Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000507 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000507
Unique NameTCONS_00000507
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2894

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000507 ID=TCONS_00000507|Name=TCONS_00000507|organism=Clytia hemisphaerica|type=transcript|length=2894bp
AGAAAGCTTTGACATACTATTATCAAAAATCGCACGTTTTGTAACCAAAT
GGGATATTCCTTTTTGTGTTGTTGGAAACAAAATTgatttggaatctaaa
agagaAGTGAGTGAAGAAGAAGGAAACTCTGTCGAAGGatctttattttt
tcttGAAACTTCTTGTAAAATTGGACATAACATTGATGCTTTGTTTGATA
AGATAATCGAATATTGTCACAACAATGGTGATGTAGCAAAAAATGTTGAT
ACTGTAGTCTCACATGTTGCAGCGAAGAAAGAACTTATTCAATTGTTCCT
TGATGGTCAGCTCAAAAGCATTTGCCTGTCATCACTGCCTTCAGAATTAA
AGAATATAAGTGCCCAAGATGCTTTGCGCAATTGCACTAAATCTGGATAT
GTTCAGACGAAATGGTTATGGATTTCATTGAATcgatttttggttttgaa
aggAGATTATCTTTATTGGTTTCGTAGAAACACTAGCAGAGATCCTGTAG
CTTTTTTGGATTTAAGAAATTGTGTATCATTATCAGGGGAAGAAGAAAGA
AACAGCTTTTCTATCGTTTATTCAAAAACTGCTGGTAATTCTCTGGACAC
AAATTGTATAACTTTTCAGTGTGTCAACACTGCAGATGAGGAAGATAGTA
TTTCATGGAAACTAGATTTACTCAACCAGCTTGCTAAGAGTACGGAAAAT
GTACCCATTCGAAAAGCTTGTTTTGGTGCTTTGACTAAAATGAAACTCGG
AAGGACAGAGAGAGCAATCATCAAAATCAGACAAAATGATGAAAGTTTGT
ATCGCTTATCCTTTAAAAGTCAAAACAAGCTTGACATGAGAATTGGCTTC
ACTTCATTGggattttcttttgaagaacACAATTTTAAGTTTTCCACGGA
TGCTTCAAGGAGTGAATACGTATTTTTCATCAAGGATTTAGCCGTAGTTT
GTTTCAAACCAAGAGATACAGAGTCGTACAATTCTGCTGGTTCtcaatta
aagaaaatatttggcgTTCAGTCATTTGGTGGAAGAATTACAGAGAAATC
GTGCTTGGAAATATTTGATTTGGCATACCGTTGTGCATGTTTTGAAATGT
CTATCAGTGGCATCGAATCACTAAAAGATTCTCTCATTCACCATTGGACA
AAATGtgaGACATTTAAAGAAATCAACTTACGTGGATATCAAATGATCAA
TCAAGATATTTTTGCGATCAGTCATGCTTTATCACATTATCATTTTATTT
CAACAATTTGTCTTCGGAATTGTGGAATTGATAGCAAGGGGCtcagtatt
tttctgaaaagtttAACCGATTACAACGCTTTGAAATGCTTGGATATTGG
AATGAACAAACATATCGATTCCAACGAAACTGGCAAATGTTTTGAAGAAT
TCTTGAAAACATgcaaattggaaacattaaagcTTATGAGTTGTGACATA
GGAAGTGTTACTTTTTCCACATTTTTACCCGTtataaagGAGCACGAAAC
TCTTGAAGAAATTGATTTGAGTTTCAATGATGTTGACGATTCTCTTTGTG
AACCGATTTCTGAAATCATTTCCAAAAACAACAGACTTGCAAAACTTGTT
TTGTGGCACAGTTGTTTGACTGAAGAGCCTGCAACTAAATTGTATGGAGC
TTTAGAAAAGAGGTCGAAAATATTTCCAAAGCTCGAGATATCTCTCCACC
ACTCTCAATTTATTTCAAACGACACAATTACGTTGTTCGACACCTTTTTG
GAGAAggtagaaaaagaagaagaagaagaagaagtagAAGTTGGTGATGT
TTGTGAAACTATTAAAATCAAAAGTAACAAGTCTGAAAATGAAACCAATT
CATCTGCTAAAGATATGAACGATTTTTTAGATGTTGATAATATCAAGTTA
GAAGTCGGCGAAGAAAACACATTTACACTGAAAGAGATGTTGGTTGACGT
CATGCTTACTCagcaaattattttaaaaagacaAGTCTTGCAATATCAAA
AACAAATGGAGCATTTTCAGCTATCCATCAATATGGTACAGATTCGCACG
CCAAGAACGTTCTGTATTTTACCATCTCCTGAAGATAAATCATGGAAAAA
GACTTCTTCATGGGGCAAAGAAACATTTCGTTTACATTTGTTATGTGAAG
GTTCAGAAGGCGGTTCTGTTGGTGATATTCATTTCCTCCAAGACCATAAA
GGATATCTTATCGAACAACCGACGGAATTTCTGAAGAAAGTGTTACCAGT
GTTGACGATTGGAATGAAAGTATTATCCACAGCTGCTAAGATTGCTGGAA
CGGCTATTGGGGCTGGTGGTTTGGTTCCCAGTGGCGATGTCTTGAAAACG
TTAGGAATCGTTTCGCAAAAGTCCGGTGATATTGCAGCTCTTCTGCAAAA
GGTCCAAGAGAGTATCAAAGAATGTAATCATCACGATGTTGAGAATCCAG
AAATCCAAGTCTCAACAGGGGCTGCTTTACGTTCtttggaagttttttta
aatgaaaatgatGAATTACGTCATTTTGGTGGATTACAATCGGTTGCCGG
TCCTGATGGTCGTTGGGCTTGGGTTTGTGATCAACATGCCAAATTTTAAA
TCCAGTGAGCCACGGTTTTGGGATCGATTAATGAAAAATGATGGTAAAGA
GTTCATAAGACGATCTATTgaattttataatttgatgaaaCTTTTGCAAA
TGTTGTGAGTATTTTTATACATGTATTATTTTATACACATTCTTCATTCG
TACATGTTTGGTATATAGGCTATATGGCAAATACCATATCAACGGGTCTG
TTACAACCCTTTTATGTCAGACGAACATTTTGATACTTTGAAACCGGATA
AAAACGCTCAAATAACGTTCATATACTTTAaaggcagaaacttt
Run BLAST on NCBI

protein sequence of TCONS_00000507-protein

>TCONS_00000507-protein ID=TCONS_00000507-protein|Name=TCONS_00000507-protein|organism=Clytia hemisphaerica|type=polypeptide|length=865bp
ESFDILLSKIARFVTKWDIPFCVVGNKIDLESKREVSEEEGNSVEGSLFF
LETSCKIGHNIDALFDKIIEYCHNNGDVAKNVDTVVSHVAAKKELIQLFL
DGQLKSICLSSLPSELKNISAQDALRNCTKSGYVQTKWLWISLNRFLVLK
GDYLYWFRRNTSRDPVAFLDLRNCVSLSGEEERNSFSIVYSKTAGNSLDT
NCITFQCVNTADEEDSISWKLDLLNQLAKSTENVPIRKACFGALTKMKLG
RTERAIIKIRQNDESLYRLSFKSQNKLDMRIGFTSLGFSFEEHNFKFSTD
ASRSEYVFFIKDLAVVCFKPRDTESYNSAGSQLKKIFGVQSFGGRITEKS
CLEIFDLAYRCACFEMSISGIESLKDSLIHHWTKCETFKEINLRGYQMIN
QDIFAISHALSHYHFISTICLRNCGIDSKGLSIFLKSLTDYNALKCLDIG
MNKHIDSNETGKCFEEFLKTCKLETLKLMSCDIGSVTFSTFLPVIKEHET
LEEIDLSFNDVDDSLCEPISEIISKNNRLAKLVLWHSCLTEEPATKLYGA
LEKRSKIFPKLEISLHHSQFISNDTITLFDTFLEKVEKEEEEEEVEVGDV
CETIKIKSNKSENETNSSAKDMNDFLDVDNIKLEVGEENTFTLKEMLVDV
MLTQQIILKRQVLQYQKQMEHFQLSINMVQIRTPRTFCILPSPEDKSWKK
TSSWGKETFRLHLLCEGSEGGSVGDIHFLQDHKGYLIEQPTEFLKKVLPV
LTIGMKVLSTAAKIAGTAIGAGGLVPSGDVLKTLGIVSQKSGDIAALLQK
VQESIKECNHHDVENPEIQVSTGAALRSLEVFLNENDELRHFGGLQSVAG
PDGRWAWVCDQHAKF
Run BLAST on NCBI

transcript from alignment at sc0000002:1772836..1792371+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000507 ID=TCONS_00000507|Name=TCONS_00000507|organism=Clytia hemisphaerica|type=transcript|length=19536bp|location=Sequence derived from alignment at sc0000002:1772836..1792371+ (Clytia hemisphaerica)
AGAAAGCTTTGACATACTATTATCAAAAATCGCACGTTTTGTAACCAAAT GGGATATTCCTTTTTGTGTTGTTGGAAACAAAATTgatttggaatctaaa agagaAGTGAGTGAAGAAGAAGGAAACTCTGTCGAAGGatctttattttt gtaagtCATTCTTTATGAAAGTGTTTAAACAATAATCTTTAGCGTTTACA TTTGCTAAGAAAATAGGCCAttctcttttgtgcttaattgtagggagGGG TCAAGtggcaatttttgaaaaattcaaacccCTTTATCACTTTATTAAGA CCccaaattttatggattttctcctGGAGTACCATTAGTTTAACATAAGT TAACATAAGTCGGAATGAAGGcatagaccagcgtccgaggatcagaaaag gccttaaaaatggttttcgtagggcaccccttagatcaggtcaaattttt gatattatgctcctaatagggtgtagaattgacaaaataatttgcccttc gaatctcctgcagttttcgagtgaatcgatttttaccttaagtggataaa ttttggcgtggatttaatttggcgattggccaaaatacgatttttggcgg ggatttaatttggcgatagatcaatttcttaaaatttggcgaggatttaa tttggcgaagtggaaattttgtcacactgaaatgggtgaaaattactcaa aaatatactaaaatattgtgatttttcacataattctctttttgttaaat ttggcggggattaaatttggcgaattgccgaatttggaaattttggcgag gatttaatttggcgaattttggccaaattcgcgaaatttaatccccgcca aaatttatccacttaaggtagttaatcgatagaacttatcaagggtcccc ccctTTACttacggttttttcgaagtctgaaaatcaaatatctgacaCTA CCAAcagattcagcgtgaaaagtagataaagaaaatggggttatttgtta agtttcgaccagctggtgccgagaaatggtatttttaaggcaaaaaatcg acgttttgggcgtttcccgatgacgtcagcatttttctgggagcattttc agaaaaaatcattcccacagctggaaagccctgaattagtagtatccgaa aatggtatggtttgttaactttcgatgttcCGAACTTGAGATATTTCCTT TTTTAAAGGTGGGTAAAtgtgctgaaaaactgctgactcagcaaaaaaaa atcgataattttcaatatttaaaccaaaatccAAATAACCCCAATTTTTT ATCtgcttttcacgctgaatccgttggtagtgtcagatatttgattttca gacttcgaaaaaaccgtaagtaaaggggggggggacccttgataagttct atcgattaactaaaaatcgattcactcgaaaactgcaggagattcgaagg gcaaattttttttgtcaattctacaccctattaggtgcataatatcaaaa atctgccctgatctaaggggttccctacgaagtgacacaattcactacct cggaCGCTGGTCTAGCATGGAGACCCTGCTacacattatttttttataag caactacaTTTTTCACTTCAGGACTAAGTTTGCTTAGCCTTTCAAgctaa tttttggaaaattgtcaaTTCCACAAACCTTTAAAATGCATTCCAGGGCG AGTGGAACCATTTCCATTTGttagaatttgaaaatatattttcttagaGA TAGCCAAAATATTTGACCCATTTTCAGGCCTCAGCCCTTAGAAACCAggt tgcttatataaaaaaaaatatgtacttctttttttacaattCCGATGAAA AAGTAGCATGGTTGCAGTATCTGTTTGAATCAGATGACAGTTGAAAAAAG AACCAATCAAACTTCTAAAACTTAATGTTTACATTTCCTTGTTCGTATTT ACTAAAACAAAACTTCGACATTTTGTCTAAGCCGTGAAATATAGTAAAAA AATCCAGCGACGAGTCAATTTTAGTGGAAGATTCCATTTTGAAATTGTCG CTGCAACCCAGCCACTATTAAAAAAAGAGGCTGGTGTGTACTAGCTACAA TGAAGGGTACTGTGTTTGCAAATTTATTATGATagtgattttcttaaaaa aagttcaaaatctaGTGATTGAAGtttgattcatttttttttttttagtc ttGAAACTTCTTGTAAAATTGGACATAACATTGATGCTTTGTTTGATAAG ATAATCGAATATTGTCACAACAATGGTGATGTAGCAAAAAATGTTGATAC TGTAGTCTCACATGTTGCAGCGAAGAAAGAACTTATTCAATTGTTCCTTG ATGGTCAGCTCAAAAGCATTTGCCTGTCATCACTGCCTTCAGAATTAAAG AATATAAGTGCCCAAGATGCTTTGCGCAATTGCACTAAATCTGGATATGT TCAGACGAAATGGTTATGGATTTCATTGAATcgatttttggttttgaaag gAGATTATCTTTATTGGTTTCGTAGAAACACTAGCAGAGATCCTGTAGCT TTTTTGGATTTAAGAAATTGTGTATCATTATCAGGGGAAGAAGAAAGAAA CAGCTTTTCTATCGTTTATTCAAAAACTGCTGGTAATTCTCTGGACACAA ATTGTATAACTTTTCAGTGTGTCAACACTGCAGATGAGGAAGATAGTATT TCATGGAAACTAGATTTACTCAACCAGCTTGCTAAGGTAATTCGTTTTTG TTCGCTGGTAGTTTTTAGACCTTTCCGTTGATTGAACTGTTTCCGTTGTT TATGATAGGATATTGTAAGTGGCAAGCAATGGAATTATCAGAGGCCGGTT ATGCTTCTCTATATCGCCACCTGTTCAAGAATTGAACTGTCAGGATCCTT GTCATTTTTTGCAGAGCGTAACGGAGTCTGGTCTCCCCTCACAGTGGTTT