGTTTTCGTCAAAATCTAAAATTTGGTCACTTAAATTAGGCTTT CACCAAATTTAGCTTTTTAAGTATTTTTGCTACTCACCAAAATTAGTTTA CAAAGGACACCCAAACAACTAAAGTTCCATATTACCATTTTCCAAAATCA AGCTATATACTTTATGATTTTTCTGTGACTTTGTTCGCCTATTATTTATT TTATAATTTTAAAATATAATTTTAGATGGCAAACTACCAAAAGCTAATTT CGTCAAAAATAAGAACCTCAAAGAGGGTTGTAATGTAAGTCATGTTTAAA TCTGGATCTGGAAGTTTGTGATCTAATTCTTTCTTAAATCAAATTCTATT GTCTAGAAATAATACTCCAATTCTTGCACCTGAGTAGATCAAGTCAGTCC CAGTTAAAGGCATTCACCTTGCAATCCAAGCTAGGGTTATTAATTTATCA TTGGTTCAAGTCACCACAAGTTTAGCTAAAAATCTCGATGTTGCAATCAA ATAAGATAGGGTTCCCGGCAAACTCTACTAACCTAATAAAGTTTTATTTT CTATAGGACAATTTTATTGATTTTGAGCTTAGTGGAGACAACAATCATTT TACAATCAATTCCAAGATATCTGAAATTCTACCCTCTGGAAGAAATATCG ACGATAAAGTTTATTACATCATGCCTATATCTGATCGATTTGGTAGAGGT ATTTACAATAGAATCTAGTGTTGACCAGTAGCGTGTTGGTAGGGGGTCAG GGGCAGTGGCGTGGTGGGAAAATTTCTCTGGGGTGGCCAAGGCAAATATG GCGCCCTTTTTAAAGATTTTTTGTTTTTGGCGCCCCTCTACGCTCATTAT GAACACAAAAAAGGGAGTGTGTGAGCGAAGCGAGCCAGAAAATTTTGAGT TTTTGAGGTAATGAGGGCGCCATTTTTGTTTTCTCTGTCAATCTTTCTAT ATGGGCGCCTGAAAAATCCTTCTTGGCGTCCCTTATTTTTGGGCGCCCCT TCTCAAAAGGGCTCCGCTGGGGGGGGGGGGGCCCGGCCCCCCCCGCCCCC CCCCCCCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCCTTATTTTTGGGCGCCCC TTCTCAAAAGGGCTCCGCTGGGGGGGCCTGGCCCCCCTGGCCCCCCCTGC CACCACGCCACTGGTCAGGGGGCTGTTTGTTCAGGGGTTGGCAAAAGACA AGGGGTGCAAAAGTCGCCTCTGATTACTAATTTCGTTACCCCTTTACCTT TTCACACCTAGGAACTAGCAGTTTCAGGTAAAGATATAAAAAAAGTCAAA CATTTTCGTACACGCTTCGCTCGTGTGTATTTACTTACGTATTTTACAAC GATATTTACTTTTGATAGGGGAAGCCAAAATCACAACTTTGGAAATTGCC TCCTCAATTATGCTCAATTTTAGTCGACCCACCACGATACTGGTGCTACC CCCCCCCTCTCCTAGTGTATATTGTACTATAACTTCCTTTCCGGTTCTAA CGTTGGACTTTTTCAGAAGAAAACAGTATACCCCTGTTGTGGAAGTCCAA ATTCCCACCGAATTCTAGCTGGAATTAATTCAATTCCAATTTGTTCCAAC TTTAGGCACAACGATTGATGCATGTAAAGCAGTGGTGGATAAAAGTTCAT CTTCACAAAATCCAATGAAAGGAGTTGTTTGTCTTTCTTTCTTGACCAAT GAATTTATTCGCGAAGAATGGAGTCAAACGGAAAATTCTTATTGGTTCCT TATAAAGAGAAACGGTGAGATTGACATGAGAAAAAAAAGAAGAAAAAAAA GAGAAATGAGATTGACATGCAGTCCCGAAAAAAGGATTCAATAAATTTTG TCAACTAATCTAGACTCGATGTCTAAATTTAGTTATACCCATATTTAGTT ATAAAGCTTACTTGAAGTTCAGATTCCTTCTTTNGTAGACAAAATTGTTT ACATTAAAAAGATATGCCAGTTATCTTGCAGTTGTAACAGCAATATCGTG TAGAAGGATGGGAAGTCATGACGTAACGTGGTAACAGTAGCAGTAAACGA GGTAACATTGCGTTGTCAAGGTAAACGAATCCTCATTCATAAAAAGCTTA AAGGAAAAATAAGAAACATGAAATTAGATGATATGGCGGTCATCGAAAAA ATGCGTTCTCTGTTCGCGTCGCAACGGGTGTTAAAAATTCATGCGGGCAG ACGGGCGGTCGAAAACATTCCCGGGTTTTTTTTAATCACGCCAATAACTC AGGGGCGGGTGGTAACGCGAGCAAAACAATTNGACTAAATTTTGTCAACT AATCTAAACTCGATGTCTAAATTTAGTTATACCCATATTTAGTTACTAGC CATAGCTTTCACTAACTGACACCCGCTAGTACAAATGCTTGTAAAAACTA ATTAATGCTAATTAAGGCTTTTTAATGCTTTATAGCAAAAGTTTGGAATG ATTTGGAATAGTTAGAATGATTCTTCTCAGCATTTTCTTTGAGATATCAA TGAATAAGCTAACATAAACGAAACATATTTTTTTTTCTAAAAATGTGAAT TACTTTTTACAAAGAATAAAATACGAATCTTAAAACATTAATTAGGAAAA GTGTCCAGGTATAATCAATTACAGACAGTTACAGATACTAAACCAGTCAA AAGACATGCAACTATTATTTATTTCAACCAATTTGAAATATAAATGAAAC ATAGTAGAACCAAACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNTAAAGAAAAAGTTTTTAGGCTAGC AACTGCCGTCCCGGAAAAAAACCGAACATTTACGGAAGAGACTAACTACG GGTAGGCTTGCGCGACAAAACAAAACAAAACACGCAAAGATTCGAGATTC CAGTCCAATATCTATGCGTGAAACTATGAGTGCCTCCTCGTCGCTGCGCT CCTGTGGGGGCAATGAAACTATGAGTGCCTCCTCGTCGCTGCGCTCCTGT GGGGGCAATAAAGCTTACTTGAAGTTCAGATTCCTTCTTTTTTTTATTCA CACGATTCTAAATTTTTTTTTCTCGAATTTTTTACTTTTTATTTCTACAC AGGCCAAACATTCATACACCCGAAATTCGGACAACCACTTGGATCAGATG AACTTTCTCGGACAGTTAGTATTTTACAAACCGAATCTTCACAAAGTTTC AAAGATGAAGTTTACAATAATATGATAAGGTAAACCTTTCTTTTAAGACT CTTTTTTGTATTTTATTTATCCATGACATAATCATCATATCGCCACAAAT TTAATTTGGTCGTAGAATATTAAAAAATAACCGTATGAGAGCGATGTTTG ATTAAAAAGACTATTTATATGGGGGGATTCGAAATCTACCAATTTACCAG AAAATATCTTGAGATCTAAATCGTATTGCTCTACCACTAGCGGCGTTCCC GGGTCAAAGACATTATCACACGTAATGAAACCAATATCTCGAGGGCCTTT TGGAGCAACCTCACAAAACAAAACATTGACTTATACTTGGAAAGCTGTTC CAAAGTCTGACTTCATTATGACCATTGTGACGTCATCTGATTACGAAAAG TCCGAACTCAAAATCACCAATCAAGGAGGGAAAGAAAATTACCATCGCAT TGACTTGATTCCAGATAATTACGCGAATGATTTGTGCAAATACAGTAGTG AACATGTTGCTACAAAAGGTACTTCTTTTTTCCTGCCGCTGTTGGCATAT GCCGACAAAATCATTTTCGATTTCTTTGCCGGTATCGGCATTTGCCGACA AGAGTGATCTGGACCTGTTGCCAGTAGACTCTCTCTAGCTCGGAAAATCT AAATCTTAAAAATCTAAAAATCAAGGCTCTAATTTACTTTTAGAATATAG AGTTTTAACATTAGACTTAAAACCTTACGACCTTAGGTTCCCAGGATCCC CAAAAGTTCAGAAATTGTTCACATGAGGCTTAGATCATAGCTTAGGAACC ATCGAATCCCTCTAAAATTGAAATATCAAATGAAATAAAGTGAAGTTACT GAAATCGAAATTCTCGCATGAACTTTAAGTTCTGTAGAAAACTATCACTA TATTTTGAACTTTCAATGTAGCTATAATTTCTACTCTTTTTCAAATTTTA TTTATTTTATTTATGTGGAACGACATCAAATTTCTTCCAAAGTTTCATCA AAAGGGTCTCTAGAGAATCGATGACAAGGTTCTATGAAAAATTGACTTTT AATGTGTTAGAAAGATGATTTCGAAAGAGGGTTGTTCTCCCAAATGTTTA AATAGAGAGTTTATGTATTTGTGTTTTTCTGCGAGGGAGATGGTTAGCTT CTGATTTGACTAGCTCCTGATCAATTTATTTTTGATTTATTTTTGATTTA TTTTTGATTTATTTTTGATTTATTTTTGATTTATTTTTGATTTATTTTTG ATTCATTTTTGATTTATTTTTGATTTATTTATGATTTATTTATGATTTAT TTTTGATTTATTTTTGATTTATTTTTGATTTATTTTTGATTTATTTATGA