Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000499 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000499
Unique NameTCONS_00000499
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length9445

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000499 ID=TCONS_00000499|Name=TCONS_00000499|organism=Clytia hemisphaerica|type=transcript|length=9445bp
CTCTACTCGAAATCGCTTTCTCTCTCAAAACTATCCAACTTTTCAAATAC
TTTTTGCTTGCATTCCCCTTCGTTTATTTAAGAAATGAATACTCGTCGAA
CTACGCCATCTTAACTATTCACATAATGCCAAACTTTTTTGAAACTAAAG
ACAACTTCTTGACCATTCTATCACAATCACGCAAGAAACAATAAGGGAAT
GCATATAACAGCAACTGTCCATATATACTCTGAGAATGGACAATCGTTCC
GGTGGTCAAGGCAACCCATATGATCGACCTTACTATGGGGACCCAAATGT
CTTGAGACAACAAATTCCTGGGTATGCTAACTCTCCTGGAATTTATCCAT
ATTCCCAGCAGCAGCAACAAGATGGTTTTTCAGGGCGACGACCAGGGCAA
GACCAGCTTGGTCTCAATAATCATGCTACCGCCAGAACCAACAGCTTGAC
TTCACCTCCACAATCAACCAATCCTTGGATGCACTCTTACCACAATCAAA
CACAACCAAATTCTATGAGCCCTAATTTCAATATGAACATACCGAATATG
TTTCATACAAGGTGGGAACAAGACCAAGCCTCACTTCTACAACAAAGAGA
AATGATGCAAAGAGAAGAACATGCAAGGATGATGTATCGAGAGCGCTTGC
AAATGCAAGAGAGAGAAAATCAGTTGAAAATCCAGATGCAGAAGGAGCAA
GAGCGAGAGTTGCAACTTCAGCGTGAAAAAGAAGCACAACTTCAGCGTGA
AAGGGAAGCAAAGGTTCAAAGAGAACGTGAAGCCCAATTAGAAAGAGAGC
GACAAGCTCAACTTCAAAGAGAACGACAAGCTGCTCTGGAGAAAGAAAGA
CAGCTACAGTTGCAGAGGGAAAGAGAAGCTCAATTACAAAGAGAAGCTCA
ATTACAATATCAGATGCAAAGAGAAATGCAACTTGAAAGAGAAAGAGAAG
CAATGGCAATAAGAGAAAGAGATGCAATCCTTGAACGAGATAGAAAAGCA
ATGCTCTACAGAGATGCTTATTTTGCACAACAACATCAACCACAGCAATt
tccaaaccattttggttccaTGCAAAATACATTGCCTAATTTGAATTTCA
CACAATCCAATGAGTCAATGTCTAATCAATTTAACTTCTATAACCAGCCC
AGTATGCATTCAAATGGTAATCTTCCTAGCAGTACATCGTCTTCTATACT
AAACTTCTCAATGGATCAAATTTTCAACCCTAATAAGATATCTGAGTCAC
CTGTCTCCAAAGCAGCAAGTACCAGTTCTTCCTTTCACTTTCCAATCTCA
TCACCTTCCACCGTCAGCTCAACAACAACTTCATCAACAACGACAACCAC
AACTGCTTTACGTAAAAGCTCATCTAACTCATTTGACAATGGAATTATAA
ATAGTATTGTTTCTGATAAGGGATTTTTAACCTCACCCTTGGACAGTAAT
AGTCAATTCATGAAAACATGGCAAGAACTACAGGATATGGATTTGagtga
aattgagaaaaatgtcCTTGGACCTAAAGATCAAGATTCCCGAAACACTC
CATTAGCAGATACTCCATTTTCAAACCCTACTACACCAACAGAAATGAAT
GGGCTGCCACCAAAACCAATTGATTCTAACTTGAATAACATTGTTAATTC
TCTACCTGAAAACTCTCTGGATTTAAATAAGCATTccattgaaacaaaag
aatctttACAAATAACAAACACTGAAGATACACCACCACAACAGAATCTA
TTGAATCATCCAAGAAATTTATTATCAGTATCTCAAACAGCTCAAGCTAG
CTCCAATTATACAAACACCAGTGTAACGCAATCAGACATAAACTTGACAC
ATGTATCAGAAAATTTACTTACCCATAATAGGTCTTGCGTTTCTTCATTT
GTTTCGCCTACGTCATCAGATTTGTATTGCAATCAAGATTTTGATAAGCA
ATCAAAACGAGGAGATGATATCAAGCATGAAGAATATTCTAATGAACTTC
AAAGCAATCACTCAAAATCATATGAAAAACAATCATCATCTTCACCTAca
acattaaaacaaaaatcaaaacaatcatttAGTAGTATTGAAAGTTTCCT
TGGTATGAGCAGCGATAGTAAAAAAACTGAAGATAATGATAATGAAAGGA
TTAATGACACCACTAAAAAGCGAGAAAGGATCCCATCAAGTGATGTACAA
GATCGAATTTCAGTCATAAAACCATTACCAATTTCATCACCACAAATTTC
AAACACATCCTCTCCTTTGGATATTGTGAATAATGATCATGACACATTGA
AAAGTCCACAAGCAATTGAAAAGCTGAAATCTcctgaagaaattcaaaaa
gtaaTAGATCATTCTGAATCTGCACCTGTCACACTCATCCATCCATCTAT
GCGCCTCAAAAAGCAAAGAAGTCTATCAAACAGTTCAATGACTGCCACCA
GTCCACAACCCGTTATGGAAaaggaaaaaccaaaaacaagtAATAGACGA
CCGTTACATCCTTCTATGCGATTACAGACcaataaaaataatacaaaagT
TGATAAAGCTGAACCTAAAAAGAGTAAGGTTGAAAATCTTGATAACAGTT
TTGACAGTGGAAAGAATATCTTACACAGTCCAAAAACTGGGCGTTATCAA
TCTGAACTTACAAGTACTTCCACCAAATCTTCAACTAGGAAGTTATCTCC
GTTCACTCCTCCAACTGTTACATCACCTTTAACCTCACCACCACTAGTAT
CACCTGGAATTCGAAGTCCCTTCAATGGAAAACCCCTCACTGGAAAACCA
TTCTCAACTGGTAAGCCTGTTCATGGAGGAAAACCAGCATCTTATTCAGC
TCAAGGTGGTGGTAAACCAATGCATATGGGAGGGAAACCGACTAGTTTCT
CTTCACATATGACTGTCAAAGAGGAAAAGTCACCAGAAAAAGAGCACACT
GGCAAACCTTTATCTTTTTTGAAGTCCATGGTAgaagaatcttccaaaaa
caCAAACACACTTCAAGGGAAAAAGATCACTGGCAAGAAAAGACCCAGAA
AGGAAACTATCGAGAAACCAGCttcaaaagaaactttaaaaaaagatgAC
ATATCAAAATCCCCTGACTTGAAAACAAGTCGTATAACAAAAATGATATC
AACCCCACCAAGCTCACAAAAATTGACAGATAATATCAAGACTAAGAAAC
CACCACAAGAAAAACAGGCACCTGTTAAAAAACTACCTGTCAAAAGGTCT
CCAAAAGTATCACCTCCCAAGAGAGAAGCTGTAAAAGATTCACCACTGAA
AGAAAATCCTTTTAGAAAATCTATCGTCCAAGCAAAGAGTAAACCAGTAc
tgacaaaacagaaaaatttgaGTAAAGAGAATATTGAAGAATTGAGCACA
AGTGAGGAAAAAGATTCCCCAAAGAAGacattcaaattcaaagggaTCAC
ATTTGATGCCAAGACTGAAGATGATGATAGCAGTGATTCTGATTCAGACA
GCTCATCAAATTCTGATTcagGGTCGTCAAGTGATAGCAGTGACAACAGT
GGAacagaagaagaaattgaagataTTGAAGACGAAGACGATGACGATAC
TGCATCTCAAACAAGTTCAGTTACAAGCTCTCCTGCAAAGAAAACACAAA
GAGCTGGTCAAAAACGAAAAGCAGTTCCTGACAATGCAGAGGtGATTGCC
AGTTTGAAGAAACGAAAAGTTGTTGATTTGGATTTGATAAAAGCGCCATT
AAAATTTggATGGAGAAGGCAGACAAGACTCAGACCGAACAATGCTGGTG