GCATTATTGCtagatgttaaaaaaaaaacttgtattatTAATTTCTTTTA GAGTACGGAAAATGTACCCATTCGAAAAGCTTGTTTTGGTGCTTTGACTA AAATGAAACTCGGAAGGACAGAGAGAGCAATCATCAAAATCAGACAAAAT GATGAAAGTTTGTATCGCTTATCCTTTAAAAGTCAAAACAAGCTTGACAT GAGAATTGGCTTCACTTCATTGggattttcttttgaagaacACAATTTTA AGGTGAGAAGGCAATAATATTTATCTCGATCTCAAAGCTATGGGgtttca aaatcggacccttacattGCAGTGCAAGACAGATCCtgatataatatttt ttggacctaccccggtggggtggaggtcctataaattatcgttcgttcgt tcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttc gttcgttcgttcgttcgttcgttcgttcgNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNacttatcaaaaatcacaaaa aatttatacacttttcattttttattaagcttagacttataattatattc aagctcaagctggacaaaaaatcaaaaaagttttaaaaccaAAGATGCTG TAaatcagtaaaagttaaaatGGTGTCATTCTTATTCATCTTAACTCGAG AGAAATAGTTTAGCTTAAAactacatattttttataataaaagcaatgaa aaattcaaaataaggttTACACCGACACCCAAAATactatttaaaattta ttcaaatttaaagttttatgtttaGCATATCCGGTGTCGTCCCAGAAAGA CTGTAATTATTGTACTGTATTTTCCCTAATCTGAGCCTAAATATGCTTAA AAGTGCAATATTTatctatcaaaaaatatttaatccatttatatacattt attatttatcattattagTCCAGAATGTATAACTTAAGTTTTCACTGCGA TTTGAAAGCAGACACTTGCATTTGTTCTTTTTGACTTGGCGGATCCATCA AATCAGAGTGAAAAaatgcaagtctagaaaaacataatttttgtcaataa tttgatgaagaatacttcagcctttctgaaatttacataggagctgcaCT TTAAATATATATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNtttccatttacgcttgatcataattatctccaagtc aaaaagaacaaatgcaagtgtctgctttcaaatcgcagtgaaaacttaag tctagaaaaaatcatttttccgtcaataatttgatgaagaacttcgttct ttctcaaattcacataggagcggtactttaatatacttgatcaaattcca tttacgctttatcataattatctccaagtcggtccaaaaaaacaaatgta tataactgccagtgaaaaacgcaagtctagaaaaaaatcatttttgcgtc aataatttgatgaagaacttcgttctttctcaaatttaNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNactttaatatacttgatcaatttccatttacgctt tatcataattatctccaagtcggtccaaaaaaacaaacgtaactgccagt gaaaaacgcaagtctagaaaagaATCATTCttgcgtcaataatttgatga agaacttcggtttttctcaaatttacataggagctgtactttaatatact tgatcaatttccatttacgctttatcataattatctccaagtcggtccaa aaaaacaaacgtaaactgccagtgaaaaacgcacacaagtctagaaaaaa ataatttttgcgtcaataatttgatgaagaacttcgttctttctcaaatt cacataggagcggtactttaatatacttgatcaatttccatttacgcttt atcaatattatctcTAAGTCCAGAAGAACAAGCATATAAAATGTACCTGG TATAAAATGTctatcaaatcaaaagaaaacaccaagttcgagaaaacatt atttttgtgaataatcaGATAATTAAGCTGTGAACTGTAACATATATACA CTCCATCAAATTCCAGTAATTGTTGGTGGTTATTCTATATtcaagtccaa aatgaaaaaatatgttttcatgctacaaaaTAATGAGGTCTAGCaggtaa aaaaataactcacaattcaggaaaaaacttgagcaaataagttaaaatct tcatactttaaagaaaaaagaacatccttatAATCGAACTCCAGTGTTGT ATCTTCCTtagttataagtttaaaagccaCTTCAACAAGATATAATGATT GTATAAATAAAAGCTGGCAATGGGAATAAAAACACCGAACGAACGAAAAA GCACCGCcttggcagccatattgaattgtttttgacaCATATCGGGAAAC CAAACTTAGCCCGATTGGATGAATTGAAAGCGTATCCCAACCGGAACGCT GCCCTAAAAAAGCTGGAGAGCAAATACACAGATCGGGAAACCAAACTTAG CCCGATTGGATGAATTGAAAGCGTATCCCAACCGGAACGCTGCCCTAAAA AAGCTGGAGAGCAAATACACAGATCGGGAAACCAAACTTAACCCGATcgg ataaaaactttagaaatctgggaaacacatttttttttctgaccctgCTT CTTCTGCGGAATAATAGCGAAATGAATGCTCAGCTGGGGCTGAccaaaaa atacagaaaaaatacAAATGCTATGTATACAATGTATGAGGACAAAAACT TAAGAATATTAGTCAAATAAGTTAAACTTTggtcaaactttttttattaa aattccaAGATCAGTATCCTATTATTTCAAGCAACTTTTAGCTCTTGAAA CAAACActcaaaacatcaaagaaatcaGTAATCGTCACTTGCCAAATAAC TCGATTTCAGGATCATAAGTCAATCAGCTTTCttcaaaaatcgtgaaaat cgaTAATAATATGGTCAAACTATCAAAAGTAAATATGAATCTTATCACGA AATTAACCCAAGGGctctgaccttgacggccgacggggaagtaccactgg agtttgaaaagttgatCCTATCAGATGTGAACTTTTGGCAAAATTGGAAC CTTGtcagaacaaaaaattaaaagatctcccattttcaccctggaatggc aaatattaataaaagtagccgaaaaacttttaaattttcttatttccacc ctgaaaattgtccaaaataatcaaaataatcgACCCTATCAGAAactcat cttgaaaattagaaaattttgcacCCTGTTAGATATCTTCAGAGTATAAA AAAGAGACCCTGCCCAGCAGAACGTCCCCATACCCAATTTTgactaagtg cccccccccctccgggaAATTAACAAAACATTGGCTATAAAACAGCAGTT TATAGTAAAATCACTTTATATACATTTGATCTCTAGTTTCGAGAGAAAAG GTTATACCTTGTAAAGCAAATGGACTAGGAAtagttgaaaaaatttaatt gaattcTGTGATAAATACCTTTCTCGTTTTGTCTGTCAGATCATGTAGTG TAGGCTATCTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNAGTGCTTGATAAAGTCATTTAACCt gtataaaaataaacaaaactgaTGTATATTGCTCCATCATTCATTCACAa acaaagataatcattttaatCATATCTCGGAATAGtcaaaaattgagaag aaagcgttgccaaaaacatttcattgctaaaaaaaaaacttgaaatgccT ACATATATAGCAAATTATCCAGCTTAAAgttgttttaaaaaaagtagCAA ACAAATAAGCAGATAATTCCCTTACCTTACCCTTGATCTACTTGACGAAA AATGGTTTCGTGGAGTTTATGTTATGATACAGCATCACGACCTGTAGTGT AGAAAGACAAAAGagtcaaacattttgacaaCAAATGAACAGCAAAGGAA AACAacatttacaaaaaagtaaaaaaaagtagaaaatataCCCTGATCTG GGTGAATCACATGACAAATCGCAAAGGcaaattaaagaaacaaaaagata caaaaaaatccttaaaaatgaGTATTGTCTGATTGACCCTTAGTTTAGGA TAGATAGAAATAGCACTAACTAGACTCATTTGTTGATATAAATGGCTGAG GTAATACTTACACATCATGATTTTGTGGTTGTTTCTCCTTCCATTTTTCT TACACCAGACTCCAGATCAGCTTATCACTTCCACCACTCCAACTTTAACA CTCAAAGAAACCACAAAATTGAAAActggttttgaatgttttgatttcgt gAAGCGAATCTGGCATCTGGTCAGGGGGTTACATTATTAAATTTTGCTTA AGATACTCTCAaaagatcatctttcaaataGATGGAAATCCTTgaattat catattttttcaatatatttcagATATTTACACGTTCGAAAGGTAGACTT TCAAAGTCcgcttgaaattcattgaaagaggccccccagcggtttgcgtg atggcgtgattgggacttttttcttgcgtgatggcgtgattagagacttt tttttgcgtgatggcgtgatcaaaattttggcgtgatgcgtgatagggct aaaatttgaggcgtgatgcgtgatttgggctatttttcgctattttttgc gtgatgacaaattttagcgattttcgtgatgcgtgatggagaaaattttt ttgcgtgatggcgtgattaggggtgccgctgggggggcctcttgaaatac tatatttacaatttgggaaatctatgatttcgcccagtggtcctcatgat tggctcactagttttttctgattttttgcacaaagatgtgtaactatcga atgtgacggagcccgatttcgaaaaaaaaatctttgtgaaaaattggatc attaactttttctgattttttgcatgaaagtagggtcaccatcataggta aaagatggctcaagcagatttttgcaaaaaaaactttgttggctcaaaaa acacatgtttatctataagaatcactattaataagcatacatcaatgttc ttagttaaattactcaatttcttatgagatagatgttttttttgctcaca aagtcttgaatatgaaagaatatttcaagagcatgaaattttggtttcta aacatttttttttatacgaaacaaacgactaatttaaatagatcgtcact atttgtgttctgaatgattgtttaatggtcacgctcacgtagatatcaat tataaatatgttaaatgcataaccaggtaggtccataaaagtatcacttg tttattttAGTTTTCCACGGATGCTTCAAGGAGTGAATACGTATTTTTCA TCAAGGATTTAGCCGTAGTTTGTTTCAAACCAAGAGATACAGAGTCGTAC AAGTATAACCctggatatattttttttatgatatcATTTTTTATTGCCCT ATTCTATAGGAACAAAATCAGCTGAGAATAATAAAGAATATGCAATGAGT GAATCTGTTCAATTGGGCTATAATCCAAGTGTAAAATCTTCTTTCAACTT ACTTGAAACCAACCAAATTTTCATCGTTTAGTTCTGCTGGTTCtcaatta aagaaaatatttggcgTTCAGTCATTTGGTGGAAGAATTACAGAGAAATC GTGCTTGGAAATATTTGATTTGGCATACCGTTGTGCATGTTTTGAAATGT CTATCAGTGGCATCGAATCACTAAAAGATTCTCTCATTCACCATTGGACA AAATGGTAAGATAATAAATATTTAGAAAACACTTTGTATCTTTTAGAGTT CGAACTCaagtaccagtggataccccttaaaacccacaataaaaagtggt accctctatctcattgtttagttggagtgtaaggctgaaactttttgtgt cgAAAGTACGTTGTCTATGATTGTCTTCCCTAgcagtgatgttttgtaga aaacagttttcagtttttcacgagGAAGTGAAAAAGTGCAGTTTTAGCTA TTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNTTAGCAtctttaaaatccttaaaatttggtattttatgaaagaa catttataagaggttgtaaaaaagtgaaacataccacataaaattaaatc tggtagttaaaaagccaaaaatgcaacattgtgggttttaaggggtatgt ggttttaaggggtatccactggtatctTACTGATAAAAGTTTTATcgttg atttttcaatttttagtgaGACATTTAAAGAAATCAACTTACGTGGATAT CAAATGATCAATCAAGATATTTTTGCGATCAGTCATGCTTTATCACATTA TCATTTTATTTCAACAATTTGTCTTCGGAATTGTGGAATTGATAGCAAGG GTGAGAGGGtgctttttaatctttttttatatCTGAAAATGTCCTGGCAG TGTATCAAAAGTATactaaaaatgtatttttgaaattcatttcaatATCA AATTCATCAATTCAATTCCAAGGGGGTCTTAGGTAAAAGTCCTGTTATAT TGTTAACTGGAATAATTTTCAATTAGATtatattttcatcttttaaTCAG GGCtcagtatttttctgaaaagtttAACCGATTACAACGCTTTGAAATGC TTGGATATTGGAATGAACAAACATATCGATTCCAACGAAACTGGCAAATG TTTTGAAGAATTCTTGAAAACATgcaaattggaaacattaaagcTTATGA GTTGTGACATAGGAAGTGTTACTTTTTCCACATTTTTACCCGTtataaag gtaagtactaatcgCTTACAATACCAGAAAGAACACTTAAGATTAAAGTT AACAGTAAAGCACTTTCCCTGATATCGAATTTAAGAATTTTCCTTATAAT CCGGAGGAGTATTTTGGCAAAAATGGTTGCTGGGGTATGCGCGGTGGCCC CTAAGGTTCAGcattttaacctttcaaagtctctctaaggggcGCAAATA ACAGAACGTTGTCAAaagagtctctctaagggtctcGAGGTTTTAAGATT TGGCCAAAGTGtctcattttaaagtttttatgggaaaatctttcaaattt gagACAAGGTTTTCTGGTCAGTTTGAGGGGTctggcacatacccgtcatc ccTCAACTCTATTATCCCCCTGGGCTCATAGGATGCCAATTAACAGTGAT TTGGTATTATAGTCGTTTTATATTCATTTATCATTTAAGGAGCACGAAAC TCTTGAAGAAATTGATTTGAGTTTCAATGATGTTGACGATTCTCTTTGTG AACCGATTTCTGAAATCATTTCCAAAAACAACAGACTTGCAAAACTTGTT TTGTGGCACAGTTGTTTGACTGAAGAGCCTGCAACTAAATTGTATGGAGC TTTAGAAAAGAGGTCGAAAATATTTCCAAAGCTCGAGATATCTCTCCACC ACTCTCAATTTATTTCAAACGACACAATTACGTTGTTCGACACCTTTTTG