TTTATTTATGATTTATTTTTGATTTATTTATGGTTTATTTTTGATTTATT TATGATTTATTTCTGATTTATTTTTGATTTATTTTTGATTTATAAAATTG TGTACGAGATTTATTTCAGTGATCCTCGATTTTTTCGGGTCAGAACTTCA GTCACTCTGCCGTCCTCAAAAGTGTAAATACATAAACTCGCTGATATTTG AGTGAATGGTATTTACACTTTTGAGGACGACAGAGTGACTGAAGTTCTGA CCCGCAAAAATCGAGGACAGTAAAAGAATGTAAACTAGCTGATACTTGAG TGAATGACATGAATATGAAACTCTCATTTTTTCCAGATCTTTCGGTTATC AAATTCCCAGCAGATGCTTTTCAACGACCAAGTTTTTACTTCAAACTTGA AACTAATGAAACTGTAAAAGAATTGAATGATTTGTTTACACCTGGGAACA CGGCAACCCCTCCTGATGAATTGTTCAAGGTTTGATAACATATATTTTCT TTATTCGCACCTGAAGGGGATTAATTTTCGCAAGAAAAAATCTTAGTACT CGCGAAAATTTTGATAACACTGCTTTTAGAAAAATGAAAGAAATTAGTTG AAAAAGGGGGAGATTCGCGAAAATAAATGAAACTATTTTTGAAATAATGG TCTCACGAAATATGCGCTCGCGAAAGTTTAAGGTCATAAATGTTTGATTC ATCATTTTTTCAATACGGGCTTTGCCTTTTTTCAACCCCGGCTCCCGGGA GCTGGCAGGCTCTGAAAAACCTTTTTTCATTTCTGTTGACTATGTCTTAA ATTATAATGTTTTACAACTTTTTTTTCGACAGGACATGGATGTGTTCAAC CATCTTCGTCAGTCAGTGCAAGCTACACATTTGATGGAGGGATATTGGAA AAATGACACATCTGAAGCTGCAAAGAACACGTTAACAAGGTTCTTATATT TGATATAGTGACCAGGTAGCTCAGTCAGTAAAGTATTCGACTCACAATCC AAGAGTTGTGGGTTCGATTCCCGGTCCACCAACTCAGTGAATGAGTAGCT TAGATTGGGTAATCCGATCTAAGCGGAAAGTTGCTGAGAGATGAATATAG GTGTTTTACCTCAGCATTCAATTTCCCGGGTGTAGCCCAAATAGAAAAGG GAAAAGACTTCCTCACTCCCGGCTCTGCCGGCAGCCACCAGATGAATATA CTTATTTACTCTATTTGATTTATATGATATAATTTAGTCGTAAGTGACAA GGCGAGATTACATTGAAATTCCACTGAGTTATACATTTTCGAGATAGGGG TATAAACGGGAAATCTTTGGCTTTGGGTCCTATCATTGTAACGTTCAATG GCCAAAAATTTAGCTGTTTATACCCGTCATTTTCACCTCTAGATACATTG GTATGCATAATGGCTTCTTTCGAACGTTTCCTGGACATTTGATGAATCCT TCATACGATCCAAGAGCTCGACCATGGTGACAAATTTACTCTTTATTCAG CTTAGTCTCAATCAAATCGAACTTAGTTTTATAGATGGAAATGAGTTTAT ATTTAATGTGGAAAGCTAAGTCATCTTGTAGATTGCGTCTCTTGATTGCC AACTGGATCAGCTATTTTTCCCTATATGGGGTGGGGATTTGTTTAAGGAA ACCCTCGTTTGTGACGCTGTTGTCTTACAGCTCAGCCAGCAAAAAAAGAA ACAAGAAAAAACTTAATTTGATCATCAACCCCTGTAAATCAAGGTCTTTC TAACTGCGTATCTTTAAATGATATTCTATTCATCTAGGTATCGATTGATG ATTGCACAAAAAGGAATAACTTTAACAACACCCTATCCAGATGCCTTTAC CGGTGAAATTGTCATGACGCTAGGGAAAGTTCTACTGAAGTAAGCAATAT CATTCAAGGTTTGCTCCAATTCCTCTAGAACTTATAATTGTGCTAATTTC ACTTAAATGTTCGAGTTGAACACAATTCTCAATCAAAGGTCATCAAAACA TGCAATAAATTTTTTGTATCATTACGTCAGTTTTCTCACATCAATAAGTT TGAATCAATCTTTGCCAATGATCTCTATATGACGTTTTCAAGCTTCAAGC TATTTGACCAAGACTTTATTTAACACAATCACTTTATCTTTACTTCTGAT GTTAAAGAGGAAAGAAGTCAGTAGAAAAAGCAGGGAACATTGCTATGGAT TTCAAACCACTCTACTTCAAAGAGTTACTAGAAAGATCGATCAAAGAGTG TGCATCTGGGTAAGTGCTGGCTTAGTATTTTTATTCACTTTTTGATCATT ATAAAGTCAAATATCCTTAGCTATTCTCTGTGGCCGTGGTGCAAAGTTAG ACCATCCGGATACGGTATGCAAGGACGTCGAGAGTAAGAGTAAATTCTAT CGTGGGTTCAATCCCCAGCCGGGTCCTACCAAAGACTTCGTACTTGACTT GCAGTTCAGCAATTAAGAGAAAGATCAAGGGTAATTAGAGCAATCCAGGA AGAAAGAGTGGTGCCCTCCTTTACCTTCGAGTAGACAGATATTATGAAAA GGGAGCCTTCGGGTTGCCTCGACTGCGGTCGCAGGCTTACTTACTTATCC TATTTAGCTCACGACCAAACTTTACCAATGATAACGGTGGACATAAACTT GCTCTTTTTCCAAGAAATCTATCCTAAGCAACCTGGCAGCATCTCAAAGT AAACTCAATTTAGAGACAACCGTTTAAGTTTTTCAGACTTGAGAACTTTA ATATTTCTTTTACAGAGCATGTGTTGTGATTGATCGAAACGGCTTCGTAG TTTATCAATCGAGTTTTATGGAAGAGAATGAAAATTCAACCCTCGAAAAT CAACACATCGTGAAGATGGTAAGTCACAGAAAGAATTGCTTGTTTAAACC TTAACAATGCCTACATAAAACAAAAGGTTTTGAAAGGGACTTATTTTGCG AAAAAAATTTCTAATATTAGTACTATCGTTCAACTATCTTAACATTAAAA ACCATCGAGCTACCAGGTGGGGTACTAGTGTTGGCGGATGAGGGGTATGT GTTGGCGGGACCTCCGAAAACCGACCCTTAGAATGATTTTTACTGAAAAG TTGACCCTTAGAGAGACTTTTTTGAAAAATTTTCTTCCACTTTTGAAAAA AGTCCTACCCTTAGAGAGACTTTTTTACAATTTTTTCTCTCAAAACCAAA AAAATTTCCTAGAAATTGTGAATTTTCATACCCTTAGAGAGACTGATTTT TCCGACCCTTAGAGGACTTTGAATATTGAAAAAACCGACTCTTACCTGGG ACTCGTGGAGGTGAAAAAAGGTACCTTTACCAGCGACTCTAAATACTCTT AACTCCACGGAAAGGTAGTACCCTAGCCTCAACGTTCAACGGGGCCATTA TCTCCTTCCTCTTGGACGATGAAGAGGGAAAAAATCATGAATTTGTAAAT TAGATTATTTTATGAACTGTATATGGTATGTACACCAGAAAGCGTCAAGA AAAATAAGAATTGTTTCATGAATTTTCCCGGGGGGAGGAGATATTTGGGC AAAAGCAGTGCGGGGATGTGTCGCTGGTTAAGGTACCTTTTTTCGCCTCC ATTAGTCCCAGGTAGGGTTGCAAAAACACCGAAATAGACAAATCAGTCCC TCGTAGGGTACCTTTTTGGGGGAAATTGGAAAAATATAGAAATTTTTGAG AGCATTTTGGAATTTCAGTCCCATTCAGGGTCACTTTTTCATAAAAACGA GTTCCACGTAGGGTCCATTTCTCGAACTTCAGCGGCACAACCCCGTCGGT TAGGCCAAAAAATTAAGAAAATGCTTAAGAATATCACCATCATGAAATTT GGCAACATAACCTAAGAATGCCATTTTTAGAGTATATTTAACTGTAAATT TCCAGTTTCACAAAAATGTCATTTAATTAATCGGAATTGTATTCGTGCTC AATTTAGGTAGATTTTTTATCCTAACCTAAGAATACCGAAAAAAGTTAAG AACATCCATGATGAAATGGAAATCCATTGCATTATTATAAAAATAGTGTA TATTTCTGGAGAATATCTCCGAAGAAATGTACCATCAGGAATAATTTTCT GAGAGGTTATCGTCCAGAGGGGCATGTCTGCAGGAATGATTTTTTTGTCC AATCTTAAGACAGTAATTTTTTCATTTTAGCATGGTAGACTCGCAAAGAC GATGATTGAGAATGGAGTTATGATAAAAAATTATTGTTTGGAATTCCGAA ACAATGTAACCGTAAAAGAATGGTTTTACTCTGTAAGTTTCAAAAACCAA CTCAATTAAGAAAATCGTCTACTTAAGTTTAGCTTTATGATTAAAATATG ATTTCTGATTTCTACGTACCGCGCTCTACCTAAAGAGATATTGTGAATGT GACGATCTGACCTGGTTGTTCAACCAAAACATTCGAAACCGCGTTTGCCT TTTACTTGGAAATGCATGCGAACAGGAAAGCGACTGGGTACTTATGTATA TTGTTTATGTATTTGATTGACAGTTGATTTTGGTGCGATGGTTTTGCTTT AGCCAATCACTGTGCTGAAAAGCTCATTTAAAATCGAAATCTGAATGAAA