ATGGGCTGAGGGGAGATGTTTATTATTATTCACCTTGTGGGAAAAAGCTG
AGGACGTATCCTGAGTTAAACAGTtACATCTTTCGAAATGATGTCGTTGA
TGTAGACTTGAAGAATTTCAGCTTTTCAACCAAACTTCGTGTTGGCGAAT
TCATGCAGGCTAAGGATGGTTCAAAGTTTGTGACACTGACTGAAGAAGAG
ATCGATGAAACATTTGTTATGATGGAAGAAAGGAGAAGTGCTTCTGCAAA
AAGAGCTGaagaaaagaagagagaaaaacgTGAAAAGGAGGAGAAGCAAC
GTCAGATACTTGAGGAGAGAAAAAAGAAGAGAGAAGAAGCCTTGGAAAGA
AAGAGATCGAAAGAAGAAGAAAGGAGAAAGGTTCAAAAAGACAAAGCATT
GGAAGCAAAGATGAAGAAGGAGAAAGAAAAGGAAGCAGCACAAGAAGCCA
AACGATTGAAAGAGGAGGCAATAATGTTGAAGAAACTAGAAAGGCAAGCT
CAAATGGAAGCAAGTCGAATTGCCAAGCGTGAGAAAGTTCAAAATATGTT
GGCTGAAAAGCAGAAGATGAAAGAACAAAGAGAACATGAACGAGTCATGA
AGATTGAGAACCAAAAAGTGgagaaagaaatgaaattacAAGCAATCGAA
AATgaGAAGGAACGTAAAAGGCTGCAACAAGTGAAAAGTAAAGTATCAGA
AAAAGAAAAGCGAAAACGAGAGCTGGTCATGATGAAAGCTTATGAAGCAC
AACGGAGAGCTGAGGAGAGAGAACGCCTCAAAGAACAAAAGAAGCTGGAG
AAAACCTTGATCAGGCAACGAAAATTGGAACAGAAAAGATATGAGCGCAT
GATCtctaaagaattgaaaaaacctATCGATGATATGGCTCTGAATGATT
TGAAGCCGTTGCCAGAGTTACCAAGGGTAACCAACATCAACATTCCTGGC
AAAGCATATGCAGATATCCTGATGGTTCAAGAGTTTGTTCACGCCTTTGG
TCATGTCATTGATATCGATCCAGAGAAGGAGTTTCCAAGCATGGGAGAGT
TGCAATCATCATTGTTGTGTGAATCTGGTAGCGATGAAGCAATCTTCACT
GCATGCCAAGCACTTCTTTTTTACGCCCTCTACGATCCCGGTGTATCTGG
GCCTTATGCCAAAACTTCACTGGGTTCAGACCTTACGAGTATCGAATTGA
ACGAGAACAACATATCAGAAGTATTACGTCTTTTCATCTTATCACGTAAT
GAAGGAAAACAACACACACTCAGTGATCAGCTCACCAAATATCCTTTAGA
AGCTCTCTCACCCAGTAGTAAAGCTGCTGTTCTAGCTTTCATTGTCAACG
AACTGCTTTGTGGAAAATCAGTTAGCAGAGAGATTGACGGTAGCTTggag
aacatttcaaatatgCGAAGGGATAAATGGAACCTGGAAGGAGATATACG
GAAaTTGAAAGCTGATCTATTATCAAAGCAACCCAAGAAAGCAGCCAGTG
ATCAACAACAGAAcctaaaaaacaacaaaggaGAGTCGAAGAAAAGAGAC
TCTGACGAGGAGAACAATTCGGACGATGAAGGAACCACTATCACCACTGC
TAAGGAGAGCAATATCGATTTAAACGACACTGCGGAAGACACAGAAGCTG
AAAACCAGCCAGAGATGGTGAATCCTACTACACTCGACCAAATGGAGAAG
AAACTACGTTTGATGGAAAAGAAACACGCTCGCTACCGTAAAAAGTTGTT
CGATTCTTCACACACGATACGTGGTATAAATTTGGGTCAAGATCGATACC
GGCGCCGTTATTTCGTGCTTCCGAACGCCGGAGGGATTTACGTCGAAGGG
CTGGAAAGTGGATTTTTTGACGAAGAAACGAACGTGAAAACAAAGGAAGA
AAAGGAAGAATGCAAAGAACATTTAGATAGTTTACTGACCACCTTGAAAT
CTCCAACTGTGTTGAAATCCCCTGTGACTGGCCCCAAAACACCGGCCACA
AATACACCGTCTGTATCAGCATTATCCTCAAATTCAAACGAACTTTTAAA
ACCGAAACAAGAGAGTCCTATAcaaacacaacaacaacaaaaacagataa
aagtTGAGAATCCTTGTTCAAGTGATAGTAGTTATGTCAAATCTTGGTTT
TCCTTACGGACTAAAAAACGTTGCGAGTCTTACAAAACTTCAGCTATACG
TGAAACGCCTAAAGAGCGCAAACATTCGCTCATCGTTGCACCGAGGATAG
AACGACTTGCCGACGACCACCAATTCTTAGAATCTATATACTCTTGTTAT
TCCACTACTTCTCCTGGTGGGAAAAACACTTTATTACCTGTCAGCAGATT
TCCCTTATCCAAGGAAAGTATGCATCGGAACTCGTTACTAGGCTTACCGG
CTGAATTGGATATGAATTTACTTATACAACAAGACCCACAAAAAGCAGCG
GAAATTCTTGAAATACAGACTGCCAAGCCTCAAGAAATTCCGCCTGAAAT
GCAGGCGGGTTGGTGGCGGATCACCGATCCAGAACAAATGCAGCGCCTGA
ACAAGTGCGCCCACGCCAGGGGTATGAGAGAACGGAACCTTCAAAAGACG
GTGGTGCGATTCCAAGACTACACCAACTCATCGTGTAAAGTTGACCATCT
TGCATtttctcTACTTCTCCCCGACGAAGAAAGTGAAAGCAAAGACAAAG
TAACAGAAGACGACAGCAGCGTTGCCACATCAACGGATACAAACAAATCG
ATACAAGATAAATGGTATCCACAGCTGGCGTATGCAAGTGACAAAGCCAT
TTTGATTGAAGTCGAAGAATTAGAGGAAAAGGTCTTCTCGGCTAGTTTGC
AAGTCAAGGGCTGGCGTTTGTCTCAAAAGATCTCTCCAGCACTTCTGCTG
AGCACGAGTAACGATCAAGCTGAGTATGATCCACCCGAAGATAAATATCC
CATCAGGATAGCGGCTTCCCGTCTCCTAGCTCTTGAGCTCGGTATCGAAC
GACGTTACATGAAGCCTCCATTCCGTACACCAGACAGCCTTCCTAAACCG
GACGCCCCAGAGGCTAAAGAAGAACCAGTCAAGAATCCAAAAGCAACAGC
CCAACTGGAGAAATGGCGTGAAGCAGTAAGCGAAGCAAAATCGTCAGCTC
AGCTATCGATGTGTATCACAGCACTCTTCGAATGTGTCGCTTGGGAGAAG
TCCATCATGAAAGTGTTCTGCATACTATGTCGTAAAAGTGACAACGAAGA
AAGATTGTTGCTATGCGACGCATGTGATCGAGGCTGTCATACGTATTGTT
GTAAGCCGAAATTCGATAAGATTCCCGATGGTGACTGGTTTTGTCAAGAT
TGTGTGTTGATGGCGTCTGGTAGTGATCAGTGCTACAAATGTAAATCGAA
GACCGGACGACGTCTGAAATGTGCATTCTGTCCACGTCATTATCACATGG
ACTGCCTTGAACCACCATTACACAAaACACCTCGTTCGCCTTGGAGTTGT
CCCGTCTGCAAGAAAACACGCTCCAAGAGTAAACCTCCTCAACGTAAAAA
ACCACGCGCCGAAGAACTTCTCAAGAAAGAGGAACAGAGCAAACAAAAAT
CCATGTCCAACAGCCGTGTGCAGACGTCCAAAGACATGGAACCGTGTCGT
TTCATATTGAACGAAATGGAAAATCACGAATCGTCATGGCCCTTTCTCGT
CCCTGTCAATATGAAGCAGTTTCCAGAGTATTATAAAGTGATCAAGCATC
CGATGGATTTCCATACCATGAAAACGAAGCTGCGTGATTACCAATACAAG
TCAAAAGAAGAGTTCGCACGTGACGCGCGGTTGGTGTTTTTCAATTGTAA
AACGTACAACGAAGACGAATCGGAGGTTGGATGTGCAGGTGAAGCGATGC
GAagtttcttcgagaaacgttgGACCGCCCTCAAAAAGGGTGTCTCTTCC
ACAAACAGTGATAACAAATTCCACACCAACAAGAAGGGGGAGGGTGTGGA
ATCATCAGGCGATGAAGGAGAAGACGCTCAGGAGGAGGGTGAAGGCGATG
AAGAAGTATCCAGTTCGAGTTCTGAAGAAATCTCATCCGAAAGTGAGAGC
AGCGAAGTGGAGGAGGACAGTGAAAACGAGACCGACTCAAAAACATGAGG
TACTTCTTGGAGATGAAAAATGGCAGCAAACAGGTGTAAGTTGATGATTT