GTAAGTCCATTCATTTTCAATTATTCATGTAAAAGTACAGTAATTACCTA TTCAAAAATCCAAATTGGAACGAAATTAAAACATAGAAAGTCTTTGAATA TGTTGATAAGAAATAAATCTATGAAAGGAATTTCAATCCTGTGCTTGTCT TTACTGTTCCAAACAATACTTCGAAAGATATtgccaaaaaaacattaaaa agtaCATTCATACAGTTAATTGATGTGTGTTCTCTTTATTGGAAGATTAT TTATTACTGCTCTGTAAATTCGGCAAATCGAAGAGGTGttattattttaa cttttttccgTAGGAGAAggtagaaaaagaagaagaagaagaagaagtag AAGTTGGTGATGTTTGTGAAACTATTAAAATCAAAAGTAACAAGTCTGAA AATGAAACCAATTCATCTGCTAAAGATATGAACGATTTTTTAGATGTTGA TAATATCAAGTTAGAAGGTATAGTCATTTGTCCAACCTTTTGAACcactc ttttcttttctttcgttTTGAGCTCTTTTCTAGATACTTCAATTTATTCA GTCTTACTCtagggctgagttaggtccccgtatgcgcatcgctcggcgta tagtcattttttcttttgatcatgaaagtatagtccctgaagagtcagaa aacgtgtgtggcgttatttggatcaggctcaaatttccataatggcggat tttagattttcaaccctttttagccctcttgcttgaaaNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNa gttcaatatggctgaaaaggtaccctttcagtgcactTTCTCGTGATTTA CCCAACctttatagtgcactatatttctcggCTGTAAATtgcgtgaaaga agaagcttgggaaattttctgtttcaaagaaaaactgagaaaattattaa tAAATATGTAACTTAGAAGCTTCAttttgtaataatattttattttattt aaatattaaataaaataaaatattattacaaaaTGAAGCTTCTAAGTTAC ATATTTATTATTAAGCTGATTGCCCAAACAAATTTATTTAATTAcataaa gaaaattattcttgtcagctgtaattatcagacaatagaaacgtTTTCAA ACAAaggagaagtaaaaacctttctttttaacaattattttgaattaaaa tgttttaaaatatatactttcatgatcaaaagaaaaaatgactatacgcc gatgcgcatacgggatctaactcagcccctagagtatcaCCACCGTAAAA ATTCTCAATGACAAAATTGAATTAGTTCTTTGATTGAAATGGCACTATCA GTCTTTCAttttaatctatatattaatagccgtagtctgtttgtttgttt tctgttttgttttctgtctgtgtgtcactttcgatttcgcaagcaatgtt ttgttctcgataagtttgttttgattgacagatcggatatagctagtcta cacaatagacagatccaggcttttaggccttactcttggtctataggcac tgctataggcggccactagtgacccccaccgggaattgcttgtTAATAGG ATTAAAAATAGtagaaaattttcacaaaagatgtttatcaatagagattt caaataaaaaaatgtttaaaacacagctgattggcttaggtttcgaaact ctctattgtttcattaaaacagTGCGcatgcgcatgcgatttatctggag aatttcaatattcaaaacaagagcagtgctcatagcatagtaggagtttt acgctcgaaacgaaggaagatatgacgtagcctaggatatagcctggttt agactttattcagcctttgttttgaaatttaaggcccatctacatttagt aattttaatttctgcccagctttGCGTGACCCtggtttttctcttttctt ttgtttgaaatgttttcgaatgtatttaacgatcgtatttattaatgaca ttcgaaacattttcaaaacaaaacaagttttttatagaaaagaacatttc aaatgtaaatcaaaacataaaaattaaaaagtttgtcgaacaataacagc attcaaaggagagtctgctaaatgacgcgccttacgcgcccacgcgccct catatttctaacgcgccttcgcgccttacgcgccttacgcgcccacgcgc cNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNcgcgtgggcgcgtaaggcgcgtaaggcgcgaaggcgcgttaaaaat atgagggcgcgtgggcgcgtaaggcgcgtcatttagcagactcattcAAA GGACGATaaaaaagcaagagaagaaattaattcatctctttcttcatata aaaacattcaagtggtgatactgttaaaaactgtgtacgtcattttaagt tgcactattctttgtggctttcccgctttttcttgaaaaattctcACTTC TACATTTTACTCCTCTTTACCAtaatattttctcaaattttctcaaactG AAGGCGAGCGAAGAGAGACAAAGATCTCCGGgggagggttagagtcaaac tttgaaaatatctttttattcatttgatcgtttttttaagccagcttcaa catccaaaggacttttagtgcgttcagctacagcttaaccggcgtgcgac acCGGATACCGGCTAGTTATTTATGATAGCAGAAATGTTTGTGCTTGTTG TTCGTGGTcattgtctttgtttttcatCCAAAAGCATCAGGGCTGAGTTC GAGTGAACGTCCATCGCCTGGGTCGACCGCCATACTGTGCAAGGGAAAGT ATGTTGTAATATCTCTGATACAATAGTATATTCATGGGTACCTTTCATCA TGCACCATGGTATCTGTGTGAAGTGTGCACAGAGACAGCAATGTGTTATG ATTCATAAtcgaaattaattaatttttactTTGGAAAAAGTAGGACCCAC TTCCTGCACTTCCTTGATGGAGGGAAAAAACTGCAAGTTTACACACACTA ATTGGCTCAATTCCACTTTATAGTGACTGTATCTAAAACATACATTGAGT ACTTTACCAAAAAGATAGAATCCAATGTTTTTATCTTACCCATAGTCGGC GAAGAAAACACATTTACACTGAAAGAGATGTTGGTTGACGTCATGCTTAC TCagcaaattattttaaaaagacaAGTCTTGCAATATCAAAAACAAATGG AGCATTTTCAGCTATCCATCAATATGGTACAGGTATGTGATGAAACTTTG CCCAGTATAACATATTTGAATGTAAACAACATTTAATCATTATGCTTTTT ACCGATCAAATTTCACAGGCCATATTGACCAAAGTAAAAAGTCCCTCCct tttcaaatgaatttttGGTAATCTTCCATCAAAATTGCCCAGGTATAAAA CATAACCCTATCCGTGCCGAgggtttttttaaaaatgttttctatTTGCC AGGGGTaatatttttagtatttttatttgccattgtcggatatatccgat tGGTAAtacagaaaaacttttttcgggaataatattttgataatattttg cgGTAATAGAGTTGACATTTTTTAAACCCCTCGGCAAAGAAACATTAAAT TTtcatgtcggatatatccgacatcggCAAATAAATCGAAAATTTAAATG TCGAATATATCCGACAACGGCACAAAAAGGgttaaaatttgcaattttac GATTTGGACTGACTATGACTAGGCTTGGTTGGAGAAGTAtgactttgaat aaaaattACTAATCACGTGAATAGTATTACGAACTAGTGTGTTATATGCG TACTGTATAATATGTTTGTTTTTTAGATTCGCACGCCAAGAACGTTCTGT ATTTTACCATCTCCTGAAGATAAATCATGGAAAAAGACTTCTTCATGGGG CAAAGAAACATTTCGTTTACATTTGTTATGTGAAGGTTCAGAAGGCGGTT CTGTTGGTGATATTCATTTCCTCCAAGACCATAAAGGATATCTTGTAACt tactcttttcttttgttttaacaGTAAAACTTAACTAACTATACTGCAGT GACTTTTTATTCAGAAATAATGCTTTTCTAAGCCACCAAAAGCGTTTTAG CCTCGTATAGCTAGGTTCTGCTCCACTGCAAAGACTCTAAACCCTCATCT ACTTCATTAGTAGAGACATTGTGAGTTCCACTACTAAATAGAAATCTACA CTTTTCTAAGACCTTTCTGTGTCACCCTTCAGATCGAACAACCGACGGAA TTTCTGAAGAAAGTGTTACCAGTGTTGACGATTGGAATGAAAGTATTATC CACAGCTGCTAAGATTGCTGGAACGGCTATTGGGGCTGGTGGTTTGGTTC CCAGTGGCGATGTCTTGAAAACGTTAGGAATCGTTTCGCAAAAGTCCGGT GATATTGCAGCTCTTCTGCAAAAGGTAAAAGAATTGTTATTACATACCGG GTGATCCACAAAAGCATTTCTCCTTGAgatgaattttttcgaaaatattg ggaatttttacaaaaatcttttaggctaacttaaattttgatgtgtcATA AATAAAATTCTGATCaatattcaaaaaacttttcttgtgaaaaatcgcca aaaaacgtcaaaaacgaGGTCATGTTTTCGAAAATTGTCCCGCTGTGCGG GTTTAGGACAGGCTAAgaaaaaaccagtaagtcactATATTCGTTGGCCC TGAGCTGTCTCTTTGTCACCAAAGTATACAGCAGAGTCATTTACTCACGA ATTGCTTCACTCgcacaaaaaatagcaaaacaaatattttactGAGGGTC TTAAAGTATTTTTGGCCTTGCTGAGATGTGCAGTGCAAGCAAGTATCAGG CTATAAGATATGTATTACTTTTGATGTACTTTCTGGTGTATAGGTCCAAG AGAGTATCAAAGAATGTAATCATCACGATGTTGAGAATCCAGAAATCCAA GTCTCAACAGGGGCTGCTTTACGTTCtttggaagtttttttaaatgaaaa tgatGAATTACGTCATTTTGGTGGATTACAATCGGTTGCCGGTCCTGATG GTCGTTGGGCTTGGGTTTGTGATCAACATGCCAAATTTTAAATCCAGTGA GCCACGGTTTTGGGATCGATTAATGAAAAATGATGGTAAAGAGTTCATAA GACGATCTATTgaattttataatttgatgaaaCTTTTGCAAATGTTGTGA GTATTTTTATACATGTATTATTTTATACACATTCTTCATTCGTACATGTT TGGTATATAGGCTATATGGCAAATACCATATCAACGGGTCTGTTACAACC CTTTTATGTCAGACGAACATTTTGATACTTTGAAACCGGATAAAAACGCT CAAATAACGTTCATATACTTTAaaggcagaaacttt

Coding sequence (CDS) from alignment at sc0000002:1772836..1792371+

>TCONS_00000507 ID=TCONS_00000507|Name=TCONS_00000507|organism=Clytia hemisphaerica|type=CDS|length=33774bp|location=Sequence derived from alignment at sc0000002:1772836..1792371+ (Clytia hemisphaerica)
GAAAGCTTTGACATACTATTATCAAAAATCGCACGTTTTGTAACCAAATG
GGATATTCCTTTTTGTGTTGTTGGAAACAAAATTgatttggaatctaaaa
gagaAGTGAGTGAAGAAGAAGGAAACTCTGTCGAAGGatctttatttttt
cttGAAACTTCTTGTAAAATTGGACATAACATTGATGCTTTGTTTGATAA
GATAATCGAATATTGTCACAACAATGGTGATGTAGCAAAAAATGTTGATA
CTGTAGTCTCACATGTTGCAGCGAAGAAAGAACTTATTCAATTGTTCCTT
GATGGTCAGCTCAAAAGCATTTGCCTGTCATCACTGCCTTCAGAATTAAA
GAATATAAGTGCCCAAGATGCTTTGCGCAATTGCACTAAATCTGGATATG
TTCAGACGAAATGGTTATGGATTTCATTGAATcgatttttggttttgaaa
ggAGATTATCTTTATTGGTTTCGTAGAAACACTAGCAGAGATCCTGTAGC
TTTTTTGGATTTAAGAAATTGTGTATCATTATCAGGGGAAGAAGAAAGAA
ACAGCTTTTCTATCGTTTATTCAAAAACTGCTGGTAATTCTCTGGACACA
AATTGTATAACTTTTCAGTGTGTCAACACTGCAGATGAGGAAGATAGTAT
TTCATGGAAACTAGATTTACTCAACCAGCTTGCTAAGAGTACGGAAAATG
TACCCATTCGAAAAGCTTGTTTTGGTGCTTTGACTAAAATGAAACTCGGA
AGGACAGAGAGAGCAATCATCAAAATCAGACAAAATGATGAAAGTTTGTA
TCGCTTATCCTTTAAAAGTCAAAACAAGCTTGACATGAGAATTGGCTTCA
CTTCATTGggattttcttttgaagaacACAATTTTAAGTTTTCCACGGAT
GCTTCAAGGAGTGAATACGTATTTTTCATCAAGGATTTAGCCGTAGTTTG
TTTCAAACCAAGAGATACAGAGTCGTACAATTCTGCTGGTTCtcaattaa
agaaaatatttggcgTTCAGTCATTTGGTGGAAGAATTACAGAGAAATCG
TGCTTGGAAATATTTGATTTGGCATACCGTTGTGCATGTTTTGAAATGTC
TATCAGTGGCATCGAATCACTAAAAGATTCTCTCATTCACCATTGGACAA
AATGtgaGACATTTAAAGAAATCAACTTACGTGGATATCAAATGATCAAT
CAAGATATTTTTGCGATCAGTCATGCTTTATCACATTATCATTTTATTTC
AACAATTTGTCTTCGGAATTGTGGAATTGATAGCAAGGGGCtcagtattt
ttctgaaaagtttAACCGATTACAACGCTTTGAAATGCTTGGATATTGGA
ATGAACAAACATATCGATTCCAACGAAACTGGCAAATGTTTTGAAGAATT
CTTGAAAACATgcaaattggaaacattaaagcTTATGAGTTGTGACATAG
GAAGTGTTACTTTTTCCACATTTTTACCCGTtataaagGAGCACGAAACT
CTTGAAGAAATTGATTTGAGTTTCAATGATGTTGACGATTCTCTTTGTGA
ACCGATTTCTGAAATCATTTCCAAAAACAACAGACTTGCAAAACTTGTTT
TGTGGCACAGTTGTTTGACTGAAGAGCCTGCAACTAAATTGTATGGAGCT
TTAGAAAAGAGGTCGAAAATATTTCCAAAGCTCGAGATATCTCTCCACCA
CTCTCAATTTATTTCAAACGACACAATTACGTTGTTCGACACCTTTTTGG
AGAAggtagaaaaagaagaagaagaagaagaagtagAAGTTGGTGATGTT
TGTGAAACTATTAAAATCAAAAGTAACAAGTCTGAAAATGAAACCAATTC
ATCTGCTAAAGATATGAACGATTTTTTAGATGTTGATAATATCAAGTTAG