AAGATCAAATCCGTGCGACAACCTGAGCAGATTATCTTACGGAGCGATGG CCTTTAGAGTGAATGCGTGCCATGCGTGGAGTATCAGAATCTGCTCGGAG ATTAGTTGTAATCTATTTATCACTTTTCTTCATCTTTTTCAGCTTGACCA CGTGATAGAAGCGAAATCGTATAGCAAGGGGTGTTTGAAGGATTATCATG TTGTGCCGATTATCGATTCCAATCTTTTATTGTTGTATATTAATGATCGA TGTGATGTTAAAGAGAAATGTACTTGCAGAGAACCGATAAACGGGGTAAT TGTCAATGTCGAACAAAATATCACATATGTTTTAGTATGGGAAGCAGTTT GTGATTTACATTCTTTCAAACAACATTCATTTTCAATTAATTTCCGCCGG GGAAAAATCAATTTTTCGGTTTAACATTTAAAGTCTAAAACTTGCGGCGA TCTCCAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCCCCCCCGA GGGTATTTAACCAGGTTGGTCAATGTGTTTAGATTGCAGTAAAATTTCTG TAAATAATCTTTTCCATTATCTTTATTAAGGATTCTGCATTTTTTGTATG TCTGAAATAATTATGTTGAGTAATATTAGATGATTTGTGGTAGAATAAAA AGGTTTTTCAACCTATGTAGACGAAAACCTGGCAAAGTCCAAGAACTTAT TTTTATGGATTGGTGAAATGAGTAGCTCGTGTAACAAGGAGCTTTCAACT AATGATTATAGTAGGGTTGAAAGCGTCAAAGGGGTTGCCTTGGTAACTCA AACTTCCATCTCTGTATTTTCTTTAAGAAACATTTTTCCTTAGATAATGA GTATCTCAATCAAGAAGTCAATGTTGCTTGCCAATATAAAGAATGGCTGA AAGAAGTATTTGTGGAATTTGATAATCATTCATTTTCTATTCTTAGAAAT TAAGAAAGGGAACTCATTTAGTAGTTTAGTGATTAAAGTATGATGGTATT AAGGTACCAGCAGTTTGGAGTTCGGTTTGCATTCGAGTAAGTATGAAGCA GTAGTCTTTTTTTTAATTACTTTTGGTGTTGAAAATGAATAGATAAACCA AAAAAGTCAAGGTTCCTAAATTAGCAATTTGGTACCGATAGTTACTTGTT TACCTTTTTACTGACCGACGCGCAACATATTACGTTTTATAATATACAAC TATGTTATATCATAATATCATAATAATATATTACAAACGGACGATAGCCT CGTCTTGCTCCACTTTTTACTGGTACCGTAGCAGAATAGAAGAACACGAA CCAAGGGGTTTGGGTACAAGCTTGAAAAATGAGGTGAAAGTTTATTTACA CCCCTGTCTCCCAGCACTGGTGGAACTTTTTCTAACAGTGAAGGATAAAT ATTTCCATCTATTGTATTCTATTCTATTAAATTTCGAATGGGGATGAAAT CAAAGTCAATTTTCCATAGGGGGTTGAAATTTAGGGTATTTTTCCTAACG GGAACGAAATTTCGGCCAAATTTTCTAGTTGGGCTTGGGTTCCGGTGGGT CTACAGAGTTATTAGTTTAATGATGACGTCTGTTATTTTTACGTTTCCAA TGGGGTTTAGTATCATAGAAAAGTTCTCCATCTTGATTTCTAAACAAAGC TACTATCATTCGAGATCATCGTTTCTCAAAGGTGGGGACGATTTCGTTGT AGTATGAGAATATCAAACTGTAAGATCATATCATAGGCCCCATGGAGCCG TTTGAAGTAAGATGGCCAAACTTTTGAGATCAGGGTTGAGCGACGAAGAA ATCTTTCACTTTTACGACTTCTCAACACCATTTTCCTAAGAATTCAGGTG TTTTAGAGTCCGCAAAATATTCTTCACTTGTTCTTAATTTTTGGCCATCA AAACCTTTTGTTCTTATATAGTTTATTCTTATAAAAAACGTACATCTAAT CTGACAAAAAGATTTTTTGACTTTTTTTTGAAGGGAAGAAATACTAATCA ATTAAACTTATTTGTTTATTTTTAGTCAAAAATGTCAACGTGTAATGACC CTTTAATATGCTTGTTTTAATTTCTAAAATATTTGGCCATACATTTAAAG AATAATTGACATCATTATGAATATTCAACTTGCCTTGATAATAACATATA TGAAAGTTGTAAAAATCATGTAGAGATAAAATAATAAGCGAGACTTAAAA GGGATTTTAAAGTTGTTGTTTTTTCACATAGCTATCCTAGTCTTTTGTTT TCTCAACTTATTACCTTTAGGGTTTTATTTAGCTAAAGCATCAGAACCTG AAAGTACGAATAAACGAATTGATTTAAGTCCAATTGGTCTCATTTTTCCA GCTGAGATAATCTTTTTGAGCCTATTATAGCCTGTTTAAAGACAATTTCA AAAAGGCTTTTTACTTTCAGTGATTGAGTTTATATTCTCTAAGACTTTAT TAATTCCTTGGAGGATTGGGGAAACTCAGATCGACTTTACAAAAGATAAT ATTCATCAGTAATAATCATCGTTGTTGCGATTTTATTTTGATTTAGAGGA TGGTCTTTTAGGAGGACTGGACATAATGTAATACAGTTGACACTCTCTAA TTTGATTTTCGTAGGGAATTGATTTTCATCAAATAAGGGAGCATATCAAA TAGTAGAGCGTTGTTTATGAGAGTTTATCGTTGACAGTGGCTTTCAATAT TATCGAATAATGGAGTCTATCGAATAATAGAGCGTCTAATAAGAGAGCGT CAACTGTAAAGGCCTACTTTGAGGCTAGAAATTATATCCATTTTACAACA CTTAATTACTAGGTTTTCTTATTGTTCTGACTGTTTCAAAGCATGCCAGC TTTGCAATGTCATTATTGACGCATTAAACAAATCGTTTCTGATTTATCCA TGTTAAACCGCAAATCTTGAGAAAAGCTTCAGAAAATTGTTGATTGTTGT AATTATTGTAGAAAACTTCAGAGCTGTACCATTATGAATTACTACGTCAT CATTGTGTTATCTTTATTTCATTGGTCACACGTGGGTGGTGATCCTATCT TAAATCGATTGAAAGATGGCTCCAAAGATTTTCAACAAGAATTGACAAAA CTGGTCAATGAGAATCTTGGCTATAAAACTTTACAGGTATATATTGTCTT TAAAATTTAAGCTTCTACAAATTCAAATGACTGAGAAATAGGTCTTGTCA CTTAGATTTGGGTAACTGACATATTGTTGAACCATAAACTTGTTCGTGTA CTTGGTTAAAGAGATATTTGGGTTTATTCAAGGATTATTGGGCCATTTCA TTTATATTCATACATGGGGATGGACAAACATTCCCAGGGAGGGGGAGCAG AATTTCCAGGGGTCTAAAAGAGTGTTTTCTCATTTTTCAAAATTTCCAAG AGGTAAAAGGCTGATTTTTGTTCGTCCACTGACCCTTTAAGATATAGAAA GAAGTTTCGCAAGGGTTTTTCGACTTGAAAAGGTTCGTCCACCCCGGTAT GGAAATTCAATGGAATGATCGATTATCGCTATATTATAGTCCTTGATCTC TTTCAAATTATAGGATAAATTCCATAAAATGTCTCAAAAAGAAGACCCCT TAACACTTGACGCACAACAAACTGTTGATGATGTGAGTATGGTATTTCGA AATTTTTGGCTTTGCTAACGTTATTTACTTTTGTTTGAGAAAGATTGCTC CTGTTATACGTATCTATCTATTAAGACCATGTTCTAGTGACCAAAATTAC AGCCCTATGTCACAGCCCCACTGGGAAGTTTGACAAAAATTTCGTCCCCG GTGGGAAAAATGCCCTAGAATTTCAGCCCTACTGAGAAATTGACTTTGAT TTTATTCCCATTCGAAATTCATTGTTTAGAAATTGCAACTCCAAAACCAT TCCCACTAGATTTCTTAACCTTGGAACAATACAATTTTTATCCCCACTGA GATTTCAATCGAAATTTTTATTCCCGCTGTAAGACTAGCCGTATTGTATA AGGGTTGCGAAGCGATCCAGACTCCACCTCAATTCGCAAATTGCTAGCAA AATAAGAGACTCTCTAAAAATCCCTCTTCTAATAAAAGCGCTACAGGGTC GTAAGAGCCTTAATGCCCCAAACACACCACATAATCCACGGCGGCACAAC ACCCGCCGCTGCCCGCGCATCGCTCTTTTGTTTTCCTTCTAGNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTA GTTATTCTAGTGTAAATGGTGCCTTAATAAAATCGAACGATATTCGTCGA ACGATCGAACATTTTTATTCGAATCACGAATCGTCTGTCGAAATCATCAG AAAACATAAAAGTAAAACAAAAACAAAAATGTACAAAGATGGCTTGTTGG TTCTTCAAATTCGACAAATTTGATTACCTCCGTACTTCTTTATCATAGAA TATCCACTTGGTTTTGCAAGGTAAAGTTTCGTTCACTAAAAGAGCACTCC TCCCGCCCGCGCGACTTGCAAAAACTCTCATTGATTGACCTTATTTGATA