GGATTTCGGACATCACTTTACGAGAAAACTGCTGAAGAAAAAGATACTGA
AAACTTCCTGCTTGTGAAGGGCTGCTTTAGGTGTTAGCCTCTTTCGATAG
AAAACAAAGTTGCATATGGGTAACGGTATCCAGATAGCGGTATTTAGGTA
GGTTTATTCTGAGCCAAACAGATGATTTGAGAAATACATTTATAACCAAG
AATGATTTTGAACTTACAACTGCTAAATCAAATCGAATTTGCATGGGCAT
ACTGCCTTCAAAGGTTCGATACCAAAAGAGATTTTAGTCCTATTTAGGCC
GCCACGTTATATTTTGATTGGATGCTGTATATATTAAATAGTTCAAACAT
GGGAGGcttattttatactttttgactCTCCCACGTGGGATATCTGGCTT
GTAAGTCACTTGATTGGCATTAGTAGGCAACAAGACATTGCCTCCAAGGg
acacatttttttaaagaaatgattttatatttttttactgCGATGCTAAC
GCAGTTGAAGTACGTTGTTAATAGctagtttttaagattttaaaataatt
ttcttctttatgCGATTTTAGAAGAGTATTTGATACATTTCAGACatctt
tttgataaaatgcCACAGACAATTTATAGTGGGGCGAAGGTTTCTAAAAT
CTTTGCTTTATAGAACAAATAAATGGGAATGGGAATGGCAAAGGAAATTT
TTCATGGATAGGATAATCTCTAccattgatttttctttgatattCTTCCC
GGACACTAAGTTTACCATGCACTCACATACATTCACTAATGGGTCCGTTC
TCCCATCGTTCATCCGCTTTTCATATCAGGGAAATCTCATTTTGActgat
gttgatattttttgagaatGTTCGACTCCCTCAACTTAactacttttttt
gattttctttttttttctcgttaACTTTAAAGGGGTatgtttttgatttt
acattgCTTGTACATTTTTTCTAATACAATTTCTAGGGCGAAGACTCGCT
TTGACCTAAATTAGGACTCCACTTAGCCATTAAATGGCTCTTAGTTAGTT
TTACAAGTGACATTTGAACCGAATGATTGGAACGTCTATCAAAAAGTATT
TGTGAACAGTTGTACTGTGCAATCGTTTCCCATCCCATCTTTGAAGTTTT
CCTACTTTGATGCATTATATTGatcattttcaagatttttcagTTAATTA
TCAtcttttatgtttttgtttcctcTAATTattcaaatcattttttcatc
ttcaattttacaaaagaatGTTGTAATAATTTTTCGTCAGGATATATTTT
TTGTTGTGAGAACCATGTAGAACATTATTTCCATTTTTTGTCATGTTGAT
AGTTTTAATTTCTCCATATACTTATAAttactttttgacgtttttacgAC
AGCTCCAACTATAAATAACcagttcgaatgtttttatgaaaaaat

protein sequence of TCONS_00000499-protein

>TCONS_00000499-protein ID=TCONS_00000499-protein|Name=TCONS_00000499-protein|organism=Clytia hemisphaerica|type=polypeptide|length=2570bp
MDNRSGGQGNPYDRPYYGDPNVLRQQIPGYANSPGIYPYSQQQQQDGFSG
RRPGQDQLGLNNHATARTNSLTSPPQSTNPWMHSYHNQTQPNSMSPNFNM
NIPNMFHTRWEQDQASLLQQREMMQREEHARMMYRERLQMQERENQLKIQ
MQKEQERELQLQREKEAQLQREREAKVQREREAQLERERQAQLQRERQAA
LEKERQLQLQREREAQLQREAQLQYQMQREMQLEREREAMAIRERDAILE
RDRKAMLYRDAYFAQQHQPQQFPNHFGSMQNTLPNLNFTQSNESMSNQFN
FYNQPSMHSNGNLPSSTSSSILNFSMDQIFNPNKISESPVSKAASTSSSF
HFPISSPSTVSSTTTSSTTTTTTALRKSSSNSFDNGIINSIVSDKGFLTS
PLDSNSQFMKTWQELQDMDLSEIEKNVLGPKDQDSRNTPLADTPFSNPTT
PTEMNGLPPKPIDSNLNNIVNSLPENSLDLNKHSIETKESLQITNTEDTP
PQQNLLNHPRNLLSVSQTAQASSNYTNTSVTQSDINLTHVSENLLTHNRS
CVSSFVSPTSSDLYCNQDFDKQSKRGDDIKHEEYSNELQSNHSKSYEKQS
SSSPTTLKQKSKQSFSSIESFLGMSSDSKKTEDNDNERINDTTKKRERIP
SSDVQDRISVIKPLPISSPQISNTSSPLDIVNNDHDTLKSPQAIEKLKSP
EEIQKVIDHSESAPVTLIHPSMRLKKQRSLSNSSMTATSPQPVMEKEKPK
TSNRRPLHPSMRLQTNKNNTKVDKAEPKKSKVENLDNSFDSGKNILHSPK
TGRYQSELTSTSTKSSTRKLSPFTPPTVTSPLTSPPLVSPGIRSPFNGKP
LTGKPFSTGKPVHGGKPASYSAQGGGKPMHMGGKPTSFSSHMTVKEEKSP
EKEHTGKPLSFLKSMVEESSKNTNTLQGKKITGKKRPRKETIEKPASKET
LKKDDISKSPDLKTSRITKMISTPPSSQKLTDNIKTKKPPQEKQAPVKKL
PVKRSPKVSPPKREAVKDSPLKENPFRKSIVQAKSKPVLTKQKNLSKENI
EELSTSEEKDSPKKTFKFKGITFDAKTEDDDSSDSDSDSSSNSDSGSSSD
SSDNSGTEEEIEDIEDEDDDDTASQTSSVTSSPAKKTQRAGQKRKAVPDN
AEVIASLKKRKVVDLDLIKAPLKFGWRRQTRLRPNNAGDGLRGDVYYYSP
CGKKLRTYPELNSYIFRNDVVDVDLKNFSFSTKLRVGEFMQAKDGSKFVT
LTEEEIDETFVMMEERRSASAKRAEEKKREKREKEEKQRQILEERKKKRE
EALERKRSKEEERRKVQKDKALEAKMKKEKEKEAAQEAKRLKEEAIMLKK
LERQAQMEASRIAKREKVQNMLAEKQKMKEQREHERVMKIENQKVEKEMK
LQAIENEKERKRLQQVKSKVSEKEKRKRELVMMKAYEAQRRAEERERLKE
QKKLEKTLIRQRKLEQKRYERMISKELKKPIDDMALNDLKPLPELPRVTN
INIPGKAYADILMVQEFVHAFGHVIDIDPEKEFPSMGELQSSLLCESGSD
EAIFTACQALLFYALYDPGVSGPYAKTSLGSDLTSIELNENNISEVLRLF
ILSRNEGKQHTLSDQLTKYPLEALSPSSKAAVLAFIVNELLCGKSVSREI
DGSLENISNMRRDKWNLEGDIRKLKADLLSKQPKKAASDQQQNLKNNKGE
SKKRDSDEENNSDDEGTTITTAKESNIDLNDTAEDTEAENQPEMVNPTTL
DQMEKKLRLMEKKHARYRKKLFDSSHTIRGINLGQDRYRRRYFVLPNAGG
IYVEGLESGFFDEETNVKTKEEKEECKEHLDSLLTTLKSPTVLKSPVTGP
KTPATNTPSVSALSSNSNELLKPKQESPIQTQQQQKQIKVENPCSSDSSY
VKSWFSLRTKKRCESYKTSAIRETPKERKHSLIVAPRIERLADDHQFLES
IYSCYSTTSPGGKNTLLPVSRFPLSKESMHRNSLLGLPAELDMNLLIQQD
PQKAAEILEIQTAKPQEIPPEMQAGWWRITDPEQMQRLNKCAHARGMRER
NLQKTVVRFQDYTNSSCKVDHLAFSLLLPDEESESKDKVTEDDSSVATST
DTNKSIQDKWYPQLAYASDKAILIEVEELEEKVFSASLQVKGWRLSQKIS
PALLLSTSNDQAEYDPPEDKYPIRIAASRLLALELGIERRYMKPPFRTPD
SLPKPDAPEAKEEPVKNPKATAQLEKWREAVSEAKSSAQLSMCITALFEC
VAWEKSIMKVFCILCRKSDNEERLLLCDACDRGCHTYCCKPKFDKIPDGD
WFCQDCVLMASGSDQCYKCKSKTGRRLKCAFCPRHYHMDCLEPPLHKTPR
SPWSCPVCKKTRSKSKPPQRKKPRAEELLKKEEQSKQKSMSNSRVQTSKD
MEPCRFILNEMENHESSWPFLVPVNMKQFPEYYKVIKHPMDFHTMKTKLR
DYQYKSKEEFARDARLVFFNCKTYNEDESEVGCAGEAMRSFFEKRWTALK
KGVSSTNSDNKFHTNKKGEGVESSGDEGEDAQEEGEGDEEVSSSSSEEIS
SESESSEVEEDSENETDSKT