AAGTCGGCGAAGAAAACACATTTACACTGAAAGAGATGTTGGTTGACGTC
ATGCTTACTCagcaaattattttaaaaagacaAGTCTTGCAATATCAAAA
ACAAATGGAGCATTTTCAGCTATCCATCAATATGGTACAGATTCGCACGC
CAAGAACGTTCTGTATTTTACCATCTCCTGAAGATAAATCATGGAAAAAG
ACTTCTTCATGGGGCAAAGAAACATTTCGTTTACATTTGTTATGTGAAGG
TTCAGAAGGCGGTTCTGTTGGTGATATTCATTTCCTCCAAGACCATAAAG
GATATCTTATCGAACAACCGACGGAATTTCTGAAGAAAGTGTTACCAGTG
TTGACGATTGGAATGAAAGTATTATCCACAGCTGCTAAGATTGCTGGAAC
GGCTATTGGGGCTGGTGGTTTGGTTCCCAGTGGCGATGTCTTGAAAACGT
TAGGAATCGTTTCGCAAAAGTCCGGTGATATTGCAGCTCTTCTGCAAAAG
GTCCAAGAGAGTATCAAAGAATGTAATCATCACGATGTTGAGAATCCAGA
AATCCAAGTCTCAACAGGGGCTGCTTTACGTTCtttggaagtttttttaa
atgaaaatgatGAATTACGTCATTTTGGTGGATTACAATCGGTTGCCGGT
CCTGATGGTCGTTGGGCTTGGGTTTGTGATCAACATGCCAAATTTTAAGA
AAGCTTTGACATACTATTATCAAAAATCGCACGTTTTGTAACCAAATGGG
ATATTCCTTTTTGTGTTGTTGGAAACAAAATTgatttggaatctaaaaga
gaAGTGAGTGAAGAAGAAGGAAACTCTGTCGAAGGatctttattttttct
tGAAACTTCTTGTAAAATTGGACATAACATTGATGCTTTGTTTGATAAGA
TAATCGAATATTGTCACAACAATGGTGATGTAGCAAAAAATGTTGATACT
GTAGTCTCACATGTTGCAGCGAAGAAAGAACTTATTCAATTGTTCCTTGA
TGGTCAGCTCAAAAGCATTTGCCTGTCATCACTGCCTTCAGAATTAAAGA
ATATAAGTGCCCAAGATGCTTTGCGCAATTGCACTAAATCTGGATATGTT
CAGACGAAATGGTTATGGATTTCATTGAATcgatttttggttttgaaagg
AGATTATCTTTATTGGTTTCGTAGAAACACTAGCAGAGATCCTGTAGCTT
TTTTGGATTTAAGAAATTGTGTATCATTATCAGGGGAAGAAGAAAGAAAC
AGCTTTTCTATCGTTTATTCAAAAACTGCTGGTAATTCTCTGGACACAAA
TTGTATAACTTTTCAGTGTGTCAACACTGCAGATGAGGAAGATAGTATTT
CATGGAAACTAGATTTACTCAACCAGCTTGCTAAGAGTACGGAAAATGTA
CCCATTCGAAAAGCTTGTTTTGGTGCTTTGACTAAAATGAAACTCGGAAG
GACAGAGAGAGCAATCATCAAAATCAGACAAAATGATGAAAGTTTGTATC
GCTTATCCTTTAAAAGTCAAAACAAGCTTGACATGAGAATTGGCTTCACT
TCATTGggattttcttttgaagaacACAATTTTAAGTTTTCCACGGATGC
TTCAAGGAGTGAATACGTATTTTTCATCAAGGATTTAGCCGTAGTTTGTT
TCAAACCAAGAGATACAGAGTCGTACAATTCTGCTGGTTCtcaattaaag
aaaatatttggcgTTCAGTCATTTGGTGGAAGAATTACAGAGAAATCGTG
CTTGGAAATATTTGATTTGGCATACCGTTGTGCATGTTTTGAAATGTCTA
TCAGTGGCATCGAATCACTAAAAGATTCTCTCATTCACCATTGGACAAAA
TGtgaGACATTTAAAGAAATCAACTTACGTGGATATCAAATGATCAATCA
AGATATTTTTGCGATCAGTCATGCTTTATCACATTATCATTTTATTTCAA
CAATTTGTCTTCGGAATTGTGGAATTGATAGCAAGGGGCtcagtattttt
ctgaaaagtttAACCGATTACAACGCTTTGAAATGCTTGGATATTGGAAT
GAACAAACATATCGATTCCAACGAAACTGGCAAATGTTTTGAAGAATTCT
TGAAAACATgcaaattggaaacattaaagcTTATGAGTTGTGACATAGGA
AGTGTTACTTTTTCCACATTTTTACCCGTtataaagGAGCACGAAACTCT
TGAAGAAATTGATTTGAGTTTCAATGATGTTGACGATTCTCTTTGTGAAC
CGATTTCTGAAATCATTTCCAAAAACAACAGACTTGCAAAACTTGTTTTG
TGGCACAGTTGTTTGACTGAAGAGCCTGCAACTAAATTGTATGGAGCTTT
AGAAAAGAGGTCGAAAATATTTCCAAAGCTCGAGATATCTCTCCACCACT
CTCAATTTATTTCAAACGACACAATTACGTTGTTCGACACCTTTTTGGAG
AAggtagaaaaagaagaagaagaagaagaagtagAAGTTGGTGATGTTTG
TGAAACTATTAAAATCAAAAGTAACAAGTCTGAAAATGAAACCAATTCAT
CTGCTAAAGATATGAACGATTTTTTAGATGTTGATAATATCAAGTTAGAA
GTCGGCGAAGAAAACACATTTACACTGAAAGAGATGTTGGTTGACGTCAT
GCTTACTCagcaaattattttaaaaagacaAGTCTTGCAATATCAAAAAC
AAATGGAGCATTTTCAGCTATCCATCAATATGGTACAGATTCGCACGCCA
AGAACGTTCTGTATTTTACCATCTCCTGAAGATAAATCATGGAAAAAGAC
TTCTTCATGGGGCAAAGAAACATTTCGTTTACATTTGTTATGTGAAGGTT
CAGAAGGCGGTTCTGTTGGTGATATTCATTTCCTCCAAGACCATAAAGGA
TATCTTATCGAACAACCGACGGAATTTCTGAAGAAAGTGTTACCAGTGTT
GACGATTGGAATGAAAGTATTATCCACAGCTGCTAAGATTGCTGGAACGG
CTATTGGGGCTGGTGGTTTGGTTCCCAGTGGCGATGTCTTGAAAACGTTA
GGAATCGTTTCGCAAAAGTCCGGTGATATTGCAGCTCTTCTGCAAAAGGT
CCAAGAGAGTATCAAAGAATGTAATCATCACGATGTTGAGAATCCAGAAA
TCCAAGTCTCAACAGGGGCTGCTTTACGTTCtttggaagtttttttaaat
gaaaatgatGAATTACGTCATTTTGGTGGATTACAATCGGTTGCCGGTCC
TGATGGTCGTTGGGCTTGGGTTTGTGATCAACATGCCAAATTTTAAGAAA
GCTTTGACATACTATTATCAAAAATCGCACGTTTTGTAACCAAATGGGAT
ATTCCTTTTTGTGTTGTTGGAAACAAAATTgatttggaatctaaaagaga
AGTGAGTGAAGAAGAAGGAAACTCTGTCGAAGGatctttattttttcttG
AAACTTCTTGTAAAATTGGACATAACATTGATGCTTTGTTTGATAAGATA
ATCGAATATTGTCACAACAATGGTGATGTAGCAAAAAATGTTGATACTGT
AGTCTCACATGTTGCAGCGAAGAAAGAACTTATTCAATTGTTCCTTGATG
GTCAGCTCAAAAGCATTTGCCTGTCATCACTGCCTTCAGAATTAAAGAAT
ATAAGTGCCCAAGATGCTTTGCGCAATTGCACTAAATCTGGATATGTTCA
GACGAAATGGTTATGGATTTCATTGAATcgatttttggttttgaaaggAG
ATTATCTTTATTGGTTTCGTAGAAACACTAGCAGAGATCCTGTAGCTTTT
TTGGATTTAAGAAATTGTGTATCATTATCAGGGGAAGAAGAAAGAAACAG
CTTTTCTATCGTTTATTCAAAAACTGCTGGTAATTCTCTGGACACAAATT
GTATAACTTTTCAGTGTGTCAACACTGCAGATGAGGAAGATAGTATTTCA
TGGAAACTAGATTTACTCAACCAGCTTGCTAAGAGTACGGAAAATGTACC
CATTCGAAAAGCTTGTTTTGGTGCTTTGACTAAAATGAAACTCGGAAGGA
CAGAGAGAGCAATCATCAAAATCAGACAAAATGATGAAAGTTTGTATCGC
TTATCCTTTAAAAGTCAAAACAAGCTTGACATGAGAATTGGCTTCACTTC
ATTGggattttcttttgaagaacACAATTTTAAGTTTTCCACGGATGCTT
CAAGGAGTGAATACGTATTTTTCATCAAGGATTTAGCCGTAGTTTGTTTC
AAACCAAGAGATACAGAGTCGTACAATTCTGCTGGTTCtcaattaaagaa
aatatttggcgTTCAGTCATTTGGTGGAAGAATTACAGAGAAATCGTGCT
TGGAAATATTTGATTTGGCATACCGTTGTGCATGTTTTGAAATGTCTATC
AGTGGCATCGAATCACTAAAAGATTCTCTCATTCACCATTGGACAAAATG
tgaGACATTTAAAGAAATCAACTTACGTGGATATCAAATGATCAATCAAG
ATATTTTTGCGATCAGTCATGCTTTATCACATTATCATTTTATTTCAACA
ATTTGTCTTCGGAATTGTGGAATTGATAGCAAGGGGCtcagtatttttct
gaaaagtttAACCGATTACAACGCTTTGAAATGCTTGGATATTGGAATGA
ACAAACATATCGATTCCAACGAAACTGGCAAATGTTTTGAAGAATTCTTG
AAAACATgcaaattggaaacattaaagcTTATGAGTTGTGACATAGGAAG
TGTTACTTTTTCCACATTTTTACCCGTtataaagGAGCACGAAACTCTTG
AAGAAATTGATTTGAGTTTCAATGATGTTGACGATTCTCTTTGTGAACCG
ATTTCTGAAATCATTTCCAAAAACAACAGACTTGCAAAACTTGTTTTGTG
GCACAGTTGTTTGACTGAAGAGCCTGCAACTAAATTGTATGGAGCTTTAG
AAAAGAGGTCGAAAATATTTCCAAAGCTCGAGATATCTCTCCACCACTCT
CAATTTATTTCAAACGACACAATTACGTTGTTCGACACCTTTTTGGAGAA
ggtagaaaaagaagaagaagaagaagaagtagAAGTTGGTGATGTTTGTG
AAACTATTAAAATCAAAAGTAACAAGTCTGAAAATGAAACCAATTCATCT
GCTAAAGATATGAACGATTTTTTAGATGTTGATAATATCAAGTTAGAAGT
CGGCGAAGAAAACACATTTACACTGAAAGAGATGTTGGTTGACGTCATGC
TTACTCagcaaattattttaaaaagacaAGTCTTGCAATATCAAAAACAA
ATGGAGCATTTTCAGCTATCCATCAATATGGTACAGATTCGCACGCCAAG
AACGTTCTGTATTTTACCATCTCCTGAAGATAAATCATGGAAAAAGACTT
CTTCATGGGGCAAAGAAACATTTCGTTTACATTTGTTATGTGAAGGTTCA
GAAGGCGGTTCTGTTGGTGATATTCATTTCCTCCAAGACCATAAAGGATA
TCTTATCGAACAACCGACGGAATTTCTGAAGAAAGTGTTACCAGTGTTGA
CGATTGGAATGAAAGTATTATCCACAGCTGCTAAGATTGCTGGAACGGCT
ATTGGGGCTGGTGGTTTGGTTCCCAGTGGCGATGTCTTGAAAACGTTAGG
AATCGTTTCGCAAAAGTCCGGTGATATTGCAGCTCTTCTGCAAAAGGTCC
AAGAGAGTATCAAAGAATGTAATCATCACGATGTTGAGAATCCAGAAATC
CAAGTCTCAACAGGGGCTGCTTTACGTTCtttggaagtttttttaaatga
aaatgatGAATTACGTCATTTTGGTGGATTACAATCGGTTGCCGGTCCTG
ATGGTCGTTGGGCTTGGGTTTGTGATCAACATGCCAAATTTTAAGAAAGC
TTTGACATACTATTATCAAAAATCGCACGTTTTGTAACCAAATGGGATAT
TCCTTTTTGTGTTGTTGGAAACAAAATTgatttggaatctaaaagagaAG
TGAGTGAAGAAGAAGGAAACTCTGTCGAAGGatctttattttttcttGAA
ACTTCTTGTAAAATTGGACATAACATTGATGCTTTGTTTGATAAGATAAT
CGAATATTGTCACAACAATGGTGATGTAGCAAAAAATGTTGATACTGTAG
TCTCACATGTTGCAGCGAAGAAAGAACTTATTCAATTGTTCCTTGATGGT
CAGCTCAAAAGCATTTGCCTGTCATCACTGCCTTCAGAATTAAAGAATAT
AAGTGCCCAAGATGCTTTGCGCAATTGCACTAAATCTGGATATGTTCAGA
CGAAATGGTTATGGATTTCATTGAATcgatttttggttttgaaaggAGAT
TATCTTTATTGGTTTCGTAGAAACACTAGCAGAGATCCTGTAGCTTTTTT
GGATTTAAGAAATTGTGTATCATTATCAGGGGAAGAAGAAAGAAACAGCT
TTTCTATCGTTTATTCAAAAACTGCTGGTAATTCTCTGGACACAAATTGT
ATAACTTTTCAGTGTGTCAACACTGCAGATGAGGAAGATAGTATTTCATG
GAAACTAGATTTACTCAACCAGCTTGCTAAGAGTACGGAAAATGTACCCA
TTCGAAAAGCTTGTTTTGGTGCTTTGACTAAAATGAAACTCGGAAGGACA
GAGAGAGCAATCATCAAAATCAGACAAAATGATGAAAGTTTGTATCGCTT
ATCCTTTAAAAGTCAAAACAAGCTTGACATGAGAATTGGCTTCACTTCAT
TGggattttcttttgaagaacACAATTTTAAGTTTTCCACGGATGCTTCA
AGGAGTGAATACGTATTTTTCATCAAGGATTTAGCCGTAGTTTGTTTCAA
ACCAAGAGATACAGAGTCGTACAATTCTGCTGGTTCtcaattaaagaaaa
tatttggcgTTCAGTCATTTGGTGGAAGAATTACAGAGAAATCGTGCTTG
GAAATATTTGATTTGGCATACCGTTGTGCATGTTTTGAAATGTCTATCAG
TGGCATCGAATCACTAAAAGATTCTCTCATTCACCATTGGACAAAATGtg
aGACATTTAAAGAAATCAACTTACGTGGATATCAAATGATCAATCAAGAT
ATTTTTGCGATCAGTCATGCTTTATCACATTATCATTTTATTTCAACAAT
TTGTCTTCGGAATTGTGGAATTGATAGCAAGGGGCtcagtatttttctga
aaagtttAACCGATTACAACGCTTTGAAATGCTTGGATATTGGAATGAAC
AAACATATCGATTCCAACGAAACTGGCAAATGTTTTGAAGAATTCTTGAA
AACATgcaaattggaaacattaaagcTTATGAGTTGTGACATAGGAAGTG
TTACTTTTTCCACATTTTTACCCGTtataaagGAGCACGAAACTCTTGAA
GAAATTGATTTGAGTTTCAATGATGTTGACGATTCTCTTTGTGAACCGAT
TTCTGAAATCATTTCCAAAAACAACAGACTTGCAAAACTTGTTTTGTGGC
ACAGTTGTTTGACTGAAGAGCCTGCAACTAAATTGTATGGAGCTTTAGAA
AAGAGGTCGAAAATATTTCCAAAGCTCGAGATATCTCTCCACCACTCTCA