CTTGATACTTGCTGTTAAAAGTCAAGGGATGACGAAGATCCTTTCCGTCA CCGTTCAACTATTTTTTTTCCATTTTAACAGCAAAATAAACATTAAAAAC CGAAGAACCACTGCTTAGATTGCTTAGATGCGTGCCGCCCGCGCGGTAAT TTGATCAACTCCAGACAGTCAAGAACACCTTCAAATTAGCCTATCATAGG CTGATTAGCCTATCATAGGCTATTTAGACTATTTTATATAGGCTATTTAG CCGAAATCGATAAAAACCTCGATTTCTAACGAAATATAAATAGTCGCGTC TATTTTTCACCATTACTTCATTGCCCAAAGCCAAAAGAATCTTTTTCACT TAAACTGATATGACATTCAATTTTGGAAACAGAAATATATAAATAAATCT ATTTTTATAGGCTAATTTTCTTATAATGAAGTGCCGTGTGCAAAAATACA TGTTTGTTTTTTCTTTTTTTTTTTTTTTAAAAAAATTTATTTTATCCAAG ACTTTGAGCGAAAAACAGCAATAGCCGAAAACGTATTGAACAAAATGGCG AGTCACATTTTGGATGATTACAAAACGAAAAACGGTGATCAAAGACCCGT CGAAAGTTGTTGTCAGTTTGATGATTTAAAACTTGATTTTGATCCCATTT TTGGTGAAAAGGTATCTCTTAACTTTGGGCTTGTTATTGATAAATTTATT ATGAATAATCCAGTCATTTTGATTCCAACCCAACATCACAACTGTAGAAC ATGACCATACTAGCAGTAGCATGGTAACTTATCTTCTCCAATTTTGGCGC ACCTTAGTAAAGATAGTAGCGAATTAAAAATACCTGGACGCGTTTTGCGT TTTTGGTAATTTCTTTATTTTTGGGGCACCAAAATTGGTGATTGGATGAA ATCTCCGCGTTCTTTAACATCTCCAAATAACTGAGTTTATGTATATGTTT TTTTCTGCGACAGAGGCGGTAAGGTTCTAATTAATCTGCATCCTAACTGA CTGAGAACGACGGGAAATCAACACTTTTATCCGTCCTCGATTTTTTAGCT TATAACTGGGGGTTTTTCCAAATCACTTGAGACACTTCACTGCCCTCAAA AATGCAAATACATAAACTCGCTAAAATCAATGCTAAGAGAATTATTGACT NATTCTAAGTCCGTGTTTCGGCTTCCGGTAATTTTGTTGCTGTTCACTGC TAGGGTACACCATTTTAAAAAGGCATTTTTTGCAGTCCTAGCTATCAAAC CGAGAAAATTTGCGTGGCTTCAAGCCAAATCATTCAAGGTCATTTTGATA AAATCATCGGTTGGAAGATGTGATTTATATAGCAAATTTTATAGCAAATT TTCGCTTGGGATAGAAGTTAAAGGTACGTGCACAATATAGCAAAACTGCT TCGCTCATAAATTCGCTTCGCAAAAAGTTTCACCGGGGCTGTGAGACAGG GGTGTAAAATTGTTACAAATCCCAGCTGGCACACAACGTTTTTTCGACGT TTATCTAACGTTCACAACGTCCATATAAGGTTAGGTGAACGTTGAAATAA CGTTGTGTGCCAGGAGATGAGATTAGCTCCAAACTTATTTACTGAATGAT TTAATTTTTTTTTTTTCAAATAATTTAGTTTATCCAAGACTTTGAGCGAA AAACAGCAATAGCCGAAAACGTATTGAACAAAATGGCGAGTCACATTTTG GATGATTACAAAACGAAAAACGGTGATCAAAGACCCGTCGAAAGTTGTTG TCAGTTTGATGATTTAAAACTTGATTTTGATCCCATTTTTGGTGAAAAGG TATCTCTTAACTTTGGGCTTGTTATTGATAAATTTATTATGAATAATCCA GTCATTTTGATTCCAACCCAACATCACAACTGTAGAACATGACCATACTA GCAGTAGCATGGTAACTTATCTTCTCCAATTTTGGCGCACCTTAGTAAAG ATAGTAGCGAATTAAAAATACCTGGACGCGTTTTGCGTTTTTGGTAATTT CTTTATTTTTGGGGCACCAAAATTGGTGATTGGATGAAATCTCCGCGTTC TTTAACATCTCCAAATAACTGAGTTTATGTATATGTTTTTTTCTGCGACA GAGGCGGTAAGGTTCTAATTAATCTGCATCCTAACTGACTGAGAACGACG GGAAATCAACACTTTTATCCGTCCTCGATTTTTTAGCTTATAACTGGGGG TTTTTCCAAATCACTTGAGACACTTCACTGCCCTCAAAAATGCAAATACA TAAACTCGCTAAAATCAATGCTAAGAGAATTATTGACTGTCGCAACTTCA CTATATACACCCTCCCCATATATCTAAACGATATTCCCAAAGGTTTCAAT GGAAGACATTTGCGAGCAAACACCTCCAAGCAATTCGAAAGTCTGTCCCT CTCTTGGAAGTCCTCCATCAGAATCCATTCACTACCTAAAGAAAGAGGAT TTGGTCACAAAATGCAAGGATGTTTATAAAGAAGCCAAAGGCGAAGCAAG GAACATTCAATACGACTCTTTAGACGGTTATTCGTTCACTTATCCTGCTT ATCAAGATCCTTCACAAATGGAATGCACATGCGCACAAAGGGATCCCAGA TTCAGGTTTGATAGTTTTTTTTTTCATGATGGTACAAAAAAAAGCAAAAG CTGTAAACGAACAGAATTGCTTACGTCAGCAAATATTTTTTAGTAACAGG AATACGTTAGTGGAGCCAGTAGCCTAAGTTCGATTGAGGTCCTATGGTAT AGTGATGTAACCACCAGGGATGTATTATAATAATTAAAAAAATTAATTAA TTTATTAATTGATTTATCTTCAAGTTCGCGACTATTGGAAACGTTACCGG GAAGTGAAGGGAGACATTTTGTTATTATTCTGGATTATTCCGAAGAAATT AAAGATACAATCTCAATTGTGAAGAAAGTTGCAAAGACATTGCTCAACCT TGTCACATTTAAAGATGAGGTGATTTTCTTTCTTATGACTCAGGAGACTT CTAAAACTTTAAAGACTAAGGGGGGGGGTACTTAGGCAAACTGGATGCGA GCCATAAGGGTCCCTTTTTCACACCCTCGAAACTCTTTCAAAGGGGTGCA AAAATCCTCCTCTCTCAAAGGGTCTTGATTTTCTAAAATTTGGATAAAAA TCGATTGAAAATTGACAAAGATTTTGAAAAAAGTCCTCTCTAAGGGTCCC AAAACACAAATTTTTCCNACACCCTCGAAACTCTCTCAAAGGGGTGCAAA AATCCTCCTCTCTCAAAGGGTCTTGATTTTCTAAAATTTGGATAAAAATC GATTGAAAATTGACAAAGATTTTGAAAAAAGTCTCTCTAAGGGTCCCAAA ACACAAATTTTTCCTCTCTTTAAGGGTCGACATACCCGTCACCTTGCAAA CCTAGTACCCCTCAGGCTAGTCGTCAAAGACCAATTGATTAAAATTTCCA ACTCTATCGTTTATAGAAATCTTGTACCAAAGTCACTAACATCACCTTTT TATTTTACTGATTTTGGTAGGATCTGTGTTTAATTTTTCATCTTTATAGA TTTCAGTAAAATTTTATCATGAGGATAATTTGGTACCATCGGACAATAAA GCAGATTGTTTGAAGATTTCATCAAAAGCAACTCCTTATCTCAAAGATAA AATTCTCCAACAAATTGAAAACAAACAGCCAAAAGGTAGGAAAGAGAAGA TCTTAACAAATTAAGGAAATCTGGTAAAATTAAATCTTTTTAGAAATAAG TTGTCCGGAAAACACCGACCAAATTTAAAAATGCGAAAAACTGACCATAG TTTATAAAGGTCACTATATCTTCCCTGAAATCCCCTGGACATCAGGAATC GCACTTAAAGCCACAGATTTTCTTAACCGAAGTTTTACTCTCTCATTTTT TCAAGGTGAAGCAGCTAGCTATAAGAAGATCTTTGAAGAAACTTTTCAGA TACTATACAATGATAAGAATAATCAAACAGGTCAGTTATTAGACGATCCT CTCGTCTACATAAGGTCAAAAAGGTTATAGTTTAGAGGAGACGAGATAAT TTTGAAAAGCAGCGACAAGCACGTGGCAGATTAAGAAGTGGTAGAAGTGT TTACTGGTGTATTCTTTCCAAACTCTACCACCACTATTTTTCCCCGTAAA CTTCCCTGACGCCCTGACGCCCTGACTTTGCACATATTTTGTTGGAATCA ATGTTGTTGAAAATTTCCAGGGTTTTTAATCCTTGGTTCTCTGTAGATAA GAATAATTTTTGTCTCTATATCCCCTCGTCTCATTGATCGGTGAAAGATG ATTAGTAAGCGGGGATAAAAAAAGATTCTGGGGAATTTGCCTTCTAGGAA AACTTTATCCCTGGAAATTTTCATGTCACCGGAGATAAATTCTAAAGAAG GTTGAAAATGTATTTCTTCTAAAAGATCAATTAGGATTCTCAGAAAATTT TCCCAGATGAAAGGGGAATTAAAGCTTCACAACAGAGATAAAAGTTTGCA GCTTTTGATATTTTTTGGATAACTTTCCCAGTGGGTAATAGGGTCTCATC GGTTCTATGTTAGAGACAGACCAGGTACTTCGGAATTATTGAAATCTTTG