Run BLAST on NCBI

transcript from alignment at sc0000002:1572459..1593587+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000499 ID=TCONS_00000499|Name=TCONS_00000499|organism=Clytia hemisphaerica|type=transcript|length=21129bp|location=Sequence derived from alignment at sc0000002:1572459..1593587+ (Clytia hemisphaerica)
CTCTACTCGAAATCGCTTTCTCTCTCAAAACTATCCAACTTTTCAAATAC TTTTTGCTTGCATTCCCCTTCGTTTATTTAAGAAATGAATACTCGTCGAA CTACGCCATCTTAACTATTCACATAATGCCAAACTTTTTTGAAACTAAAG ACAACTTCTTGACCATTGTAAGTACacatttttaatgattttaaccagga atttcgcgggaattacaAATATTTTAATGGAGAAAATAGTCAAATGAgca aaagattcaaaaaagaCATTAAAAACGATCTAAAAAGTCATAAACCAACA TCTATAATTACACGTACATTATGAAAATGAGGTAGACATGTTGGCTTCTC TTTCATCATGAGATGAGATTTAGAATaggtaaaatgcttttttaggCAGT TAGGGTTTAGTTTtcttagaaatttaaaaatgaaagtgaatgTGTATTTA GTTTTTTTCCAGTCAGTCTGCAGGGATACATATCAACAAACTTCCATCAt aactttcttcaaaaatcaaaacatacacTACTGTCTGACTGTATTTGAAA TTGATACATACTACTGTACAGTCGATTAAAGTCGATTATTTCCGGTTCGA TTAATATCTTTGCCCGGACTTTAATTGTTTgcgattagtttgattgttca attggttcaacaagttcgattgatcaggTCTGGTACGATCTGTTTTGCAA TTAAGCGATGATCAGGGTATTTGATAGTTGACTTTTATGATGTAGAGTCA TCTGCGGTAAATTCCATTATCAATTGGGGTTACTGACATATATACCTCCA GCTATAAGGCAACATGTAACCCACAATTATATTGACTTCTACCATTTAGC CATTCAACGAAAAACTCTGGACCTGGGCAGTCAGGAGCTTCCTTGCAATT GGAATTGCATGGGATTATTTGTGACTAAAATCGTCTAAAATTACAATCTT GTTGAACTTGACCTGAACATCAATAGTTGTGAGAACGAGAGAATGCGACA acctaccgtgagatcgggtaacttgcatcaatggaggctaacatgcatag ccctcaaatgaaagacttggcgtgtcattaaaatacaaagttaaatcaag acaaaaatgcgaaatggtagagtagagctgtgagcagagctgtgtagttg tattttaatgaccagacaggtcattcatttgagggccatgcatgtttgcc tctactgatgcaagttacccgatctcacggtattgtTTCAGATTTGCATT TAAATTACTTCAATCAGAAATTAGCTGCTctgtaccgtaacttggtctaa tgtcaacatccctcctctaattctgacaccctttttatcacctgaaattg atagaaaggttgaaactgtttttctttgcttagttgTCAGAGAAGAATAA TCccttttcaatcagtgattcaagctttcatattactCCTGTCTCGaaag aagggtgttggaattagacgagggatgtcgatattagaccaacttacagt acgTTATTACATAAATAAAACCCTAACACTTAGTAGCATGTTGCACTTTT GAATTTGAGAAAGTCCTGGACATGACTCAAACTGGCCCGTGCATTAACTT TGGGTAAAtacatagctgtcaactttgcctcacaaaaatgcgggagagct ccaagtcggaaaaattttccctgatAATCTGATTtctcaaaatcggaaaa tcgggaaatcggggaaattttctcgtaaaatccgattttattggaaattt ttttcgggaaattgGGGAATTTTTCGTTCCGATCTTNNaaaaatcccaaa aatgcgggagatttggcagaattttcttcacgcgggagaaatcgttgaca tgcgggagtctcccgctcaatgcgggagagttgacagctatgtaAATGAA TGAATTGAATATGCAGAAAATTTGGTTGATGAAATTCTGATTTTAtgcat catttttttcttgcatATTTCAAGAttgatttatatattatataaaaaga atAATATGTCAATATTGTGTTTTAGTTTAGTATTATTTATTGACCCTGAC TGAAAATAAATAGAATAGGATAGAAAATTAGACAAAATACatcaataaat aaattgagTTGCTGTTTCgatttcacttttcttttgctaattttaatgTA AAGGTCAAGTAAGCATTTGATAGTATTGACCTCCCCTGTCCTGTAAATTT CTCAGTTTCAAACTACTTTCATAGACTTTTTGTGATTCGCTTGATATGCA TTTTAGGGATGGatatttttctagattttacaCCACTTGTTTAACTTATA TATTTTACAGTATGCTTTTAGGGCCCCCAGTGGTTTTCGTGAGtgcgtga aaataaaaaaaagatagcACGAGTGCTTAAATTGGAAAGCcttgcgtgaa caaaaattgcgtgaattgcgaaaaaacattgcATGAATGCATGaatatga gaaaaaaatttgctgtTAATTGCGTGAATTTGAAGGTCTGCTGAGGGATC CTCCTTTTGGTCTTATATACTTTCAATGACTGGTTGTGCAACTTAGATAC GAAATAGGTGGTTTAAAATCCTGCAGAGGGAGATTAAACTTCAGCTAACT TCATTCAACTGGGTGCCACCCCCTTGATGAAGTTGCttatttttgtcttt attgaaaaccACCTAGGTTTTAGGCTTTTTTGTGTCCGGGGTCTTGAAAC TAATCTATTAATAAGAGTAAAGTAAACTAAAAGTTTTATTTACATTTCAG CTATCACAATCACGCAAGAAACAATAAGGGAATGCATATAACAGCAACTG TCCATATATACTCTGAGAATGGACAATCGTTCCGGTGGTCAAGGCAACCC ATATGATCGACCTTACTATGGGGACCCAAATGTCTTGAGTAAgtgatttg atttaaaattggagcaaaaccaaaaacaaaatattgaacAGTAATCCATC AAAGCTTCATCACTTTATAGTAAAAGattgattgaattttttatttattt aatttccCCTTTTATTCCTTTTTAGGACAACAAATTCCTGGGTATGCTAA CTCTCCTGGAATTTATCCATATTCCCAGCAGCAGCAACAAGATGGTTTTT CAGGGCGACGACCAGGGCAAGACCAGCTTGGTCTCAATAATCATGCTACC GCCAGAACCAACAGCTTGACTTCACCTCCACAATCAACCAATCCTTGGAT GCACTCTTACCACAATCAAACACAACCAAATTCTATGAGCCCTAATTTCA ATATGAACATACCGAATATGTTTCATACAAGGTGGGAACAAGACCAAGCC TCACTTCTACAACAAAGAGAAATGATGCAAAGAGAAGAACATGCAAGGAT GATGTATCGAGAGCGCTTGCAAATGCAAGAGAGAGAAAATCAGTTGAAAA TCCAGATGCAGAAGGAGCAAGAGCGAGAGTTGCAACTTCAGCGTGAAAAA GAAGCACAACTTCAGCGTGAAAGGGAAGCAAAGGTTCAAAGAGAACGTGA AGCCCAATTAGAAAGAGAGCGACAAGCTCAACTTCAAAGAGAACGACAAG CTGCTCTGGAGAAAGAAAGACAGCTACAGTTGCAGAGGGAAAGAGAAGCT CAATTACAAAGAGAAGCTCAATTACAATATCAGATGCAAAGAGAAATGCA ACTTGAAAGAGAAAGAGAAGCAATGGCAATAAGAGAAAGAGATGCAATCC TTGAACGAGATAGAAAAGCAATGCTCTACAGAGATGCTTATTTTGCACAA CAACATCAACCACAGCAATttccaaaccattttggttccaTGCAAAATAC ATTGCCTAATTTGAATTTCACACAATCCAATGAGTCAATGTCTAATCAAT