ATTTATTTCAAACGACACAATTACGTTGTTCGACACCTTTTTGGAGAAgg
tagaaaaagaagaagaagaagaagaagtagAAGTTGGTGATGTTTGTGAA
ACTATTAAAATCAAAAGTAACAAGTCTGAAAATGAAACCAATTCATCTGC
TAAAGATATGAACGATTTTTTAGATGTTGATAATATCAAGTTAGAAGTCG
GCGAAGAAAACACATTTACACTGAAAGAGATGTTGGTTGACGTCATGCTT
ACTCagcaaattattttaaaaagacaAGTCTTGCAATATCAAAAACAAAT
GGAGCATTTTCAGCTATCCATCAATATGGTACAGATTCGCACGCCAAGAA
CGTTCTGTATTTTACCATCTCCTGAAGATAAATCATGGAAAAAGACTTCT
TCATGGGGCAAAGAAACATTTCGTTTACATTTGTTATGTGAAGGTTCAGA
AGGCGGTTCTGTTGGTGATATTCATTTCCTCCAAGACCATAAAGGATATC
TTATCGAACAACCGACGGAATTTCTGAAGAAAGTGTTACCAGTGTTGACG
ATTGGAATGAAAGTATTATCCACAGCTGCTAAGATTGCTGGAACGGCTAT
TGGGGCTGGTGGTTTGGTTCCCAGTGGCGATGTCTTGAAAACGTTAGGAA
TCGTTTCGCAAAAGTCCGGTGATATTGCAGCTCTTCTGCAAAAGGTCCAA
GAGAGTATCAAAGAATGTAATCATCACGATGTTGAGAATCCAGAAATCCA
AGTCTCAACAGGGGCTGCTTTACGTTCtttggaagtttttttaaatgaaa
atgatGAATTACGTCATTTTGGTGGATTACAATCGGTTGCCGGTCCTGAT
GGTCGTTGGGCTTGGGTTTGTGATCAACATGCCAAATTTTAAGAAAGCTT
TGACATACTATTATCAAAAATCGCACGTTTTGTAACCAAATGGGATATTC
CTTTTTGTGTTGTTGGAAACAAAATTgatttggaatctaaaagagaAGTG
AGTGAAGAAGAAGGAAACTCTGTCGAAGGatctttattttttcttGAAAC
TTCTTGTAAAATTGGACATAACATTGATGCTTTGTTTGATAAGATAATCG
AATATTGTCACAACAATGGTGATGTAGCAAAAAATGTTGATACTGTAGTC
TCACATGTTGCAGCGAAGAAAGAACTTATTCAATTGTTCCTTGATGGTCA
GCTCAAAAGCATTTGCCTGTCATCACTGCCTTCAGAATTAAAGAATATAA
GTGCCCAAGATGCTTTGCGCAATTGCACTAAATCTGGATATGTTCAGACG
AAATGGTTATGGATTTCATTGAATcgatttttggttttgaaaggAGATTA
TCTTTATTGGTTTCGTAGAAACACTAGCAGAGATCCTGTAGCTTTTTTGG
ATTTAAGAAATTGTGTATCATTATCAGGGGAAGAAGAAAGAAACAGCTTT
TCTATCGTTTATTCAAAAACTGCTGGTAATTCTCTGGACACAAATTGTAT
AACTTTTCAGTGTGTCAACACTGCAGATGAGGAAGATAGTATTTCATGGA
AACTAGATTTACTCAACCAGCTTGCTAAGAGTACGGAAAATGTACCCATT
CGAAAAGCTTGTTTTGGTGCTTTGACTAAAATGAAACTCGGAAGGACAGA
GAGAGCAATCATCAAAATCAGACAAAATGATGAAAGTTTGTATCGCTTAT
CCTTTAAAAGTCAAAACAAGCTTGACATGAGAATTGGCTTCACTTCATTG
ggattttcttttgaagaacACAATTTTAAGTTTTCCACGGATGCTTCAAG
GAGTGAATACGTATTTTTCATCAAGGATTTAGCCGTAGTTTGTTTCAAAC
CAAGAGATACAGAGTCGTACAATTCTGCTGGTTCtcaattaaagaaaata
tttggcgTTCAGTCATTTGGTGGAAGAATTACAGAGAAATCGTGCTTGGA
AATATTTGATTTGGCATACCGTTGTGCATGTTTTGAAATGTCTATCAGTG
GCATCGAATCACTAAAAGATTCTCTCATTCACCATTGGACAAAATGtgaG
ACATTTAAAGAAATCAACTTACGTGGATATCAAATGATCAATCAAGATAT
TTTTGCGATCAGTCATGCTTTATCACATTATCATTTTATTTCAACAATTT
GTCTTCGGAATTGTGGAATTGATAGCAAGGGGCtcagtatttttctgaaa
agtttAACCGATTACAACGCTTTGAAATGCTTGGATATTGGAATGAACAA
ACATATCGATTCCAACGAAACTGGCAAATGTTTTGAAGAATTCTTGAAAA
CATgcaaattggaaacattaaagcTTATGAGTTGTGACATAGGAAGTGTT
ACTTTTTCCACATTTTTACCCGTtataaagGAGCACGAAACTCTTGAAGA
AATTGATTTGAGTTTCAATGATGTTGACGATTCTCTTTGTGAACCGATTT
CTGAAATCATTTCCAAAAACAACAGACTTGCAAAACTTGTTTTGTGGCAC
AGTTGTTTGACTGAAGAGCCTGCAACTAAATTGTATGGAGCTTTAGAAAA
GAGGTCGAAAATATTTCCAAAGCTCGAGATATCTCTCCACCACTCTCAAT
TTATTTCAAACGACACAATTACGTTGTTCGACACCTTTTTGGAGAAggta
gaaaaagaagaagaagaagaagaagtagAAGTTGGTGATGTTTGTGAAAC
TATTAAAATCAAAAGTAACAAGTCTGAAAATGAAACCAATTCATCTGCTA
AAGATATGAACGATTTTTTAGATGTTGATAATATCAAGTTAGAAGTCGGC
GAAGAAAACACATTTACACTGAAAGAGATGTTGGTTGACGTCATGCTTAC
TCagcaaattattttaaaaagacaAGTCTTGCAATATCAAAAACAAATGG
AGCATTTTCAGCTATCCATCAATATGGTACAGATTCGCACGCCAAGAACG
TTCTGTATTTTACCATCTCCTGAAGATAAATCATGGAAAAAGACTTCTTC
ATGGGGCAAAGAAACATTTCGTTTACATTTGTTATGTGAAGGTTCAGAAG
GCGGTTCTGTTGGTGATATTCATTTCCTCCAAGACCATAAAGGATATCTT
ATCGAACAACCGACGGAATTTCTGAAGAAAGTGTTACCAGTGTTGACGAT
TGGAATGAAAGTATTATCCACAGCTGCTAAGATTGCTGGAACGGCTATTG
GGGCTGGTGGTTTGGTTCCCAGTGGCGATGTCTTGAAAACGTTAGGAATC
GTTTCGCAAAAGTCCGGTGATATTGCAGCTCTTCTGCAAAAGGTCCAAGA
GAGTATCAAAGAATGTAATCATCACGATGTTGAGAATCCAGAAATCCAAG
TCTCAACAGGGGCTGCTTTACGTTCtttggaagtttttttaaatgaaaat
gatGAATTACGTCATTTTGGTGGATTACAATCGGTTGCCGGTCCTGATGG
TCGTTGGGCTTGGGTTTGTGATCAACATGCCAAATTTTAAGAAAGCTTTG
ACATACTATTATCAAAAATCGCACGTTTTGTAACCAAATGGGATATTCCT
TTTTGTGTTGTTGGAAACAAAATTgatttggaatctaaaagagaAGTGAG
TGAAGAAGAAGGAAACTCTGTCGAAGGatctttattttttcttGAAACTT
CTTGTAAAATTGGACATAACATTGATGCTTTGTTTGATAAGATAATCGAA
TATTGTCACAACAATGGTGATGTAGCAAAAAATGTTGATACTGTAGTCTC
ACATGTTGCAGCGAAGAAAGAACTTATTCAATTGTTCCTTGATGGTCAGC
TCAAAAGCATTTGCCTGTCATCACTGCCTTCAGAATTAAAGAATATAAGT
GCCCAAGATGCTTTGCGCAATTGCACTAAATCTGGATATGTTCAGACGAA
ATGGTTATGGATTTCATTGAATcgatttttggttttgaaaggAGATTATC
TTTATTGGTTTCGTAGAAACACTAGCAGAGATCCTGTAGCTTTTTTGGAT
TTAAGAAATTGTGTATCATTATCAGGGGAAGAAGAAAGAAACAGCTTTTC
TATCGTTTATTCAAAAACTGCTGGTAATTCTCTGGACACAAATTGTATAA
CTTTTCAGTGTGTCAACACTGCAGATGAGGAAGATAGTATTTCATGGAAA
CTAGATTTACTCAACCAGCTTGCTAAGAGTACGGAAAATGTACCCATTCG
AAAAGCTTGTTTTGGTGCTTTGACTAAAATGAAACTCGGAAGGACAGAGA
GAGCAATCATCAAAATCAGACAAAATGATGAAAGTTTGTATCGCTTATCC
TTTAAAAGTCAAAACAAGCTTGACATGAGAATTGGCTTCACTTCATTGgg
attttcttttgaagaacACAATTTTAAGTTTTCCACGGATGCTTCAAGGA
GTGAATACGTATTTTTCATCAAGGATTTAGCCGTAGTTTGTTTCAAACCA
AGAGATACAGAGTCGTACAATTCTGCTGGTTCtcaattaaagaaaatatt
tggcgTTCAGTCATTTGGTGGAAGAATTACAGAGAAATCGTGCTTGGAAA
TATTTGATTTGGCATACCGTTGTGCATGTTTTGAAATGTCTATCAGTGGC
ATCGAATCACTAAAAGATTCTCTCATTCACCATTGGACAAAATGtgaGAC
ATTTAAAGAAATCAACTTACGTGGATATCAAATGATCAATCAAGATATTT
TTGCGATCAGTCATGCTTTATCACATTATCATTTTATTTCAACAATTTGT
CTTCGGAATTGTGGAATTGATAGCAAGGGGCtcagtatttttctgaaaag
tttAACCGATTACAACGCTTTGAAATGCTTGGATATTGGAATGAACAAAC
ATATCGATTCCAACGAAACTGGCAAATGTTTTGAAGAATTCTTGAAAACA
TgcaaattggaaacattaaagcTTATGAGTTGTGACATAGGAAGTGTTAC
TTTTTCCACATTTTTACCCGTtataaagGAGCACGAAACTCTTGAAGAAA
TTGATTTGAGTTTCAATGATGTTGACGATTCTCTTTGTGAACCGATTTCT
GAAATCATTTCCAAAAACAACAGACTTGCAAAACTTGTTTTGTGGCACAG
TTGTTTGACTGAAGAGCCTGCAACTAAATTGTATGGAGCTTTAGAAAAGA
GGTCGAAAATATTTCCAAAGCTCGAGATATCTCTCCACCACTCTCAATTT
ATTTCAAACGACACAATTACGTTGTTCGACACCTTTTTGGAGAAggtaga
aaaagaagaagaagaagaagaagtagAAGTTGGTGATGTTTGTGAAACTA
TTAAAATCAAAAGTAACAAGTCTGAAAATGAAACCAATTCATCTGCTAAA
GATATGAACGATTTTTTAGATGTTGATAATATCAAGTTAGAAGTCGGCGA
AGAAAACACATTTACACTGAAAGAGATGTTGGTTGACGTCATGCTTACTC
agcaaattattttaaaaagacaAGTCTTGCAATATCAAAAACAAATGGAG
CATTTTCAGCTATCCATCAATATGGTACAGATTCGCACGCCAAGAACGTT
CTGTATTTTACCATCTCCTGAAGATAAATCATGGAAAAAGACTTCTTCAT
GGGGCAAAGAAACATTTCGTTTACATTTGTTATGTGAAGGTTCAGAAGGC
GGTTCTGTTGGTGATATTCATTTCCTCCAAGACCATAAAGGATATCTTAT
CGAACAACCGACGGAATTTCTGAAGAAAGTGTTACCAGTGTTGACGATTG
GAATGAAAGTATTATCCACAGCTGCTAAGATTGCTGGAACGGCTATTGGG
GCTGGTGGTTTGGTTCCCAGTGGCGATGTCTTGAAAACGTTAGGAATCGT
TTCGCAAAAGTCCGGTGATATTGCAGCTCTTCTGCAAAAGGTCCAAGAGA
GTATCAAAGAATGTAATCATCACGATGTTGAGAATCCAGAAATCCAAGTC
TCAACAGGGGCTGCTTTACGTTCtttggaagtttttttaaatgaaaatga
tGAATTACGTCATTTTGGTGGATTACAATCGGTTGCCGGTCCTGATGGTC
GTTGGGCTTGGGTTTGTGATCAACATGCCAAATTTTAAGAAAGCTTTGAC
ATACTATTATCAAAAATCGCACGTTTTGTAACCAAATGGGATATTCCTTT
TTGTGTTGTTGGAAACAAAATTgatttggaatctaaaagagaAGTGAGTG
AAGAAGAAGGAAACTCTGTCGAAGGatctttattttttcttGAAACTTCT
TGTAAAATTGGACATAACATTGATGCTTTGTTTGATAAGATAATCGAATA
TTGTCACAACAATGGTGATGTAGCAAAAAATGTTGATACTGTAGTCTCAC
ATGTTGCAGCGAAGAAAGAACTTATTCAATTGTTCCTTGATGGTCAGCTC
AAAAGCATTTGCCTGTCATCACTGCCTTCAGAATTAAAGAATATAAGTGC
CCAAGATGCTTTGCGCAATTGCACTAAATCTGGATATGTTCAGACGAAAT
GGTTATGGATTTCATTGAATcgatttttggttttgaaaggAGATTATCTT
TATTGGTTTCGTAGAAACACTAGCAGAGATCCTGTAGCTTTTTTGGATTT
AAGAAATTGTGTATCATTATCAGGGGAAGAAGAAAGAAACAGCTTTTCTA
TCGTTTATTCAAAAACTGCTGGTAATTCTCTGGACACAAATTGTATAACT
TTTCAGTGTGTCAACACTGCAGATGAGGAAGATAGTATTTCATGGAAACT
AGATTTACTCAACCAGCTTGCTAAGAGTACGGAAAATGTACCCATTCGAA
AAGCTTGTTTTGGTGCTTTGACTAAAATGAAACTCGGAAGGACAGAGAGA
GCAATCATCAAAATCAGACAAAATGATGAAAGTTTGTATCGCTTATCCTT
TAAAAGTCAAAACAAGCTTGACATGAGAATTGGCTTCACTTCATTGggat
tttcttttgaagaacACAATTTTAAGTTTTCCACGGATGCTTCAAGGAGT
GAATACGTATTTTTCATCAAGGATTTAGCCGTAGTTTGTTTCAAACCAAG
AGATACAGAGTCGTACAATTCTGCTGGTTCtcaattaaagaaaatatttg
gcgTTCAGTCATTTGGTGGAAGAATTACAGAGAAATCGTGCTTGGAAATA
TTTGATTTGGCATACCGTTGTGCATGTTTTGAAATGTCTATCAGTGGCAT
CGAATCACTAAAAGATTCTCTCATTCACCATTGGACAAAATGtgaGACAT
TTAAAGAAATCAACTTACGTGGATATCAAATGATCAATCAAGATATTTTT
GCGATCAGTCATGCTTTATCACATTATCATTTTATTTCAACAATTTGTCT
TCGGAATTGTGGAATTGATAGCAAGGGGCtcagtatttttctgaaaagtt
tAACCGATTACAACGCTTTGAAATGCTTGGATATTGGAATGAACAAACAT
ATCGATTCCAACGAAACTGGCAAATGTTTTGAAGAATTCTTGAAAACATg
caaattggaaacattaaagcTTATGAGTTGTGACATAGGAAGTGTTACTT
TTTCCACATTTTTACCCGTtataaagGAGCACGAAACTCTTGAAGAAATT