TGAATACAACCATAATGAATGAGAGGTACTTCTCATCCTTTTTTTTCAGA AAAACATTTCATCTTTGTGACAAGTGGATACTACAAGGATGGCAGTTGGT CTGAAGTTGAGAAAGGGTTCAAAGATGGGCGGAAAAGTTTGGAATGTGGC GTTTCTTTTTCTCTTCTACTAATATATGGTAAGCTTTATAGGGCAGAGTA AATACACGCTTTTTTAGAAGAATGGTGTATATCCATTCCATCGTGGATAT TCTTAACTTTTTTTGGGGAAATCGTCCTAAAATATTCTTACAGCATTCTT AGGTTAGGATCCAATTCAGACTAGCTTGAGTAGCAAAATTCCATGATGGT GATAATATTCTTAGTCTTGTATTCTTAGTCTTTTTAGCCATTTTCATCAT ATTTCTTATAAAGTGTATTCTTATAAAAAAGCGTGTAGATACTATTTTCC TTCGTTACACTATGAACTATAAAATCAATAGTCACAGGAAAAAATTAGCA GATCACAAGTTTGTGAAACGTTGTTTCCGGCCCTTAAAAATCGGATTTTC AAAATTTAGTTTGTGAAATAAAGTTTGGGATATTGTGAACATTGGGTTTT ATTATTTCACATTGAGACTTTCTTTTCACAAGGTCATCGTGAATTTGATT TTCACAATGACAAAATTAATTTTCACAAGCTTAAGAAAAATAGGTTGTAA AATTCAATTTCACAAGTTTGTTAATTTTATATATCATAACTTGGGATATT GATTGACAATCACAATGTAAAATAGTATTGGTAATAACCATTCTGATACC AAGTTTGGGAAAGTCAATTTCCGACCCCAAAAACATTTTCTTTGGTCTGA TTGGGATTTTGCAAATGCTGGGTATGTTTTATTCTTTGCTAAGGCAAATT TGTGAATTTAGTATTTGCAATGTAAAAATTGTTTTCACAAGTTTCAAAAG TAAGCTTGTTAAATTCCATTTCACAAGGTTAAGTTAATTGTGGTTACCAT AGATTGGGATGTTGAGAATAACAATACAAACTAGCACAAATTCACTAGTT GATACCAAATTCGGAAAAACTCGTTTCCGTATCTCTCCTATCGTCTAATC TGGGAGTTTGTTAATCCCAAATGTTTTACGAACTTATAATGACTTTTACA ATGAAAAAATATACATATGTACAATGAAGAAAAATGATAAAAAATGTTCT TAACCTGTTATTTATAGTCGTGTAAGATTTTAGAATTTGGGAAACAGCCA AAATATATTTATTTTTTACTGTACAAAGATTTAGGTGCTCATTTTTGATT TTATACAATATTTGTAATATTTTCAGATGGAAAACTAGCGGGAGCAACGT ACAGCAACAACAAAAATCTTGCAGGAGTCGGATGTGATATAGAGGTGGGT CTGTGTACTAATAATATGTTCCTTTTTTCCAAACAATACATCAATTTCTG AAAACTTAAAATGTTGAAGCAGCAAATATGTAAAACAGCAAAAATGAATG CAATTTCTGAAAATAATATTTCACCCCTGTCTCAGTGACAGTGTCTGTAA AACCCCCTGGTGGATTTCATTAATACAAAATATCTACTGAGCCTGGATTG CTTGTTTTCGAGCTGCCTTCGAGGTAATGAAGTGAATAAATAAGCGATAA TTGTTGCATTAACCTTCAATTTCATTTTTCTAGGGTCGTGACAACTTTAT GGAATTTGAACTTGGAAAGGATAATAATCATTTTACCATCAATTCCAAGA TATCTGCCATTTTATCCTCCGCTAAGAATTTCAACGACTTCGACGACAAA GTTCATTACATCATGCCTATATCTGATCGATTTGGAAGAGGTATTTGCAA AATAGTTTAAAGTTTTTTAAAGGATTGTGATCCAAGAGACACTTAATGAA TCCATTTGATTTCCACCCACGAAAAAAAGGAGCAACTAGAGCCCAGAACT AGACTAAAATGATCTAAAAATCGAAAGTTTCTGATCTCAAAGGGCCATGG TTTTCTTAAATTTGGACCAAAGTTTTATAAAAATCCCTTGCAACTGTTCT AAGAGTTTTTTCTCTCCAAGGTAAAGTCAATTTTTGTTATTTCGAACCGC AAATTTTAACCCTATTTGCGAAAATTAGTCCTCGCAAAATATTTAAAATC AGGACTTCGGCCAAAACCCCTAGGAAAATGAAAGAAATTGGCAGAATAAG TGGTCGATTCGCGAAATTTTGTCCACACAAGAATTTTGGATTTTCAATCA GCGAAAAACATTCCGCACGAAAATTAATCTATTAAGGTACTACCTACTGT TAGTTTTTCAAAATCTTGTTCCAATCATATTGAAAGTAACTTCCAATATG AATATCACTGGGTCGATAAACGCAAACTTATTAATTTCGCCTTAGCGAAA GTATTACAATGAAATTGAAATCAAGTCAATAACTCTTGATAGACGGTGAT ATACTTTTTGGTGATTAGTTCTTACAAAGTAAACAAAGGATGACGAAAAA GATGAGCATATTCATTTTTCTTATAAGCATTTACTTTATAAGAATCAAGT CAATAACTCTTGATAGACAGCCATATACATTTCGGTAATTAGGTCTTACA AAGTAAACAAGGGATGGCGTGCAATATGAGCATATTTATTTTTATAAGCA TATAATTTATAAGAGTTCTTAAAAATTAAACAGTAATTGTTGTTAAATTG GTTTTATTTTTTTAGCGTTTTTAAGCCTCGGTGTTCTTGGAAAATTGTTT CATCAAGGCCCGATGTAGACAGGAACCCGTCTGCGTATTTTTTTAAATCT GATGAATACTTGACGGGTCAGAGCTGTGAGTCCGATTTTGGCCTCAAAAA AATTACAGTGGGAAATTCAAACTGTCAGCCCATACCATGCTATATATTTC GCCATCAGTATATAGAATAAGAAATCATAGCATGGATCTCCAGGCTAGGC CCGATGTAAAGTAGATTTCAGATTAGCTTCAATCTCTACTTCTTGTTTTC CCCATGTAGCTAAAATTTTAGGCGAAACTTTCGACTTCAAGTCGTCTTGT TTAGATTAATCTTGTTTCAATCTTAGGCACAACCATTGACGCATGTAAAG CAGTGGTGGATAAAAGTTCATCTTCACAAAATCCAATGAAAGGAGCCGTT TGTCTTTCTTTTCTGACCAATGAATTTATTCGCGAAGAATGGAGTCAAAC GGAAAATTCTTATTGGTTCCTTATCAAAAGAAACGGCGAGGCTTACTTTA AAATCCTCTGCTTTGACAATAAATACTCATAGTAGTTTGTATTTTTACAG GACTGGTGCATACATTAGTTTCAGGCCCCTTATTTTCATACAGTCTCCAT ACACGCATGTGCATTTGATTCGTGTAAACTCTAAAGACGTTAATCTCACT TAAGAGATGTAAAAAGCAGTTAATGCACACAGAACTGGAAAACCAGGATT ATTCCCCAGAAATTTCCCTACATTAATTTAATTGTTATCGAAATAAAATT GAAGCATCTAATATATTTATCACAGGTCAAACATTTATTCATCCGAAATT CGGACAACCGCTTGGATCAGATGAACTTTCTCGGACAGTTAATATTTTAC AAATCGAATCTTCACAAAGTTTCAAAGATGAAGTGTACAATGATATGATA AGGTAATGTAATTCTAGAATCAAATTATCTATACTCCTGGTTTCAGCGGT ATACATTTCATGGAATAAATAGCTTTCACTCGAACTAAATAAGAAACTGT TGCAAGATGTAAACCTTGTGGAACCTTGCTCAAAACTTTTAAGAAAATAA GGGCTTCGATATTTAATTGTTTTGATCGTTTATAAAGGGTTATCTATGAT GAATCTTCCAAACCAATATTTTCAATCACATTTAGCGGTGTTCCTGGATC AAAGATTCTATCAGACGTAATGATGCCAATATCTCGAGGGCCTTTTGGAG CCACTTCACAAAATAAAACATTGACTTATACTTGGAAAGCTGTTCCAAAG TCTGACTTCATTTTGACTATTGTGACGTCATCTGATTACGAAAAATCCGA ACTCAAAATCACCAATCAAGGAGGGGCGGAAGATTATCATCGCCTTGATC TATGGAATTCCACATATTTAGATGATCATATTTGCAAATACAGTGAAACA CAGGTAGCAGTCAAAGGTACGTAATGTTTCCAATGTAAATATATAAAGAA CAAGAAGCCGGAGCGGCGTGAAGGTCCAACTGACGTGGCAATAACCGAAT GTCGCTCGTGCCGGGTTCCTTAAGTGACGCAAAAAAATTTCCTTCCCATC CTCCACTCTGAGCTTCTATTCTTTAACACTTTCTTTGTATAGCTAATTTA TGAGAAATTTGATACATTTCTCGAAATTTCGAAACTTTTGCCGCTGATGG GATTCGAACCCATTAGCACAAAGCACTTTTGATTAGAACGCCAGCGCCTT AACCACTCGGCCATCGAGTCACAACTACATTAAGGAGTTCAAAGTTCCTT ATAAACATGGTATTTACTCCAAACTTTACCCGGGGGCTAAAACCCTAACC AGGGGTTAACTCCCATCCCAACCCTAGCCCTAACCCTACCTGAAACAACC