TTAACTTCTATAACCAGCCCAGTATGCATTCAAATGGTAATCTTCCTAGC AGTACATCGTCTTCTATACTAAACTTCTCAATGGATCAAATTTTCAACCC TAATAAGATATCTGAGTCACCTGTCTCCAAAGCAGCAAGTACCAGTTCTT CCTTTCACTTTCCAATCTCATCACCTTCCACCGTCAGCTCAACAACAACT TCATCAACAACGACAACCACAACTGCTTTACGTAAAAGCTCATCTAACTC ATTTGACAATGGAATTATAAATAGTATTGTTTCTGATAAGGGATTTTTAA CCTCACCCTTGGACAGTAATAGTCAATTCATGAAAACATGGCAAGAACTA CAGGATATGGATTTGagtgaaattgagaaaaatgtcCTTGGACCTAAAGA TCAAGATTCCCGAAACACTCCATTAGCAGATACTCCATTTTCAAACCCTA CTACACCAACAGAAATGAATGGGCTGCCACCAAAACCAATTGATTCTAAC TTGAATAACATTGTTAATTCTCTACCTGAAAACTCTCTGGATTTAAATAA GCATTccattgaaacaaaagaatctttACAAATAACAAACACTGAAGATA CACCACCACAACAGAATCTATTGAATCATCCAAGAAATTTATTATCAGTA TCTCAAACAGCTCAAGCTAGCTCCAATTATACAAACACCAGTGTAACGCA ATCAGACATAAACTTGACACATGTATCAGAAAATTTACTTACCCATAATA GGTCTTGCGTTTCTTCATTTGTTTCGCCTACGTCATCAGATTTGTATTGC AATCAAGATTTTGATAAGCAATCAAAACGAGGAGATGATATCAAGCATGA AGAATATTCTAATGAACTTCAAAGCAATCACTCAAAATCATATGAAAAAC AATCATCATCTTCACCTAcaacattaaaacaaaaatcaaaacaatcattt AGTAGTATTGAAAGTTTCCTTGGTATGAGCAGCGATAGTAAAAAAACTGA AGATAATGATAATGAAAGGATTAATGACACCACTAAAAAGCGAGAAAGGA TCCCATCAAGTGATGTACAAGATCGAATTTCAGTCATAAAACCATTACCA ATTTCATCACCACAAATTTCAAACACATCCTCTCCTTTGGATATTGTGAA TAATGATCATGACACATTGAAAAGTCCACAAGCAATTGAAAAGCTGAAAT CTcctgaagaaattcaaaaagtaaTAGATCATTCTGAATCTGCACCTGTC ACACTCATCCATCCATCTATGCGCCTCAAAAAGCAAAGAAGTCTATCAAA CAGTTCAATGACTGCCACCAGTCCACAACCCGTTATGGAAaaggaaaaac caaaaacaagtAATAGACGACCGTTACATCCTTCTATGCGATTACAGACc aataaaaataatacaaaagTTGATAAAGCTGAACCTAAAAAGAGTAAGGT TGAAAATCTTGATAACAGTTTTGACAGTGGAAAGAATATCTTACACAGTC CAAAAACTGGGCGTTATCAATCTGAACTTACAAGTACTTCCACCAAATCT TCAACTAGGAAGTTATCTCCGTTCACTCCTCCAACTGTTACATCACCTTT AACCTCACCACCACTAGTATCACCTGGAATTCGAAGTCCCTTCAATGGAA AACCCCTCACTGGAAAACCATTCTCAACTGGTAAGCCTGTTCATGGAGGA AAACCAGCATCTTATTCAGCTCAAGGTGGTGGTAAACCAATGCATATGGG AGGGAAACCGACTAGTTTCTCTTCACATATGACTGTCAAAGAGGAAAAGT CACCAGAAAAAGAGCACACTGGCAAACCTTTATCTTTTTTGAAGTCCATG GTAgaagaatcttccaaaaacaCAAACACACTTCAAGGGAAAAAGATCAC TGGCAAGAAAAGACCCAGAAAGGAAACTATCGAGAAACCAGCttcaaaag aaactttaaaaaaagatgACATATCAAAATCCCCTGACTTGAAAACAAGT CGTATAACAAAAATGATATCAACCCCACCAAGCTCACAAAAATTGACAGA TAATATCAAGACTAAGAAACCACCACAAGAAAAACAGGCACCTGTTAAAA AACTACCTGTCAAAAGGTCTCCAAAAGTATCACCTCCCAAGAGAGAAGCT GTAAAAGATTCACCACTGAAAGAAAATCCTTTTAGAAAATCTATCGTCCA AGCAAAGAGTAAACCAGTActgacaaaacagaaaaatttgaGTAAAGAGA ATATTGAAGAATTGAGCACAAGTGAGGAAAAAGATTCCCCAAAGAAGaca ttcaaattcaaagggaTCACATTTGATGCCAAGACTGAAGATGATGATAG CAGTGATTCTGATTCAGACAGCTCATCAAATTCTGATTcaggtatttttt atttcattaacTTATTTCTCTTTTACTACAATGCCTCTTTCTATAGTtcg attttttgtttatttgtgaCGTAACTTAAGCTGACTTGCCTGGCCCACGA TATCCATTAATATCCATCATTCACCATATATAGAGAACAATATTGAATAC TGTGATGTAATTTTGGTCACAAGCCAAGAGTAATGATGCCTTAGAGTTCC TATTGAAAgcctgaatttgaaaaaaacttaaaagcTTTCCAAAAGATTCT TGACAGGATTGATGTATGTCTTATACTGACCTACTGGCTTTGAGCCCTTT ACATTAAAGTTGTTCATTTCCTACAGGGTCGTCAAGTGATAGCAGTGACA ACAGTGGAacagaagaagaaattgaagataTTGAAGACGAAGACGATGAC GATACTGCATCTCAAACAAGTTCAGTTACAAGCTCTCCTGCAAAGAAAAC ACAAAGAGCTGGTCAAAAACGAAAAGCAGTTCCTGACAATGCAGAGGGTA ACAAAATCCTTGACATATTGCTTCTTCATCAAAAGAACTTTTAATCAAGA TTTCTgttacatttttaaaaaggttCCAAAAGctccaaaatcttcaaaaa gatCATTCCTACAAAAAGTGATTTTGGAAACTTTGGTAAATGTTGATCCT TCTATGTGAACagcaaatgaaatattttttttatttagaaccaatattat tttgacattagcatgtttttttttgcattctagTGATTGCCAGTTTGAAG AAACGAAAAGTTGTTGATTTGGATTTNATtagcatgtttttttttcattc tagtGATTGCCAGTTTGAAGAAACGAAAAGTTGTTGATTTGGATTTGATA AAAGCGCCATTAAAATTTgggtaaaaaatatttctcaatctTTTGATGGA TCTATCGTAGCTGAcagcatgttttttttttgtctgaaaGACAGTTTTTT ATCTCAATAAGATTCGATCGCTTGGGTCTTAAAATAAGTTACGTAATTTT CTCCCGTATTCTTCTTGTAGATGGAGAAGGCAGACAAGACTCAGACCGAA CAATGCTGGTGATGGGCTGAGGGGAGATGTTTATTATTATTCACCTTGTG GGAAAAAGCTGAGGACGTATCCTGAGTTAAACAGTGTAAGTTGGAACAAA TATATTTGTAGCAGACTAATATGAAGACTCCGTGATATTATGATATAAAG Caactacagtcaactctctctcttattcgaacttcttttatttgaatctt tctgtaattggAAGAAAAACactggtcccctcagctggcaaatcgcctaa aatgctctctctctgtaattcaaatctttctctttcaaagaaaattcttg gccccttaaaaatcgaattagagtgaGTTAACTATTGCTATTTAAAAGGT GGAAGCTGACAAGAGACAGCAACTTGCTATATCCATCTTGGAATACCTTA CCGTCTTTTTGAATAACCCTTTTTTACTTTCCAAAGGCTGGAGCAAATTA CGAATTTAGTAATATGATAATTTTGCAACATCATAAGGTGTTGTTTCAAT GCTCATTAAGataattaaatatattttttcagtACATCTTTCGAAATGAT GTCGTTGATGTAGACTTGAAGAATTTCAGCTTTTCAACCAAACTTCGTGT TGGCGAATTCATGCAGGCTAAGGATGTAAGTTAATACTGCTataaattac ataaattgtATAATAGCCTaagatttggccaatttttttcaacttggCAA AATAAAGTGGCTTGCTAAAAACCTAACCCTTTGCTCATGCATGCAGGTTT