GATTTGAGTTTCAATGATGTTGACGATTCTCTTTGTGAACCGATTTCTGA
AATCATTTCCAAAAACAACAGACTTGCAAAACTTGTTTTGTGGCACAGTT
GTTTGACTGAAGAGCCTGCAACTAAATTGTATGGAGCTTTAGAAAAGAGG
TCGAAAATATTTCCAAAGCTCGAGATATCTCTCCACCACTCTCAATTTAT
TTCAAACGACACAATTACGTTGTTCGACACCTTTTTGGAGAAggtagaaa
aagaagaagaagaagaagaagtagAAGTTGGTGATGTTTGTGAAACTATT
AAAATCAAAAGTAACAAGTCTGAAAATGAAACCAATTCATCTGCTAAAGA
TATGAACGATTTTTTAGATGTTGATAATATCAAGTTAGAAGTCGGCGAAG
AAAACACATTTACACTGAAAGAGATGTTGGTTGACGTCATGCTTACTCag
caaattattttaaaaagacaAGTCTTGCAATATCAAAAACAAATGGAGCA
TTTTCAGCTATCCATCAATATGGTACAGATTCGCACGCCAAGAACGTTCT
GTATTTTACCATCTCCTGAAGATAAATCATGGAAAAAGACTTCTTCATGG
GGCAAAGAAACATTTCGTTTACATTTGTTATGTGAAGGTTCAGAAGGCGG
TTCTGTTGGTGATATTCATTTCCTCCAAGACCATAAAGGATATCTTATCG
AACAACCGACGGAATTTCTGAAGAAAGTGTTACCAGTGTTGACGATTGGA
ATGAAAGTATTATCCACAGCTGCTAAGATTGCTGGAACGGCTATTGGGGC
TGGTGGTTTGGTTCCCAGTGGCGATGTCTTGAAAACGTTAGGAATCGTTT
CGCAAAAGTCCGGTGATATTGCAGCTCTTCTGCAAAAGGTCCAAGAGAGT
ATCAAAGAATGTAATCATCACGATGTTGAGAATCCAGAAATCCAAGTCTC
AACAGGGGCTGCTTTACGTTCtttggaagtttttttaaatgaaaatgatG
AATTACGTCATTTTGGTGGATTACAATCGGTTGCCGGTCCTGATGGTCGT
TGGGCTTGGGTTTGTGATCAACATGCCAAATTTTAAGAAAGCTTTGACAT
ACTATTATCAAAAATCGCACGTTTTGTAACCAAATGGGATATTCCTTTTT
GTGTTGTTGGAAACAAAATTgatttggaatctaaaagagaAGTGAGTGAA
GAAGAAGGAAACTCTGTCGAAGGatctttattttttcttGAAACTTCTTG
TAAAATTGGACATAACATTGATGCTTTGTTTGATAAGATAATCGAATATT
GTCACAACAATGGTGATGTAGCAAAAAATGTTGATACTGTAGTCTCACAT
GTTGCAGCGAAGAAAGAACTTATTCAATTGTTCCTTGATGGTCAGCTCAA
AAGCATTTGCCTGTCATCACTGCCTTCAGAATTAAAGAATATAAGTGCCC
AAGATGCTTTGCGCAATTGCACTAAATCTGGATATGTTCAGACGAAATGG
TTATGGATTTCATTGAATcgatttttggttttgaaaggAGATTATCTTTA
TTGGTTTCGTAGAAACACTAGCAGAGATCCTGTAGCTTTTTTGGATTTAA
GAAATTGTGTATCATTATCAGGGGAAGAAGAAAGAAACAGCTTTTCTATC
GTTTATTCAAAAACTGCTGGTAATTCTCTGGACACAAATTGTATAACTTT
TCAGTGTGTCAACACTGCAGATGAGGAAGATAGTATTTCATGGAAACTAG
ATTTACTCAACCAGCTTGCTAAGAGTACGGAAAATGTACCCATTCGAAAA
GCTTGTTTTGGTGCTTTGACTAAAATGAAACTCGGAAGGACAGAGAGAGC
AATCATCAAAATCAGACAAAATGATGAAAGTTTGTATCGCTTATCCTTTA
AAAGTCAAAACAAGCTTGACATGAGAATTGGCTTCACTTCATTGggattt
tcttttgaagaacACAATTTTAAGTTTTCCACGGATGCTTCAAGGAGTGA
ATACGTATTTTTCATCAAGGATTTAGCCGTAGTTTGTTTCAAACCAAGAG
ATACAGAGTCGTACAATTCTGCTGGTTCtcaattaaagaaaatatttggc
gTTCAGTCATTTGGTGGAAGAATTACAGAGAAATCGTGCTTGGAAATATT
TGATTTGGCATACCGTTGTGCATGTTTTGAAATGTCTATCAGTGGCATCG
AATCACTAAAAGATTCTCTCATTCACCATTGGACAAAATGtgaGACATTT
AAAGAAATCAACTTACGTGGATATCAAATGATCAATCAAGATATTTTTGC
GATCAGTCATGCTTTATCACATTATCATTTTATTTCAACAATTTGTCTTC
GGAATTGTGGAATTGATAGCAAGGGGCtcagtatttttctgaaaagtttA
ACCGATTACAACGCTTTGAAATGCTTGGATATTGGAATGAACAAACATAT
CGATTCCAACGAAACTGGCAAATGTTTTGAAGAATTCTTGAAAACATgca
aattggaaacattaaagcTTATGAGTTGTGACATAGGAAGTGTTACTTTT
TCCACATTTTTACCCGTtataaagGAGCACGAAACTCTTGAAGAAATTGA
TTTGAGTTTCAATGATGTTGACGATTCTCTTTGTGAACCGATTTCTGAAA
TCATTTCCAAAAACAACAGACTTGCAAAACTTGTTTTGTGGCACAGTTGT
TTGACTGAAGAGCCTGCAACTAAATTGTATGGAGCTTTAGAAAAGAGGTC
GAAAATATTTCCAAAGCTCGAGATATCTCTCCACCACTCTCAATTTATTT
CAAACGACACAATTACGTTGTTCGACACCTTTTTGGAGAAggtagaaaaa
gaagaagaagaagaagaagtagAAGTTGGTGATGTTTGTGAAACTATTAA
AATCAAAAGTAACAAGTCTGAAAATGAAACCAATTCATCTGCTAAAGATA
TGAACGATTTTTTAGATGTTGATAATATCAAGTTAGAAGTCGGCGAAGAA
AACACATTTACACTGAAAGAGATGTTGGTTGACGTCATGCTTACTCagca
aattattttaaaaagacaAGTCTTGCAATATCAAAAACAAATGGAGCATT
TTCAGCTATCCATCAATATGGTACAGATTCGCACGCCAAGAACGTTCTGT
ATTTTACCATCTCCTGAAGATAAATCATGGAAAAAGACTTCTTCATGGGG
CAAAGAAACATTTCGTTTACATTTGTTATGTGAAGGTTCAGAAGGCGGTT
CTGTTGGTGATATTCATTTCCTCCAAGACCATAAAGGATATCTTATCGAA
CAACCGACGGAATTTCTGAAGAAAGTGTTACCAGTGTTGACGATTGGAAT
GAAAGTATTATCCACAGCTGCTAAGATTGCTGGAACGGCTATTGGGGCTG
GTGGTTTGGTTCCCAGTGGCGATGTCTTGAAAACGTTAGGAATCGTTTCG
CAAAAGTCCGGTGATATTGCAGCTCTTCTGCAAAAGGTCCAAGAGAGTAT
CAAAGAATGTAATCATCACGATGTTGAGAATCCAGAAATCCAAGTCTCAA
CAGGGGCTGCTTTACGTTCtttggaagtttttttaaatgaaaatgatGAA
TTACGTCATTTTGGTGGATTACAATCGGTTGCCGGTCCTGATGGTCGTTG
GGCTTGGGTTTGTGATCAACATGCCAAATTTTAAGAAAGCTTTGACATAC
TATTATCAAAAATCGCACGTTTTGTAACCAAATGGGATATTCCTTTTTGT
GTTGTTGGAAACAAAATTgatttggaatctaaaagagaAGTGAGTGAAGA
AGAAGGAAACTCTGTCGAAGGatctttattttttcttGAAACTTCTTGTA
AAATTGGACATAACATTGATGCTTTGTTTGATAAGATAATCGAATATTGT
CACAACAATGGTGATGTAGCAAAAAATGTTGATACTGTAGTCTCACATGT
TGCAGCGAAGAAAGAACTTATTCAATTGTTCCTTGATGGTCAGCTCAAAA
GCATTTGCCTGTCATCACTGCCTTCAGAATTAAAGAATATAAGTGCCCAA
GATGCTTTGCGCAATTGCACTAAATCTGGATATGTTCAGACGAAATGGTT
ATGGATTTCATTGAATcgatttttggttttgaaaggAGATTATCTTTATT
GGTTTCGTAGAAACACTAGCAGAGATCCTGTAGCTTTTTTGGATTTAAGA
AATTGTGTATCATTATCAGGGGAAGAAGAAAGAAACAGCTTTTCTATCGT
TTATTCAAAAACTGCTGGTAATTCTCTGGACACAAATTGTATAACTTTTC
AGTGTGTCAACACTGCAGATGAGGAAGATAGTATTTCATGGAAACTAGAT
TTACTCAACCAGCTTGCTAAGAGTACGGAAAATGTACCCATTCGAAAAGC
TTGTTTTGGTGCTTTGACTAAAATGAAACTCGGAAGGACAGAGAGAGCAA
TCATCAAAATCAGACAAAATGATGAAAGTTTGTATCGCTTATCCTTTAAA
AGTCAAAACAAGCTTGACATGAGAATTGGCTTCACTTCATTGggattttc
ttttgaagaacACAATTTTAAGTTTTCCACGGATGCTTCAAGGAGTGAAT
ACGTATTTTTCATCAAGGATTTAGCCGTAGTTTGTTTCAAACCAAGAGAT
ACAGAGTCGTACAATTCTGCTGGTTCtcaattaaagaaaatatttggcgT
TCAGTCATTTGGTGGAAGAATTACAGAGAAATCGTGCTTGGAAATATTTG
ATTTGGCATACCGTTGTGCATGTTTTGAAATGTCTATCAGTGGCATCGAA
TCACTAAAAGATTCTCTCATTCACCATTGGACAAAATGtgaGACATTTAA
AGAAATCAACTTACGTGGATATCAAATGATCAATCAAGATATTTTTGCGA
TCAGTCATGCTTTATCACATTATCATTTTATTTCAACAATTTGTCTTCGG
AATTGTGGAATTGATAGCAAGGGGCtcagtatttttctgaaaagtttAAC
CGATTACAACGCTTTGAAATGCTTGGATATTGGAATGAACAAACATATCG
ATTCCAACGAAACTGGCAAATGTTTTGAAGAATTCTTGAAAACATgcaaa
ttggaaacattaaagcTTATGAGTTGTGACATAGGAAGTGTTACTTTTTC
CACATTTTTACCCGTtataaagGAGCACGAAACTCTTGAAGAAATTGATT
TGAGTTTCAATGATGTTGACGATTCTCTTTGTGAACCGATTTCTGAAATC
ATTTCCAAAAACAACAGACTTGCAAAACTTGTTTTGTGGCACAGTTGTTT
GACTGAAGAGCCTGCAACTAAATTGTATGGAGCTTTAGAAAAGAGGTCGA
AAATATTTCCAAAGCTCGAGATATCTCTCCACCACTCTCAATTTATTTCA
AACGACACAATTACGTTGTTCGACACCTTTTTGGAGAAggtagaaaaaga
agaagaagaagaagaagtagAAGTTGGTGATGTTTGTGAAACTATTAAAA
TCAAAAGTAACAAGTCTGAAAATGAAACCAATTCATCTGCTAAAGATATG
AACGATTTTTTAGATGTTGATAATATCAAGTTAGAAGTCGGCGAAGAAAA
CACATTTACACTGAAAGAGATGTTGGTTGACGTCATGCTTACTCagcaaa
ttattttaaaaagacaAGTCTTGCAATATCAAAAACAAATGGAGCATTTT
CAGCTATCCATCAATATGGTACAGATTCGCACGCCAAGAACGTTCTGTAT
TTTACCATCTCCTGAAGATAAATCATGGAAAAAGACTTCTTCATGGGGCA
AAGAAACATTTCGTTTACATTTGTTATGTGAAGGTTCAGAAGGCGGTTCT
GTTGGTGATATTCATTTCCTCCAAGACCATAAAGGATATCTTATCGAACA
ACCGACGGAATTTCTGAAGAAAGTGTTACCAGTGTTGACGATTGGAATGA
AAGTATTATCCACAGCTGCTAAGATTGCTGGAACGGCTATTGGGGCTGGT
GGTTTGGTTCCCAGTGGCGATGTCTTGAAAACGTTAGGAATCGTTTCGCA
AAAGTCCGGTGATATTGCAGCTCTTCTGCAAAAGGTCCAAGAGAGTATCA
AAGAATGTAATCATCACGATGTTGAGAATCCAGAAATCCAAGTCTCAACA
GGGGCTGCTTTACGTTCtttggaagtttttttaaatgaaaatgatGAATT
ACGTCATTTTGGTGGATTACAATCGGTTGCCGGTCCTGATGGTCGTTGGG
CTTGGGTTTGTGATCAACATGCCAAATTTTAAGAAAGCTTTGACATACTA
TTATCAAAAATCGCACGTTTTGTAACCAAATGGGATATTCCTTTTTGTGT
TGTTGGAAACAAAATTgatttggaatctaaaagagaAGTGAGTGAAGAAG
AAGGAAACTCTGTCGAAGGatctttattttttcttGAAACTTCTTGTAAA
ATTGGACATAACATTGATGCTTTGTTTGATAAGATAATCGAATATTGTCA
CAACAATGGTGATGTAGCAAAAAATGTTGATACTGTAGTCTCACATGTTG
CAGCGAAGAAAGAACTTATTCAATTGTTCCTTGATGGTCAGCTCAAAAGC
ATTTGCCTGTCATCACTGCCTTCAGAATTAAAGAATATAAGTGCCCAAGA
TGCTTTGCGCAATTGCACTAAATCTGGATATGTTCAGACGAAATGGTTAT
GGATTTCATTGAATcgatttttggttttgaaaggAGATTATCTTTATTGG
TTTCGTAGAAACACTAGCAGAGATCCTGTAGCTTTTTTGGATTTAAGAAA
TTGTGTATCATTATCAGGGGAAGAAGAAAGAAACAGCTTTTCTATCGTTT
ATTCAAAAACTGCTGGTAATTCTCTGGACACAAATTGTATAACTTTTCAG
TGTGTCAACACTGCAGATGAGGAAGATAGTATTTCATGGAAACTAGATTT
ACTCAACCAGCTTGCTAAGAGTACGGAAAATGTACCCATTCGAAAAGCTT
GTTTTGGTGCTTTGACTAAAATGAAACTCGGAAGGACAGAGAGAGCAATC
ATCAAAATCAGACAAAATGATGAAAGTTTGTATCGCTTATCCTTTAAAAG
TCAAAACAAGCTTGACATGAGAATTGGCTTCACTTCATTGggattttctt
ttgaagaacACAATTTTAAGTTTTCCACGGATGCTTCAAGGAGTGAATAC
GTATTTTTCATCAAGGATTTAGCCGTAGTTTGTTTCAAACCAAGAGATAC
AGAGTCGTACAATTCTGCTGGTTCtcaattaaagaaaatatttggcgTTC
AGTCATTTGGTGGAAGAATTACAGAGAAATCGTGCTTGGAAATATTTGAT
TTGGCATACCGTTGTGCATGTTTTGAAATGTCTATCAGTGGCATCGAATC
ACTAAAAGATTCTCTCATTCACCATTGGACAAAATGtgaGACATTTAAAG
AAATCAACTTACGTGGATATCAAATGATCAATCAAGATATTTTTGCGATC
AGTCATGCTTTATCACATTATCATTTTATTTCAACAATTTGTCTTCGGAA
TTGTGGAATTGATAGCAAGGGGCtcagtatttttctgaaaagtttAACCG