CTTTAATCTAACCAGGAAATTTGACTCTACTACCAATTCAATCCAAAACA TAGGTCAAACATCGCGCGGGTATGCGGGGCAAAAATTCTAGATCAGCGGT TGGTTTAGCCTGGACTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGACTTGTTAATTTATTGC GCGCACAGGCCCCGACAAAGACAAAATCTTTTCGATCAGTTGCTTTTTAA AGGTCCATTCTGCTGCACGCTGGACCAATTACATATTGTACAAGTCGCTG TATCTGTTGAGCGATCGTCGCACATCGAATTCTGTAATTCCAAAGGACTC TTTTGATGAGGACTTTTGTTCCTTGAGCTCAAACTTTGACCCTAACTGAT GATAACCCGTGACCTTTAAACGATCCGCCAATGAGAAACAAATAAGATAA CTTTTTGTGATCCCATATAGTAGAAGAGTTTTATGGCTTTTATTAACACT GTAATAATTTCCATAATGCACCCCTGTCTCACAGCCCCGGTGGAACTTTT TTCCTTAGTGAAGATAAAGATTCCAATTGAAATGCTGGGGTCCCAGGGTC TGTGATACAGGGTTGGCATAATATAATAAAGACACTCTCGCGTTACTTTC TTATTAACTCATTTACATCTTCTTAAATGTTATGCTTAAGTCTGTTTATT GAAGATAATTTATATAGCTACTACAGAGCCTTTACATAGTTATTTCTTAA TCTTTTCAGACTTGGCAGTAATCAAATTTCCAGCAGATGCTTTTCTCAGG CCAAGTATTTACTTCAAACTAGAGACAAATGAGACGGTTCAGGAATTAAA AGACTTGTTCATGCCTGGGGAGACAGCAACACCTCGTGGCCTCTTCAAGG TATTCTTAAAGTTTTGGATTCAGCTAGACTAGAGTCCAACCTCGTGTTCA TGTATCCCAGGCTTTATTTACACTACTGATGGACGCCAGATTATTCTGGG AACGAGGTTGACAAGAGTCTACATCTGACTGAACTTTACTTTCTTATGAT TTTGATGGTCTAAGTCTAGTGAAGTAGACTAGGGAAAATTGCCATATTGG AATGTCGGAATGTTCATTTATATAAAAAACTCAGGTAAGTTATGCTATGT CTCAAAAACATGAAAAAATTAGCATAATTTTTGGAAAGCATTCCACCGGG AAAAATGAGCAAACCAATGATTTAATACGAAACAATTAGGTAACACTCTT ACAGGGAAACTTCATCATGGTGAGAACCCAAAAATAATCAGATAATTTAT TCTATTCATTTTCTTTATAGAGTATCGATGTTTTTAAAAATATACGGTTA TCGGCACAAGCTACAAAATCTATGGATCAATATTGGAAAAATGATACATC AGAGAAAGCAATCAGTATCATCGCAAGGTAAACTCTCTTAATTTCCCATT GGAATTGGAAGTATTTATACCTTGTCCACAAGAATTTCTACATGCCTTAT TAGCACACCCCCTTCTCACAGACCCACTGGGACCCCTTTCGACTGGAAAA ACTTGCCAAAATATCTTCCCCAGTGGAAAATTATACTCCATTTGTGTCCC CACTGAAGGTAATAAAATAAACCAATCCCCACTGTAAATTATCACGCTAT TTTTACCCAACCCAACTGAATTTTCTGACTTTAAAACAATGGAATTTGAA TTCCAAGCATTGAAAACGTGGGGATATCAATCTTCATCGAGATTAAGTCT GTTAATTTTACCCCCACTGGCTGAAAAAATCCTACCGGGTCTGTGAGAAG GGGGTGTATTAGCGGACTACCTACCTTATAATTTACCTTATTCACGTATT GCGTTCTGGACGAGATGTCACTTAATCTAAGTTAGTTAAGTTTGTTACCC CTCGTAATTGATTACAAACAAAAGGAACAATCTTTGGATCAAACCAACCT CGCTCCCTGCGTATTATCAGCTTTTTAGGGCTTACTGATAGCACCAGATA ACACCCTGACATTGACTGAAAACAAACTGTTTATTTTGTAGGTACATTGG TATGGAGAATGGTTTCTTCCGTATTTACCCTGGCTTACTGATGAATCCTT CATACGACCCAAGAGCTCGACCATGGTAATCTCTCCCGGCATACCCATTT ACATTTACGAGATTGCTAAATCCTTTGAAAGGCCTTGTTGTATGTTGGGT CGCACTGATGCTATACTTTAATCTTTTGATCCTGCCCGGATAAAAAAATC AATGACATTTCTTTTAATCTTTAGAATTTTGAAGCTATGTTGGAATGACA TTTAAAAGGATAAATGCTCTCATAAAAATATTTGATATTATTCTTATCTT CCAAGGTACCGCCTCATGATTGCTCAAAAAGGGATGACATTAACCACGCC CTACTTGGATGCCTTTACTGGTGAAACTGTTATGACTCTTGGACAAGTCC TACACATGTAGGTATAGTTAGTCGGATAGTATTATATGTGACTAATATTA TATAATAATTATGGGTTCTATAGAAGCCACCAGACCTGCAGTCAATTAGA AATATTTATTTAGTCAAGCTAAATTTCAAAAACAATGATTTAAAAGAAAG GCTTTAAGACCAATATAGAATCGGGTGGTCTTGCAACATTGAGTCAACAC ATAATCTCTTTTCCAATTATCAGGGGCAAGACTTCGACAGAGAAAGCAGG GAATATAGCGATGGATTTCAAACTACCCTACTTTAAAGTGTTACTGGATA AGTCAATCAATGAATGCGAAACTGATGGGTAGGTTGTTCTCTAATTTTCC TATATCCAAACATACATTATTTCACAAGTTTTCTATGCAGTTAAAATTAA ATTTTGACTATTCCAGAAAAAGGTTCCCATGTTAAAGGACATTGGCTGCC CTTAAAACACAAGCAAGAAAACTTATTTAAGGAGAGTCACTGTATTCTCA GGGCGTTTATGACAAAAATCTAGGAATGTCTCCAAATTTTGAAAGGAAAT CCAAAACGGATAACTTTTCTTAGACCAGCCAACCATTAGAGCTTATCAGA TTTGAGAACTACGTTTTTACTACAGAGCATGTGTTGTGATTGATCGAAAT GGCTTCGTGGTTTACCAATCGAGTTTTATGGAAAAGAATGAAAATTCAAC CCTCGAAAATCAACACATCATTAAGATGGTAGGTCATAGAAAGATTTCTT GTTCAACCTAACAATACTTTTTTTGGCTCTCGCCTAAATTCTCACTCCAA ATATTTTCGATTTTTAAACGACGGTTGGCTTTTACCTGTCAGAGATAGAG ACCAGGTTGAGAAATTTTAAAACCTAAGACACCCCTGTGTCACAGACCCG GTGGGACGTCCGTCCTATTGGAAGATTTGTCTGACATCTCTCCCAGGTGG GAAGATTACCCTAAAATTTCAGCCGACTGCAGAATCGACTTTGATTTCAT CCCCATTTGAAATTAAAAAAAATCAAAAAATTGTATTTCATTTTTTTGAA ATGGGAGCAAGAGAATTTCTATCCCCATTAGGATTTCGAAAAAATATCAT CCCCAGTGTGGAAAGAAGTTCCACCGGAACTGTGAGGCAGGGGTGTCCTA AGGTGTCGGTGATGATGTCACTAATTTCGCCGTTTTTTGATTTTTAGCAT AGTCGAGTTGCAAAGAGCATGATCGAAGAGGGAGTTATGATAAAAAATTA TTGTTTGGAATTCCGAAACAATATAACCATCAAGGAATGGTTTTACTCTG TAAGTAATGAGTATTTTACTGTTTGATAAAAATTCTAAAAATTTATCGAG GTTCCACTGCATTATGCATTATTTGAAATTAAACTAATCTTAATGGCAAT AGGCCTTTTCATAAATTACGTCACGAACATCACTTGCCTCGTATTCAAAC AATTACCATGGTGATTATGTCCCCTGAGACATTAAATCGTTTTTTTATGA ATAGGAAGTAGTTTTAAGAAGATCCGTTGGGATTTAATCACCATGGCAAT AATTTCAAAACGAGGCAAGTGATGTTCGTGACGTAATTTATGAAAAGGTC TATTTGACTTGTTTCGCTCTCAGGGTTTGCTCCATTTCAAGCCATTAAAG GCCTTCGTCAAGTTTATTAGGAAATTTTAATTTTTATTGACAGGTTTTTA TTAACACTAAACTTTATTAGTGATAAAAACATGTTCAACCTCGTCCCCTA GCCTGTACCAAACTCTTCTTCGCTGACTGAAAGGATAACTGGAAATTCGA CACACGATAAGTTTTTTCAAAATATCAAAAAACGCCTATAGGAGGGATGG TACAGGCTACCTCTCCCCTTGCCTAATCTTTTTTTTTTTTTCAGCTTGAT CACGTGACCGAAGCGAAGAAATATGAATCGAATCGAAATTGTTTGGATTA TCGAGTTGTTCCGATTGTTGATTCCAATCTTTTATTATTGTATATTAATG ACGCTTGCACTTTACCAGAAAATTGTAACTGTGAAGAACCAATCAACAAC GTAAAGAAAATTCTCAAACTTGCACGTTTTTTTTGAGAAACTAGTTTTAT ACCAATCAGCCTCAATGTTTTTTAAGAAATCGGCCTTTTGAGCCTTAAAT