AAAAATAACATACAGGCACAAAAATTCTACAATCATTATTTCCAGCTATA TTAATGTGTCAAGATTCTTTTACAGGGTTCAAAGTTTGTGACACTGACTG AAGAAGAGATCGATGAAACATTTGTTATGATGGAAGAAAGGAGAAGTGCT TCTGCAAAAAGAGCTGaagaaaagaagagagaaaaacgTGAAAAGGAGGA GAAGCAACGTCAGATACTTGAGGAGAGAAAAAAGAAGAGAGAAGAAGCCT TGGAAAGAAAGAGATCGAAAGAAGAAGAAAGGAGAAAGGGTATGGAATTT CTCGTATTGGAAAATACAAATGTGACTTTGttacttttgtaattttttta ataatattatCTCCAGTTTTGTAGcattaaattatatttttaagttACCG ATCGGTAATGGCCTATGATTTGGGGACTAAGACCATAGTTGCAGATAGTC TATGACTTACTGATCCATCTTTATCATTACGGTTTCTTTTATAATTTATC TTTCTCATTCCACACGGTCTTCCATAGGTCCTTGCCCTGCACACAACTGT GAATGAAACAATGCACCTTACTATTTTAGTTCAAAAAGACAAAGCATTGG AAGCAAAGATGAAGAAGGAGAAAGAAAAGGAAGCAGCACAAGAAGCCAAA CGATTGAAAGGTACATCCTTAATGAAACTATTCTACTTCTCATAACCTTC AAAGTTTTATTCAACTGATAGTAGTTTGGCACATTAAAAGTTGTTCTAAC GATATTCATTTACATTTTTATGTTTCAGAGGAGGCAATAATGTTGAAGAA ACTAGAAAGGCAAGCTCAAATGGAAGCAAGTCGAATTGCCAAGCGTGAGA AAGTTCAAAATATGTTGGCTGAAAAGCAGAAGATGAAAGAACAAAGAGAA CATGTACTtctcaatttttataaattttatgaCCTTCAAATTACAAGACC CTTCATATCACTTATTTCCTTAGTTAGTACCTGTTTCTAAGTTCCTTTGA ACATTTTATAAATACTAAAATCAGAAAAGGTATTCTCCTAATGAAACGAA TCGATGGACTCATTATTGGTCATGTTTTCTAGGAACGAGTCATGAAGATT GAGAACCAAAAAGTGgagaaagaaatgaaattacAAGCAATCGAAAATGT AAGTTCATCATAATCAATACAACAAATCGATCACTTTGGTACCGCCATCA AAACTTAGTTTAAAATTgaagttttgataaaattaaacTGCTGCTCCCAT TGCATGATACCCTATTCACCAATCCGAATTTGCATTACAAGCATCTTCTA ACAAATAAGTCCTACCATTTTCctaccatttttcattttaggaGAAGGAA CGTAAAAGGCTGCAACAAGTGAAAAGTAAAGTATCAGAAAAAGAAAAGCG AAAACGAGAGCTGGTCATGATGAAAGCTTATGAAGCACAACGGAGAGCTG AGGTATAAATTTGCAAATTGATAGGTATAATTGAATGGATTTTTGAGTTT GGATATAGATCCTGTAAACTTATTATTATATGTACGTATAATACGTGAAG TATTAGCTTCTTCAACTTCTGTCGTATTTTGGCTGTCAAAACTTGCATTC AATTTTGAATCTTACTTCATACTTGAATAAACATGTACAATTCAGTATTG TATGAATTGCTAAATTGGAATACACTCCACTGTGTAATTCGTTCATATCT CATTACAGGAGAGAGAACGCCTCAAAGAACAAAAGAAGCTGGAGAAAACC TTGATCAGGCAACGAAAATTGGAACAGAAAAGATATGAGCGCATGATCtc taaagaattgaaaaaacctATCGATGATATGGCTCTGAATGATTTGAAGC CGTTGCCAGAGTTACCAAGGGTAACCAACATCAACATTCCTGGCAAAGCA TATGCAGATATCCTGATGGTTCAAGAGTTTGTTCACGCCTTTGGTCATGT CATTGATATCGGTAAGAACTTTTCATGCTGACAAATCTTTCTTACCACCA TAATACTGAACTAATCATGATAACTGCTATAACTCCGCTATTATTGATGT CAGTCCATTATTTTATATTCTTAGATCCAGAGAAGGAGTTTCCAAGCATG GGAGAGTTGCAATCATCATTGTTGTGTGAATCTGGTAGCGATGAAGCAAT CTTCACTGCATGCCAAGCACTTCTTTTTTACGCCCTCTACGATCCCGGTG TATCTGGGCCTTATGTATGTTTATCTTGCTTGAAACTGTTTTGTGTTAAC TAGGCCTATCGGTTATACAAAACTGATAAAGATCATTAAGTATTTCCTGA CAAGTTTTGATCGGGTAAATTGTGTTTATTTGATTTAATAAGTTTAATAA GTTAATAATTTATTAAGTACTCCTGTTCTCCTGTACTTTGTCTCGCGCAC TAGTTTTATTATATCATTTAAGTCAATCACGCTTTCTAATTATTTAACCG ACTCCCTTATAAAACGAAACTcatctttaaaatgtttttgtttcagGCCA AAACTTCACTGGGTTCAGACCTTACGAGTATCGAATTGAACGAGAACAAC ATATCAGAAGTATTACGTCTTTTCATCTTATCACGTAATGAAGGAAAACA ACACACACTCAGTGATCAGCTCACCAAATATCCTTTAGAAGCTCTCTCAC CCAGTAGTAAAGCTGCTGTTCTAGCTTTCATTGTCAACGAACTGCTTTGT GGAAAATCAGTTAGCAGGTTTGGACCCATTCCTCCAAAGAAaggattttt ttactttaaattttgatcatgactttcatcaattttcaaggtttttctgT AGCGAAACAAATACTTGCTTTCTAGTAGAATGTAGTAGGTAGAATCTTTC ACTTTCTCAATGAAGCCGTCCCAGATTTGTAATTTTGCAGATGTAATTTT TCGGTCAGTATATTTTTCGTCAACTTTTAATAAAACCACCTGTGTTCTGT AGTATGCTACACTAAGAAgtctaaaaaaatcatttttatgtTCTTTAGAG AGATTGACGGTAGCTTggagaacatttcaaatatgCGAAGGGATAAATGG AACCTGGAAGGAGATATACGGAAGTAAGTTTCTTTGCCCTTATTTCATTC AACAATATCCCGCTTTAAAACTTGCCCCATAATATAAAGTATCAATTGAT TCATAAACTCAATTAGGCTGTGAATTATTTGAAAAAGACGGAGGTATTAT TAGATACCTGAGAATTGATGTTTTTcatgtttactttttttagaTTGAAA GCTGATCTATTATCAAAGCAACCCAAGAAAGCAGCCAGTGATCAACAACA GAAcctaaaaaacaacaaaggaGAGTCGAAGAAAAGAGACTCTGACGAGG AGAACAATTCGGACGATGAAGGAACCACTATCACCACTGCTAAGGAGAGC AATATCGATTTAAACGACACTGCGGAAGACACAGAAGCTGAAAACCAGCC AGAGGTTTGATTGCACTCCAAACAGACATTTTTATACAATCCACCCTATG TCTTCTTGAGCGAAAGTTTGATCCAATTGGTCAGGCTCAGATGTTTAGAC TACAATGTTTAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNC CCCGTCtgtgctatttttagaatttttttttcatatttttcattgttAAT AGTTTTACTAccattgtggaaagtttcattgacaTATCTTAGATATTTCT aaagttattacaaaaaaagtaataaaatgactttttccatttctcagTTT TAACTACCACCTTAACCGACTCCCTTATAAAACGAAACTcatctttaaaa tgtttttgtttcagGCCAAAACTTCACTGGGTTCAGACCTTACGAGTATC GAATTGAACGAGAACAACATATCAGAAGTATTACGTCTTTTCATCATGTC ACGGAATGAAGGAAAACAACACACACTCAGTGATCAGCTCACCAAATATC CTTTAGAAGCTCTCTCACCCAGTAGTAAAGCTTCTGTTCTAGCTTTCATT GTCAACGAACTGCTTTGTGGAAAATCAGTTAGCAGGTTTGGACCCATTCC TCCAAAGAAAggattttttactttaaattttgatcatgactttcatcaat tttcaaggtttttctgTAGCGAAACAAATACTTGCTTTCTAGTAGAATGT