ATTACAACGCTTTGAAATGCTTGGATATTGGAATGAACAAACATATCGAT
TCCAACGAAACTGGCAAATGTTTTGAAGAATTCTTGAAAACATgcaaatt
ggaaacattaaagcTTATGAGTTGTGACATAGGAAGTGTTACTTTTTCCA
CATTTTTACCCGTtataaagGAGCACGAAACTCTTGAAGAAATTGATTTG
AGTTTCAATGATGTTGACGATTCTCTTTGTGAACCGATTTCTGAAATCAT
TTCCAAAAACAACAGACTTGCAAAACTTGTTTTGTGGCACAGTTGTTTGA
CTGAAGAGCCTGCAACTAAATTGTATGGAGCTTTAGAAAAGAGGTCGAAA
ATATTTCCAAAGCTCGAGATATCTCTCCACCACTCTCAATTTATTTCAAA
CGACACAATTACGTTGTTCGACACCTTTTTGGAGAAggtagaaaaagaag
aagaagaagaagaagtagAAGTTGGTGATGTTTGTGAAACTATTAAAATC
AAAAGTAACAAGTCTGAAAATGAAACCAATTCATCTGCTAAAGATATGAA
CGATTTTTTAGATGTTGATAATATCAAGTTAGAAGTCGGCGAAGAAAACA
CATTTACACTGAAAGAGATGTTGGTTGACGTCATGCTTACTCagcaaatt
attttaaaaagacaAGTCTTGCAATATCAAAAACAAATGGAGCATTTTCA
GCTATCCATCAATATGGTACAGATTCGCACGCCAAGAACGTTCTGTATTT
TACCATCTCCTGAAGATAAATCATGGAAAAAGACTTCTTCATGGGGCAAA
GAAACATTTCGTTTACATTTGTTATGTGAAGGTTCAGAAGGCGGTTCTGT
TGGTGATATTCATTTCCTCCAAGACCATAAAGGATATCTTATCGAACAAC
CGACGGAATTTCTGAAGAAAGTGTTACCAGTGTTGACGATTGGAATGAAA
GTATTATCCACAGCTGCTAAGATTGCTGGAACGGCTATTGGGGCTGGTGG
TTTGGTTCCCAGTGGCGATGTCTTGAAAACGTTAGGAATCGTTTCGCAAA
AGTCCGGTGATATTGCAGCTCTTCTGCAAAAGGTCCAAGAGAGTATCAAA
GAATGTAATCATCACGATGTTGAGAATCCAGAAATCCAAGTCTCAACAGG
GGCTGCTTTACGTTCtttggaagtttttttaaatgaaaatgatGAATTAC
GTCATTTTGGTGGATTACAATCGGTTGCCGGTCCTGATGGTCGTTGGGCT
TGGGTTTGTGATCAACATGCCAAATTTTAAGAAAGCTTTGACATACTATT
ATCAAAAATCGCACGTTTTGTAACCAAATGGGATATTCCTTTTTGTGTTG
TTGGAAACAAAATTgatttggaatctaaaagagaAGTGAGTGAAGAAGAA
GGAAACTCTGTCGAAGGatctttattttttcttGAAACTTCTTGTAAAAT
TGGACATAACATTGATGCTTTGTTTGATAAGATAATCGAATATTGTCACA
ACAATGGTGATGTAGCAAAAAATGTTGATACTGTAGTCTCACATGTTGCA
GCGAAGAAAGAACTTATTCAATTGTTCCTTGATGGTCAGCTCAAAAGCAT
TTGCCTGTCATCACTGCCTTCAGAATTAAAGAATATAAGTGCCCAAGATG
CTTTGCGCAATTGCACTAAATCTGGATATGTTCAGACGAAATGGTTATGG
ATTTCATTGAATcgatttttggttttgaaaggAGATTATCTTTATTGGTT
TCGTAGAAACACTAGCAGAGATCCTGTAGCTTTTTTGGATTTAAGAAATT
GTGTATCATTATCAGGGGAAGAAGAAAGAAACAGCTTTTCTATCGTTTAT
TCAAAAACTGCTGGTAATTCTCTGGACACAAATTGTATAACTTTTCAGTG
TGTCAACACTGCAGATGAGGAAGATAGTATTTCATGGAAACTAGATTTAC
TCAACCAGCTTGCTAAGAGTACGGAAAATGTACCCATTCGAAAAGCTTGT
TTTGGTGCTTTGACTAAAATGAAACTCGGAAGGACAGAGAGAGCAATCAT
CAAAATCAGACAAAATGATGAAAGTTTGTATCGCTTATCCTTTAAAAGTC
AAAACAAGCTTGACATGAGAATTGGCTTCACTTCATTGggattttctttt
gaagaacACAATTTTAAGTTTTCCACGGATGCTTCAAGGAGTGAATACGT
ATTTTTCATCAAGGATTTAGCCGTAGTTTGTTTCAAACCAAGAGATACAG
AGTCGTACAATTCTGCTGGTTCtcaattaaagaaaatatttggcgTTCAG
TCATTTGGTGGAAGAATTACAGAGAAATCGTGCTTGGAAATATTTGATTT
GGCATACCGTTGTGCATGTTTTGAAATGTCTATCAGTGGCATCGAATCAC
TAAAAGATTCTCTCATTCACCATTGGACAAAATGtgaGACATTTAAAGAA
ATCAACTTACGTGGATATCAAATGATCAATCAAGATATTTTTGCGATCAG
TCATGCTTTATCACATTATCATTTTATTTCAACAATTTGTCTTCGGAATT
GTGGAATTGATAGCAAGGGGCtcagtatttttctgaaaagtttAACCGAT
TACAACGCTTTGAAATGCTTGGATATTGGAATGAACAAACATATCGATTC
CAACGAAACTGGCAAATGTTTTGAAGAATTCTTGAAAACATgcaaattgg
aaacattaaagcTTATGAGTTGTGACATAGGAAGTGTTACTTTTTCCACA
TTTTTACCCGTtataaagGAGCACGAAACTCTTGAAGAAATTGATTTGAG
TTTCAATGATGTTGACGATTCTCTTTGTGAACCGATTTCTGAAATCATTT
CCAAAAACAACAGACTTGCAAAACTTGTTTTGTGGCACAGTTGTTTGACT
GAAGAGCCTGCAACTAAATTGTATGGAGCTTTAGAAAAGAGGTCGAAAAT
ATTTCCAAAGCTCGAGATATCTCTCCACCACTCTCAATTTATTTCAAACG
ACACAATTACGTTGTTCGACACCTTTTTGGAGAAggtagaaaaagaagaa
gaagaagaagaagtagAAGTTGGTGATGTTTGTGAAACTATTAAAATCAA
AAGTAACAAGTCTGAAAATGAAACCAATTCATCTGCTAAAGATATGAACG
ATTTTTTAGATGTTGATAATATCAAGTTAGAAGTCGGCGAAGAAAACACA
TTTACACTGAAAGAGATGTTGGTTGACGTCATGCTTACTCagcaaattat
tttaaaaagacaAGTCTTGCAATATCAAAAACAAATGGAGCATTTTCAGC
TATCCATCAATATGGTACAGATTCGCACGCCAAGAACGTTCTGTATTTTA
CCATCTCCTGAAGATAAATCATGGAAAAAGACTTCTTCATGGGGCAAAGA
AACATTTCGTTTACATTTGTTATGTGAAGGTTCAGAAGGCGGTTCTGTTG
GTGATATTCATTTCCTCCAAGACCATAAAGGATATCTTATCGAACAACCG
ACGGAATTTCTGAAGAAAGTGTTACCAGTGTTGACGATTGGAATGAAAGT
ATTATCCACAGCTGCTAAGATTGCTGGAACGGCTATTGGGGCTGGTGGTT
TGGTTCCCAGTGGCGATGTCTTGAAAACGTTAGGAATCGTTTCGCAAAAG
TCCGGTGATATTGCAGCTCTTCTGCAAAAGGTCCAAGAGAGTATCAAAGA
ATGTAATCATCACGATGTTGAGAATCCAGAAATCCAAGTCTCAACAGGGG
CTGCTTTACGTTCtttggaagtttttttaaatgaaaatgatGAATTACGT
CATTTTGGTGGATTACAATCGGTTGCCGGTCCTGATGGTCGTTGGGCTTG
GGTTTGTGATCAACATGCCAAATTTTAAGAAAGCTTTGACATACTATTAT
CAAAAATCGCACGTTTTGTAACCAAATGGGATATTCCTTTTTGTGTTGTT
GGAAACAAAATTgatttggaatctaaaagagaAGTGAGTGAAGAAGAAGG
AAACTCTGTCGAAGGatctttattttttcttGAAACTTCTTGTAAAATTG
GACATAACATTGATGCTTTGTTTGATAAGATAATCGAATATTGTCACAAC
AATGGTGATGTAGCAAAAAATGTTGATACTGTAGTCTCACATGTTGCAGC
GAAGAAAGAACTTATTCAATTGTTCCTTGATGGTCAGCTCAAAAGCATTT
GCCTGTCATCACTGCCTTCAGAATTAAAGAATATAAGTGCCCAAGATGCT
TTGCGCAATTGCACTAAATCTGGATATGTTCAGACGAAATGGTTATGGAT
TTCATTGAATcgatttttggttttgaaaggAGATTATCTTTATTGGTTTC
GTAGAAACACTAGCAGAGATCCTGTAGCTTTTTTGGATTTAAGAAATTGT
GTATCATTATCAGGGGAAGAAGAAAGAAACAGCTTTTCTATCGTTTATTC
AAAAACTGCTGGTAATTCTCTGGACACAAATTGTATAACTTTTCAGTGTG
TCAACACTGCAGATGAGGAAGATAGTATTTCATGGAAACTAGATTTACTC
AACCAGCTTGCTAAGAGTACGGAAAATGTACCCATTCGAAAAGCTTGTTT
TGGTGCTTTGACTAAAATGAAACTCGGAAGGACAGAGAGAGCAATCATCA
AAATCAGACAAAATGATGAAAGTTTGTATCGCTTATCCTTTAAAAGTCAA
AACAAGCTTGACATGAGAATTGGCTTCACTTCATTGggattttcttttga
agaacACAATTTTAAGTTTTCCACGGATGCTTCAAGGAGTGAATACGTAT
TTTTCATCAAGGATTTAGCCGTAGTTTGTTTCAAACCAAGAGATACAGAG
TCGTACAATTCTGCTGGTTCtcaattaaagaaaatatttggcgTTCAGTC
ATTTGGTGGAAGAATTACAGAGAAATCGTGCTTGGAAATATTTGATTTGG
CATACCGTTGTGCATGTTTTGAAATGTCTATCAGTGGCATCGAATCACTA
AAAGATTCTCTCATTCACCATTGGACAAAATGtgaGACATTTAAAGAAAT
CAACTTACGTGGATATCAAATGATCAATCAAGATATTTTTGCGATCAGTC
ATGCTTTATCACATTATCATTTTATTTCAACAATTTGTCTTCGGAATTGT
GGAATTGATAGCAAGGGGCtcagtatttttctgaaaagtttAACCGATTA
CAACGCTTTGAAATGCTTGGATATTGGAATGAACAAACATATCGATTCCA
ACGAAACTGGCAAATGTTTTGAAGAATTCTTGAAAACATgcaaattggaa
acattaaagcTTATGAGTTGTGACATAGGAAGTGTTACTTTTTCCACATT
TTTACCCGTtataaagGAGCACGAAACTCTTGAAGAAATTGATTTGAGTT
TCAATGATGTTGACGATTCTCTTTGTGAACCGATTTCTGAAATCATTTCC
AAAAACAACAGACTTGCAAAACTTGTTTTGTGGCACAGTTGTTTGACTGA
AGAGCCTGCAACTAAATTGTATGGAGCTTTAGAAAAGAGGTCGAAAATAT
TTCCAAAGCTCGAGATATCTCTCCACCACTCTCAATTTATTTCAAACGAC
ACAATTACGTTGTTCGACACCTTTTTGGAGAAggtagaaaaagaagaaga
agaagaagaagtagAAGTTGGTGATGTTTGTGAAACTATTAAAATCAAAA
GTAACAAGTCTGAAAATGAAACCAATTCATCTGCTAAAGATATGAACGAT
TTTTTAGATGTTGATAATATCAAGTTAGAAGTCGGCGAAGAAAACACATT
TACACTGAAAGAGATGTTGGTTGACGTCATGCTTACTCagcaaattattt
taaaaagacaAGTCTTGCAATATCAAAAACAAATGGAGCATTTTCAGCTA
TCCATCAATATGGTACAGATTCGCACGCCAAGAACGTTCTGTATTTTACC
ATCTCCTGAAGATAAATCATGGAAAAAGACTTCTTCATGGGGCAAAGAAA
CATTTCGTTTACATTTGTTATGTGAAGGTTCAGAAGGCGGTTCTGTTGGT
GATATTCATTTCCTCCAAGACCATAAAGGATATCTTATCGAACAACCGAC
GGAATTTCTGAAGAAAGTGTTACCAGTGTTGACGATTGGAATGAAAGTAT
TATCCACAGCTGCTAAGATTGCTGGAACGGCTATTGGGGCTGGTGGTTTG
GTTCCCAGTGGCGATGTCTTGAAAACGTTAGGAATCGTTTCGCAAAAGTC
CGGTGATATTGCAGCTCTTCTGCAAAAGGTCCAAGAGAGTATCAAAGAAT
GTAATCATCACGATGTTGAGAATCCAGAAATCCAAGTCTCAACAGGGGCT
GCTTTACGTTCtttggaagtttttttaaatgaaaatgatGAATTACGTCA
TTTTGGTGGATTACAATCGGTTGCCGGTCCTGATGGTCGTTGGGCTTGGG
TTTGTGATCAACATGCCAAATTTTAAGAAAGCTTTGACATACTATTATCA
AAAATCGCACGTTTTGTAACCAAATGGGATATTCCTTTTTGTGTTGTTGG
AAACAAAATTgatttggaatctaaaagagaAGTGAGTGAAGAAGAAGGAA
ACTCTGTCGAAGGatctttattttttcttGAAACTTCTTGTAAAATTGGA
CATAACATTGATGCTTTGTTTGATAAGATAATCGAATATTGTCACAACAA
TGGTGATGTAGCAAAAAATGTTGATACTGTAGTCTCACATGTTGCAGCGA
AGAAAGAACTTATTCAATTGTTCCTTGATGGTCAGCTCAAAAGCATTTGC
CTGTCATCACTGCCTTCAGAATTAAAGAATATAAGTGCCCAAGATGCTTT
GCGCAATTGCACTAAATCTGGATATGTTCAGACGAAATGGTTATGGATTT
CATTGAATcgatttttggttttgaaaggAGATTATCTTTATTGGTTTCGT
AGAAACACTAGCAGAGATCCTGTAGCTTTTTTGGATTTAAGAAATTGTGT
ATCATTATCAGGGGAAGAAGAAAGAAACAGCTTTTCTATCGTTTATTCAA
AAACTGCTGGTAATTCTCTGGACACAAATTGTATAACTTTTCAGTGTGTC
AACACTGCAGATGAGGAAGATAGTATTTCATGGAAACTAGATTTACTCAA
CCAGCTTGCTAAGAGTACGGAAAATGTACCCATTCGAAAAGCTTGTTTTG
GTGCTTTGACTAAAATGAAACTCGGAAGGACAGAGAGAGCAATCATCAAA
ATCAGACAAAATGATGAAAGTTTGTATCGCTTATCCTTTAAAAGTCAAAA
CAAGCTTGACATGAGAATTGGCTTCACTTCATTGggattttcttttgaag
aacACAATTTTAAGTTTTCCACGGATGCTTCAAGGAGTGAATACGTATTT
TTCATCAAGGATTTAGCCGTAGTTTGTTTCAAACCAAGAGATACAGAGTC
GTACAATTCTGCTGGTTCtcaattaaagaaaatatttggcgTTCAGTCAT
TTGGTGGAAGAATTACAGAGAAATCGTGCTTGGAAATATTTGATTTGGCA
TACCGTTGTGCATGTTTTGAAATGTCTATCAGTGGCATCGAATCACTAAA