GTTTCTTACATGTTTCTAAACTTTTTGACATGATCAGCCTCGTGGAAGGC TGGATTGGAAGGTTCTTAAAAAAAAACGAATTAAAAATTTTTATTTTCTC ATTCTCAGCCTCAGCATATTTCTGAGATGTTTCTTAGTTTTTAGGCATTC TGAGCCTCGTGTTTCTTAAAAGTGTGTTTCTTAAAAAAAAAAAAGTGTAT TTCAAAATAAAGTGGAGGCTTTTCAACTATATAACTCGAATGTTTCTTTA ACTCGAACAAAATTTGTGTTCCCCGTGCATGCTCGAGTTATGGAGACTCC ACTGTATATTCCAAAAGTTTTGACCTTCAAAACATATCATTACGTATGGT TAAAAATGCAAAAAGCGCACCTGAGAAACTAATTTCGTTGGTTTCGTTGT ACGGAATACAGGTGGTCGAAATCATTTAAAAGCGAATTCTACTATTTTCA ATTTTTCAGGAAAGATTTGGGTATTGTTCGAACGATATCAGCGAAACAAA TTGTGAATGTCCTTGCATACAACCCGTTACTTGTCTCAGTGATCTTCGAA TTACGTAAGTCTTTAAAGTTTTGGAGAAAGTTTTTGCCAAGCTTCGTTAG ATTTCTTGGATGGTTTCTTTGTATCAAAAATACATCTTCATTGTACCTCC TAGAATTTTTTACTATTTTTCATAGCCCAGGCAGACTTGAATGCAACCCA GAGGACAAACGAAAAACAGATTTCTCAGAAAAATGGTTCAAAGGAAACAT TTCAGAGCTTACTCTCTGTTTTGACCCTGAATGCAAGAAACGGTGAGTGT CGACGTGTCGACCAGATTCGTGGTTGGTGTAGAAAAAGTACTGAGAAGTA GGAAGAATCATCCTAATTCTATCTTTTTTTTTTTATTCTTAATTTTCAAT TGTCATTTTTGAATTTTTAAACAATGCTTTAAAGTTCAAGTCAATTCACT AATGAAATCTGACGTTTTGTTTTTGTATTGCGTAATTTTACGTAGAAATC AGACATTACATGTCAGGGTATTATCTGGCGCTCTGGAGCATCGAAAAGCT GATAACATGCAAGGAATACGAGGTTGCCCCTGGTGTTCAAGGTGGTCTGG ATAATAAATCTTATAATAGAGTAAAGTCTCAGTAAAATGAGGTTGAAAAT CTAGGATGATCAGTAAATTGAGGTCAAAAATCTAGGGTGGTCCAAAAAAT GAGGGGTTCTGAACAATTGAAATAAAACCCAGGGGGGGGGTAAACTTTCC AAAAAAAAGACCTCCTCAAAAAGGGTACAATTTTCTTTCTAGAATAGCCC TATTCTCTTTATAATGAGGTATAACATTTGATAATATGTTTTCATATAAA GAACAAGTTTCAATTTTTTTGATACTGATCTTGAGCATTATTTTACTAAC ACTTTCACCTACCTCATAAACTTAGGAATAGCTTAAGAATCACACAAACA TAAAAGCAAGGGCTACAACGAGTGGAAGCTTTTAACCAGAATAAGAACAT TTTTTTATGCTTTGACATTTCTCAAACAAAACCTGTGGTAGTGAAAGACC AATACAAAAAACGTTAGAGAATATAAAACAAGTTTGGCCCCCTACTATTT ACAGTTGAAGAGAAAGAAAGTCAGGGGAAAGTAAACAAAACTTATATTCC CGACAGTCAAGATTTTTAACGCTGTATGCTATAATTACTTCTTGCTGATC AATGGTACATCCCCTTCTCACAGACCCGGTAGAATCTTTCAGCCAGTGGG GTGAAAATAACGGACCAAAACGTGATGGAGATTGATATTTCCATGTTTTG AAAGGCTGGGGATTTGACGAAATCAATTGTTTTTGAACCATAAAATTCAG CGGAGATTGAAAAAAATAGCACAGCTTTTTGTAGTGAGAATCGGATTATA TGGTGACAAAAAATGATTTATAATTTTTCAATGGAGCCGATATTTTGGTC AATTTTTCCAGTGGGAAGGATTCACAGNTCTTAGTGGTGACAAAAATTGA TTTATAATTTTTCAATGGAGCCGATATTTTGGTCAATTTTTCCAGTGGGA AGGGTTCACAGTGTTTCGTGTGATTTTTCTGTTTACCCTTAAAAATGATA ATCATGCATTACAGGGTAGTCATTCAAGACTACATTTTGTTGATATACCA TTTACTTTTCAGCGACACATGGGATAATTGTGAAAGTTTCAAACCTGCTT GCAACTGGTGTTTCAAATTCCCAAATGGAACCCATGTTGCCGACGAGAAA AAGCATTGTGATTATTCTGACGAAGAATGTTTTCCGACGCCATCACCACC CATCATAACGCCTGCACCACCCACAACACCTGACTCGCAAGAAACTGAGG ACCTATCAGATGGTGCTATTGCTGTGATTATACTATTTAGTATAATATTT GTATGCTCCATACTGGGTGGTATCTACTGGTGGTTCAATAAAAAAGCTAA ACGAAGACAACGTAATAACAATAACAACGGGAATAATTCTAACACAACAC TTACTCCTCGAGCCAACAGTGGTTTTGATGATGACCAATATCAACCAGGA TATCAACCATCAGGCCACGCACCAAACGATCGACTAGGATCAGTACCATC ACCGACTGATACCAAAGATGCTGCAGTAGAGATAACAATGCCAGCAGTGT ACGAGGAGAGACCTGCAGATGAAAATGGTTCAGTTAGTACCACGGCTTAA ACCATCGCATAGTATGTAAAAATTAATTTTTCTGAGTACTATTCAATAAA CAAAGACTTAAAAGATTTCATTACATTAAAAGGACATTTCACATCAGACA CATATTTCATATCAGGACAGTGTCTCCCTATTGTTTTCTTATACTGATTT AAGCAAAAAGATGTTTTTCTTTTCCTTTTTTCTGACCAATCTTGCTCCAT ATCCGTGTCAATCCGATGTGATAAAGCTTGTGAGTTGAAGTTGATGAGTA AGCAAACGATATCACTCTTATTTGAAAACAAAAGACTTTTTGAAATCTGA ATAAGTTTACTACGAGTATTATTAGCAAAACGTTTTGCAGTTAGAAGTGT CCAAAAATATAATTTTATGGTGTTGCAAAACCGTAATCTGGAAACATTTT GGGATCCCTCTCCCTCCCTAGGCCCACTTAATGCAAGTCAAAGTGACTCA TAAAAAAGAGCTTTTTTGAAGAACAAATTAGTGGGTTGCTTTGAAGGATC TTATATTACACGAAGCTGACATTTTGTACTTTCAAGATCCTGCAGATTCT AATTTATTTTTTCTCGACACATTGTAAATATCTAGCTATTTTATTGTATA CACACCTTTCATTGTATATTTGGGATAGAATTTTTCAAAGTC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000321XLOC_000321Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000523-exon-sc0000002-1575043694:343544..343583TCONS_00000523-exon-sc0000002-1575043694:343544..343583Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1575043694:302908..302947TCONS_00000523-exon-sc0000002-1575043694:302908..302947Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1575043694:302495..302596TCONS_00000523-exon-sc0000002-1575043694:302495..302596Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1575043694:302125..302226TCONS_00000523-exon-sc0000002-1575043694:302125..302226Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1575043694:301516..301618TCONS_00000523-exon-sc0000002-1575043694:301516..301618Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1575043694:300102..300203TCONS_00000523-exon-sc0000002-1575043694:300102..300203Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1575043694:299489..299641TCONS_00000523-exon-sc0000002-1575043694:299489..299641Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1575043694:271380..271474TCONS_00000523-exon-sc0000002-1575043694:271380..271474Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1575043694:271142..271258TCONS_00000