AGTAGGTAGAATCTTTCACTTTCTCAATGAAGCCGTCCCAGATTTGTGAT TTTGCAGATGTAATTTTTCGGTCAGTATATTTTTCGTCAACTTTTAATAA ACCCACCTGTGTTCTGTAGTATGCTACACTAAGAAgtctaaaaaaatcat ttttatgtTCTTTAGAGAGATTGACGGTAGCTTggagaacatttcaaata tgCGAAGGGATAAATGGAACCTGGAAGGAGATATACGGAAGTAAGTTTCT TTGCCCTTATTTCATTCAACAATATCCCGCTTTAAAACTTGCCCCATAAT ATAAAGTATCAATTGATTCATAAACTCAATTAGGCTGTGAATTATTTGAA AAAGACGGAGGTATTATTAGATACCTGAGAATTGATGTTTTTcatgttta ctttttttagaTTGAAAGCTGATCTATTATCAAAGCAACCCAAGAAAGCA GCCAGTGATCAACAACAGAAcctaaaaaacaacaaaggaGAGTCGAAGAA AAGAGACTCTGACGAGGAGAACAATTCGGACGATGAAGGAACCACTATCA CCACTGCTAAGGAGAGCAATATCGATTTAAACGACACTGCGGAAGACACA GAAGCTGAAAACCAGCCAGAGGTTTGATTGCACTCCAAACAGACATTTTT ATACAATCCACCCTATGTCTTCTTGAGCGAAAGTTTGATCCAATTGGTCA GGCTCAGATGTTTAGACTACAatgtttaaacttttttcagttAGGTTATG CTTCAACTTTTGAGATGACTGAAGAAAGCTTAATTCGTTAGTGTTACATT CGAATACCTGATATCATGATTATAAATTTTCTAAGAGGTTGTAGTTACAT ATTTCCTTAAGGATACTGttgagaatttttcattttcttctccgTCTAGA TGGTGAATCCTACTACACTCGACCAAATGGAGAAGAAACTACGTTTGATG GAAAAGGCGAGTTCTGTTCTCTTTCTTTAACAACAACACTGGAAATGTTC AATCTCACAAAGCAAGATTTTTGTTAGGAAGCCTTAATTTTTCTAGTTTT CGAGAGATAATGTAGTGCTAGTGGCGATTTCGGCAAGCCTTAGTTTTAAT TCTTTCgtccttaaattttttttcatacacTAGTTCCTTTTGTTATTAAA TTTACTCTTAGAACTAGATACTAATCTGTTTATTAAGCTCCAcaacgttt ttttttctctttctccagAAACACGCTCGCTACCGTAAAAAGTTGTTCGA TTCTTCACACACGATACGTGGTATAAATTTGGGTCAAGATCGATACCGGC GCCGTTATTTCGTGCTTCCGAACGCCGGAGGGATTTACGTCGAAGGGCTG GAAAGTGGATTTTTTGACGAAGAAACGAACGTGAAAACAAAGGAAGAAAA GGAAGAATGCAAAGAACATTTAGATAGTTTACTGACCACCTTGAAATCTC CAACTGTGTTGAAATCCCCTGTGACTGGCCCCAAAACACCGGCCACAAAT ACACCGTCTGTATCAGCATTATCCTCAAATTCAAACGAACTTTTAAAACC GAAACAAGAGAGTCCTATAcaaacacaacaacaacaaaaacagataaaag tTGAGAATCCTTGTTCAAGTGATAGTAGTTATGTCAAATCTTGGTTTTCC TTACGGACTAAAAAACGTTGCGAGTCTTACAAAACTTCAGCTATACGTGA AACGCCTAAAGAGCGCAAACATTCGCTCATCGTTGCACCGAGGATAGAAC GACTTGCCGACGACCACCAATTCTTAGAATCTATATACTCTTGTTATTCC ACTACTTCTCCTGGTGGGAAAAACACTTTATTACCTGTCAGCAGATTTCC CTTATCCAAGGAAAGTATGCATCGGAACTCGTTACTAGGCTTACCGGCTG AATTGGATATGAATTTACTTATACAACAAGACCCACAAAAAGCAGCGGAA ATTCTTGAAATACAGACTGCCAAGCCTCAAGAAATTCCGCCTGAAATGCA GGCGGGTTGGTGGCGGATCACCGATCCAGAACAAATGCAGCGCCTGAACA AGTGCGCCCACGCCAGGTAACGACAGCTCtctgtcaaattttcaagataC TGGCTGAATACCATTTCTACTTAAATGAGATCAGAAAAGCTTTTGTTTCG TTcttttcttaaaggttttgttttttagataagagtgatattgtttgctt actcattaattttaatttacaagctttttgatattaaattgacacggatg tggagcaagattagtcagaaaaagtaaaagaaaattttttatatcAGCAT GTTATTCGAGATGTTATTACTCTATTTTTCCGATATTTTAGGGGTATGAG AGAACGGAACCTTCAAAAGACGGTGGTGCGATTCCAAGACTACACCAACT CATCGTGTAAAGTTGACCATCTTGCATGTAGGTTTATGTCTTTGAATTTT ACCATCAAGGAAGCCCGAGTGGTATTCTTAGTATCTTTTTGATGATATTT CAGTCGAATTTAATTTAGAACAAGTGCGCTTCAAAGCTGTTATTAATTGT agacatagtgtcctccccccccccctttataaagggggggggggggtttN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAGATTTACGT GTGGGAAATAGGTAACTTGGGAGTTTTAGAAAGCGCGCTTATTTCATTCA CTAAAGTCtctaaaacattttattttcagtttctcTACTTCTCCCCGACG AAGAAAGTGAAAGCAAAGACAAAGTAACAGAAGACGACAGCAGCGTTGCC ACATCAACGGATACAAACAAATCGATACAAGATAAATGGTATCCACAGCT GGCGTATGCAAGTGACAAAGCCATTTTGATTGAAGTCGAAGAATTAGAGG AAAAGGTCTTCTCGGCTAGTTTGCAAGTCAAGGTTAGAAAAGTGTTTTTT ACAAGTCATGTATTTAAGGCGGGGCGCATGGTTATCCTACTTGGACATGC TGATTAATAACATTTTCAATCaacttttcaagttttatttttgacgtTTT CGAATCTGCTAGACTGGTTATAACGTAGTAACATACGTTAAAGAGCCTCT TTCATTTGAAATCTTCTATTTTGAATTCTTTACAATCTTGCTAACAGGGC TGGCGTTTGTCTCAAAAGATCTCTCCAGCACTTCTGCTGAGCACGAGTAA CGATCAAGCTGAGTATGATCCACCCGAAGATAAATATCCCATCAGGATAG CGGCTTCCCGTCTCCTAGCTCTTGAGCTCGGTATCGAACGACGTTACATG AAGCCTCCATTCCGTACACCAGACAGCCTTCCTAAACCGGACGCCCCAGA GGCTAAAGAAGAACCAGTCAAGAATCCAAAAGCAACAGCCCAACTGGAGA AATGGCGTGAAGCAGTAAGCGAAGCAAAATCGTCAGCTCAGCTATCGATG TGTATCACAGCACTCTTCGAATGTGTCGCTTGGGAGAAGTCCATCATGAA AGTGGTGAGAGGATAATGAACATGCTCTTCCTTATTAGAgagaaacacaa aaaaaaaacttggttTGTTTCCAAGCGTGGATTTGTTTTCATTACTGTAG CATTGATGGGTAAAGTTTAATTTTATTCATCGATGATAAAGTAATGATGA CGACTTAATAACACACTCAGAACACTTCAAGCTTTTATATCTCGAATTGA CTTTAGAATAAACAGTTTAATATTCTCTATATGTAGGCAAAACTGAATAT ACTCGACCGAATGTAATATGTTAAAGATGTGTATTGCCTTCGCAGTAAAA GATCTAGTTTCAGACTATTGTTTTATTATCTCTTAGTTCTGCATACTATG TCGTAAAAGTGACAACGAAGAAAGATTGTTGCTATGCGACGCATGTGATC GAGGCTGTCATACGTATTGTTGTAAGGTAAGTTACCTACCGTATTCTGAA TTTTTCGAAATTGCAACGATAGACCCTTTTTGAGTTCTCTTCAATTATAA GATCAGTTTatcatcttctttttttctctattttcagCCGAAATTCGATA AGATTCCCGATGGTGACTGGTTTTGTCAAGATTGTGTGTTGATGGTATGT GTATAGCGACATTTATTTTCTGTCATCCTTCACAGATATTCAAAAAACCT TACCTGATTTCATATGATTTGGTTGCAATGCATAAGACAACCCCCGACAT