AGATTCTCTCATTCACCATTGGACAAAATGtgaGACATTTAAAGAAATCA
ACTTACGTGGATATCAAATGATCAATCAAGATATTTTTGCGATCAGTCAT
GCTTTATCACATTATCATTTTATTTCAACAATTTGTCTTCGGAATTGTGG
AATTGATAGCAAGGGGCtcagtatttttctgaaaagtttAACCGATTACA
ACGCTTTGAAATGCTTGGATATTGGAATGAACAAACATATCGATTCCAAC
GAAACTGGCAAATGTTTTGAAGAATTCTTGAAAACATgcaaattggaaac
attaaagcTTATGAGTTGTGACATAGGAAGTGTTACTTTTTCCACATTTT
TACCCGTtataaagGAGCACGAAACTCTTGAAGAAATTGATTTGAGTTTC
AATGATGTTGACGATTCTCTTTGTGAACCGATTTCTGAAATCATTTCCAA
AAACAACAGACTTGCAAAACTTGTTTTGTGGCACAGTTGTTTGACTGAAG
AGCCTGCAACTAAATTGTATGGAGCTTTAGAAAAGAGGTCGAAAATATTT
CCAAAGCTCGAGATATCTCTCCACCACTCTCAATTTATTTCAAACGACAC
AATTACGTTGTTCGACACCTTTTTGGAGAAggtagaaaaagaagaagaag
aagaagaagtagAAGTTGGTGATGTTTGTGAAACTATTAAAATCAAAAGT
AACAAGTCTGAAAATGAAACCAATTCATCTGCTAAAGATATGAACGATTT
TTTAGATGTTGATAATATCAAGTTAGAAGTCGGCGAAGAAAACACATTTA
CACTGAAAGAGATGTTGGTTGACGTCATGCTTACTCagcaaattatttta
aaaagacaAGTCTTGCAATATCAAAAACAAATGGAGCATTTTCAGCTATC
CATCAATATGGTACAGATTCGCACGCCAAGAACGTTCTGTATTTTACCAT
CTCCTGAAGATAAATCATGGAAAAAGACTTCTTCATGGGGCAAAGAAACA
TTTCGTTTACATTTGTTATGTGAAGGTTCAGAAGGCGGTTCTGTTGGTGA
TATTCATTTCCTCCAAGACCATAAAGGATATCTTATCGAACAACCGACGG
AATTTCTGAAGAAAGTGTTACCAGTGTTGACGATTGGAATGAAAGTATTA
TCCACAGCTGCTAAGATTGCTGGAACGGCTATTGGGGCTGGTGGTTTGGT
TCCCAGTGGCGATGTCTTGAAAACGTTAGGAATCGTTTCGCAAAAGTCCG
GTGATATTGCAGCTCTTCTGCAAAAGGTCCAAGAGAGTATCAAAGAATGT
AATCATCACGATGTTGAGAATCCAGAAATCCAAGTCTCAACAGGGGCTGC
TTTACGTTCtttggaagtttttttaaatgaaaatgatGAATTACGTCATT
TTGGTGGATTACAATCGGTTGCCGGTCCTGATGGTCGTTGGGCTTGGGTT
TGTGATCAACATGCCAAATTTTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000313XLOC_000313Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000507-exon-sc0000002-1491911889:1772836..1772985TCONS_00000507-exon-sc0000002-1491911889:1772836..1772985Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1510915933:1772836..1772985TCONS_00000507-exon-sc0000002-1510915933:1772836..1772985Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1575043694:1772836..1772985TCONS_00000507-exon-sc0000002-1575043694:1772836..1772985Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1491911889:1775034..1775571TCONS_00000507-exon-sc0000002-1491911889:1775034..1775571Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1510915933:1775034..1775571TCONS_00000507-exon-sc0000002-1510915933:1775034..1775571Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1575043694:1775034..1775571TCONS_00000507-exon-sc0000002-1575043694:1775034..1775571Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1491911889:1775837..1776037TCONS_00000507-exon-sc0000002-1491911889:1775837..1776037Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1510915933:1775837..1776037TCONS_00000507-exon-sc0000002-1510915933:1775837..1776037Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1575043694:1775837..1776037TCONS_00000507-exon-sc0000002-1575043694:1775837..1776037Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1491911889:1782996..1783087TCONS_00000507-exon-sc0000002-1491911889:1782996..1783087Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1510915933:1782996..1783087TCONS_00000507-exon-sc0000002-1510915933:1782996..1783087Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1575043694:1782996..1783087TCONS_00000507-exon-sc0000002-1575043694:1782996..1783087Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1491911889:1783267..1783440TCONS_00000507-exon-sc0000002-1491911889:1783267..1783440Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1510915933:1783267..1783440TCONS_00000507-exon-sc0000002-1510915933:1783267..1783440Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1575043694:1783267..1783440TCONS_00000507-exon-sc0000002-1575043694:1783267..1783440Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1491911889:1784652..1784785TCONS_00000507-exon-sc0000002-1491911889:1784652..1784785Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1510915933:1784652..1784785TCONS_00000507-exon-sc0000002-1510915933:1784652..1784785Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1575043694:1784652..1784785TCONS_00000507-exon-sc0000002-1575043694:1784652..1784785Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1491911889:1784986..1785185TCONS_00000507-exon-sc0000002-1491911889:1784986..1785185Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1510915933:1784986..1785185TCONS_00000507-exon-sc0000002-1510915933:1784986..1785185Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1575043694:1784986..1785185TCONS_00000507-exon-sc0000002-1575043694:1784986..1785185Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1491911889:1785625..1785885TCONS_00000507-exon-sc0000002-1491911889:1785625..1785885Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1510915933:1785625..1785885TCONS_00000507-exon-sc0000002-1510915933:1785625..1785885Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1575043694:1785625..1785885TCONS_00000507-exon-sc0000002-1575043694:1785625..1785885Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1491911889:1786199..1786352TCONS_00000507-exon-sc0000002-1491911889:1786199..1786352Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1510915933:1786199..1786352TCONS_00000507-exon-sc0000002-1510915933:1786199..1786352Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1575043694:1786199..1786352TCONS_00000507-exon-sc0000002-1575043694:1786199..1786352Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1491911889:1790081..1790217TCONS_00000507-exon-sc0000002-1491911889:1790081..1790217Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1510915933:1790081..1790217TCONS_00000507-exon-sc0000002-1510915933:1790081..1790217Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1575043694:1790081..1790217TCONS_00000507-exon-sc0000002-1575043694:1790081..1790217Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1491911889:1790812..1790979TCONS_00000507-exon-sc0000002-1491911889:1790812..1790979Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1510915933:1790812..1790979TCONS_00000507-exon-sc0000002-1510915933:1790812..1790979Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1575043694:1790812..1790979TCONS_00000507-exon-sc0000002-1575043694:1790812..1790979Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1491911889:1791218..1791409TCONS_00000507-exon-sc0000002-1491911889:1791218..1791409Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1510915933:1791218..1791409TCONS_00000507-exon-sc0000002-1510915933:1791218..1791409Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1575043694:1791218..1791409TCONS_00000507-exon-sc0000002-1575043694:1791218..1791409Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1491911889:1791879..1792371TCONS_00000507-exon-sc0000002-1491911889:1791879..1792371Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1510915933:1791879..1792371TCONS_00000507-exon-sc0000002-1510915933:1791879..1792371Clytia hemisphaericaexon
TCONS_00000507-exon-sc0000002-1575043694:1791879..1792371TCONS_00000507-exon-sc0000002-1575043694:1791879..1792371Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000507-proteinTCONS_00000507-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1772836..1792371 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.14477 2.89914 0.972451 0.497651 2.68739 1.9009 2.40396 2.84677 1.63679 2.01363 1.74029 1.3816 3.5373 2.81086 4.04409 4.81023 3.42212 4.42258 7.95931 9.45092 4.07535 3.86969 5.41008 6.20602 0 0 4.06834 2.59104 4.31173 4.79641
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001806Small_GTPase
IPR011993PH_dom-like
IPR027417P-loop_NTPase
Vocabulary: Molecular Function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003924 GTPase activity
molecular_function GO:0005525 GTP binding
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000507 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top