523-exon-sc0000002-1575043694:271142..271258Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1575043694:268592..269771TCONS_00000523-exon-sc0000002-1575043694:268592..269771Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1510915933:343544..343583TCONS_00000523-exon-sc0000002-1510915933:343544..343583Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1510915933:302908..302947TCONS_00000523-exon-sc0000002-1510915933:302908..302947Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1510915933:302495..302596TCONS_00000523-exon-sc0000002-1510915933:302495..302596Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1510915933:302125..302226TCONS_00000523-exon-sc0000002-1510915933:302125..302226Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1510915933:301516..301618TCONS_00000523-exon-sc0000002-1510915933:301516..301618Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1510915933:300102..300203TCONS_00000523-exon-sc0000002-1510915933:300102..300203Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1510915933:299489..299641TCONS_00000523-exon-sc0000002-1510915933:299489..299641Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1510915933:271380..271474TCONS_00000523-exon-sc0000002-1510915933:271380..271474Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1510915933:271142..271258TCONS_00000523-exon-sc0000002-1510915933:271142..271258Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1510915933:268592..269771TCONS_00000523-exon-sc0000002-1510915933:268592..269771Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1491911889:343544..343583TCONS_00000523-exon-sc0000002-1491911889:343544..343583Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1491911889:302908..302947TCONS_00000523-exon-sc0000002-1491911889:302908..302947Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1491911889:302495..302596TCONS_00000523-exon-sc0000002-1491911889:302495..302596Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1491911889:302125..302226TCONS_00000523-exon-sc0000002-1491911889:302125..302226Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1491911889:301516..301618TCONS_00000523-exon-sc0000002-1491911889:301516..301618Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1491911889:300102..300203TCONS_00000523-exon-sc0000002-1491911889:300102..300203Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1491911889:299489..299641TCONS_00000523-exon-sc0000002-1491911889:299489..299641Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1491911889:271380..271474TCONS_00000523-exon-sc0000002-1491911889:271380..271474Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1491911889:271142..271258TCONS_00000523-exon-sc0000002-1491911889:271142..271258Clytia hemisphaericaexon
TCONS_00000523-exon-sc0000002-1491911889:268592..269771TCONS_00000523-exon-sc0000002-1491911889:268592..269771Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:268592..343583 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 2.23487e-08 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
Blast
BLAST of TCONS_00000523 vs. Swiss-Prot (Human)
Match: CAHD1 (VWFA and cache domain-containing protein 1 OS=Homo sapiens GN=CACHD1 PE=2 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 7.746e-17
Identity = 86/344 (25.00%), Postives = 144/344 (41.86%), Query Frame = 1
Query:    1 VGMENGFFRAYPGHLMNPSYDPRARPWYRLMIAQKG-ITLTTPYPDAFTGEIVMTXXXXXXXXXXXXXXAGNIA---MDFKPLYFKELLERSIKECASGA-----CVVIDRNGFVVYQSSFMEENENSTLENQHIVKMHGRLAKTMIENGVMI-KNYCLEFRNNVTVKEWF---YSLDHVIEAKSYSKGCLKDYHVVPIIDSNLLLLYINDRCDVKEKCTCREPINGERFGYCSNDISETNCECPCIQPV---TCLSDLRITPGRLECNP--EDKRKTDFSEKWFKGNISELTLCFDPECKKRDTWDNCESFKPACNWCFKFPNG-THVADEKKHCDYSDEECF 975
            +   NG  R YPG LM+ ++DP  R WY   +A  G I+LT PY D      V+T+   +      +     +A   +DF   YF ++L   +  C         C +++  G++V   + ++   ++ +E QHI      +A  ++ +   + KN C  F +  TV+ ++    SL   +    +   C K Y +  I  +N  +  +N+ CD    C C      +R     + + +  CECPC  P+    C  +L     R   NP  E  ++         G    L  C +  C +R    +C      C WC    +G TH+  +K +C    +ECF
Sbjct:  733 IATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVANPGLISLTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDLLPVCNQDGGNKIRCFIMEDRGYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHPNFVKKNLCNSFSDR-TVQRFYKFNTSLAGDLTNLVHGSHCSK-YRLARIPGTNAFVGIVNETCDSLAFCACSMV---DRLCLNCHRMEQNECECPCECPLEVNECTGNLTNAENR---NPSCEVHQEPVTYTAIDPGLQDALHQCVNSRCSQRLESGDCFGVLD-CEWCMVDSDGKTHL--DKPYC-APQKECF 1064          
The following BLAST results are available for this feature:
BLAST of TCONS_00000523 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CAHD17.746e-1725.00VWFA and cache domain-containing protein 1 OS=Homo... [more]
back to top