CTGTCTCACCGTAATCTGTATTGAAACTTTACATCAGTACCatttcataa aatataaaagACTAAAGAATCTAATTACCATCAAAATTAATGCTTTTCTG AGGACTTACTCAATGTAGGTAGCGGAAacttaaaatgtttaaaatcttGT CTGAATTAGATTgccattttgaagaatatttgcATGTGATAATACTTAAT GATATTTCTTTTACTTCAGGCGTCTGGTAGTGATCAGTGCTACAAATGTA AATCGAAGACCGGACGACGTCTGAAATGTGCATTCTGTCCACGTCATTAT CACATGGACTGCCTTGAACCACCATTACACAAGTATGATTTCTTTCTTAA CACTCTCTAAATGGTTGAGATTTTCGGATATTTACACACGTGACTCATTC CAATAACATTTCTTTTCGATAAAGGTTACCAAGTAATAATTTTAACTgtt aatttcaatttcacaTGTTTTGCCTTTTTCACATTCTCAAAAGTCCTtga aaggggtacaaaaaccattaaaaaggaTTTGAGTTtctgtaagggttcca aaattacgaaaataaaaaatcagctccctcaaagggtcataaattcttga aacttgaactaaaattggaaaaatttggctgaaattttggggaaatagtT TCTCTAAGTGGGTCAAAAACGTGGAAATTCAGTCTCGCTAAGGTCCGCTT TATACCTGTCAAACCTCGTACCCCCTCCCCGGATCAGCGTTTAGCATTTT TTAGCATTATTAGGGATAAACTACAATATCGTATaatctttttcgataaa attttcaaacagaACACCTCGTTCGCCTTGGAGTTGTCCCGTCTGCAAGA AAACACGCTCCAAGAGTAAACCTCCTCAACGTAAAAAACCACGCGCCGAA GAACTTCTCAAGAAAGAGGAACAGAGCAAACAAAAATCCATGTCCAACAG CCGTGTGCAGACGTCCAAAGACATGGAACCGTGTCGTTTCATATTGAACG AAATGGAAAATCACGAATCGTCATGGCCCTTTCTCGTCCCTGTCAATATG AAGCAGGTAAGTGAGTCTGGGGGATGTTTTTGGGTAAGATTCTTCTGAAT CATGTGGGTGACATTAATGGAGTAGTCTTGATTTAGATCACCAAATCAAC AGAACCAACCCGAGGAGGAAAAAAACACATTTAGGAGAAAAAGTGGATCA TAGTTCCAGGGCCAACAAAACTGAATAGATCACAATTGAATGTCTGTAAA TACTAGACTAGCACTGGTATCTTTGCTTTTACTTCTACCGTTATTTAGCA TACTTTTCATCGtatttttttgttgttctttGTTTTTCAGTTTCCAGAGT ATTATAAAGTGATCAAGCATCCGATGGATTTCCATACCATGAAAACGAAG CTGCGTGATTACCAGTAAGCTAGTAATTTTTGTACCGTGCCTAATCAGTT GTATATGAATTTTCAAAGTGGAGGTGGGAGGGGTTGAAAAGCCATTGAAA ATGTGATTCAACGCCGAATGCAATTAAGGTGCATTAAGATAATTGAATTC TATGAACCATGTGTGCAAATACAACTTTCATTGtgtcattttaagttttt atcaCCTTGTCCATTGCAATGATGCCGATTAAAATCTGTTTCTCAAATTC GATATATTATTAGTGCAAAGGTATTTTACATTCTTTTTCATCAGATACAA GTCAAAAGAAGAGTTCGCACGTGACGCGCGGTTGGTGTTTTTCAATTGTA AAACGTACAACGAAGACGAATCGGAGGTAATATCCCTTTCTTTGGTCGGT TGATCTAGTTGACAACATCTTATAAATGCAATTCAAGAATAGTTTCAATA TTTTGGTATTCATACCAATTAGGGACCCCCCTCTTATTCAGAAAATATAG GTTATCAAGTTGGTATCAATTCCAATTTTAGTGGTGGTGGTGTACACTAC TTTCTAATCTTGAATGTCATTTTTTCAGCCATGGGGCTGTTTTCCGGATC CTACGAGAAAACCCTTCCCTGTAAGAGGTGTCtatgttttccaaaaataa cCTCCCCACTTCCATATTGTTTGCTGTTTGAATTGTTTGATTTCGAAAAT TTGTGTCAGGTTGGATGTGCAGGTGAAGCGATGCGAagtttcttcgagaa acgttgGACCGCCCTCAAAAAGGGTGTCTCTTCCACAAACAGTGATAACA AATTCCACACCAACAAGAAGGGGGAGGGTGTGGAATCATCAGGCGATGAA GGAGAAGACGCTCAGGAGGAGGGTGAAGGCGATGAAGAAGTATCCAGTTC GAGTTCTGAAGAAATCTCATCCGAAAGTGAGAGCAGCGAAGTGGAGGAGG ACAGTGAAAACGAGACCGACTCAAAAACATGAGGTACTTCTTGGAGATGA AAAATGGCAGCAAACAGGTGTAAGTTGATGATTTGGATTTCGGACATCAC TTTACGAGAAAACTGCTGAAGAAAAAGATACTGAAAACTTCCTGCTTGTG AAGGGCTGCTTTAGGTGTTAGCCTCTTTCGATAGAAAACAAAGTTGCATA TGGGTAACGGTATCCAGATAGCGGTATTTAGGTAGGTTTATTCTGAGCCA AACAGATGATTTGAGAAATACATTTATAACCAAGAATGATTTTGAACTTA CAACTGCTAAATCAAATCGAATTTGCATGGGCATACTGCCTTCAAAGGTT CGATACCAAAAGAGATTTTAGTCCTATTTAGGCCGCCACGTTATATTTTG ATTGGATGCTGTATATATTAAATAGTTCAAACATGGGAGGcttattttat actttttgactCTCCCACGTGGGATATCTGGCTTGTAAGTCACTTGATTG GCATTAGTAGGCAACAAGACATTGCCTCCAAGGgacacatttttttaaag aaatgattttatatttttttactgCGATGCTAACGCAGTTGAAGTACGTT GTTAATAGctagtttttaagattttaaaataattttcttctttatgCGAT TTTAGAAGAGTATTTGATACATTTCAGACatctttttgataaaatgcCAC AGACAATTTATAGTGGGGCGAAGGTTTCTAAAATCTTTGCTTTATAGAAC AAATAAATGGGAATGGGAATGGCAAAGGAAATTTTTCATGGATAGGATAA TCTCTAccattgatttttctttgatattCTTCCCGGACACTAAGTTTACC ATGCACTCACATACATTCACTAATGGGTCCGTTCTCCCATCGTTCATCCG CTTTTCATATCAGGGAAATCTCATTTTGActgatgttgatattttttgag aatGTTCGACTCCCTCAACTTAactactttttttgattttcttttttttt ctcgttaACTTTAAAGGGGTatgtttttgattttacattgCTTGTACATT TTTTCTAATACAATTTCTAGGGCGAAGACTCGCTTTGACCTAAATTAGGA CTCCACTTAGCCATTAAATGGCTCTTAGTTAGTTTTACAAGTGACATTTG AACCGAATGATTGGAACGTCTATCAAAAAGTATTTGTGAACAGTTGTACT GTGCAATCGTTTCCCATCCCATCTTTGAAGTTTTCCTACTTTGATGCATT ATATTGatcattttcaagatttttcagTTAATTATCAtcttttatgtttt tgtttcctcTAATTattcaaatcattttttcatcttcaattttacaaaag aatGTTGTAATAATTTTTCGTCAGGATATATTTTTTGTTGTGAGAACCAT GTAGAACATTATTTCCATTTTTTGTCATGTTGATAGTTTTAATTTCTCCA TATACTTATAAttactttttgacgtttttacgACAGCTCCAACTATAAAT AACcagttcgaatgtttttatgaaaaaat

Coding sequence (CDS) from alignment at sc0000002:1572459..1593587+

>TCONS_00000499 ID=TCONS_00000499|Name=TCONS_00000499|organism=Clytia hemisphaerica|type=CDS|length=215964bp|location=Sequence derived from alignment at sc0000002:1572459..1593587+ (Clytia hemisphaerica)
ATGGACAATCGTTCCGGTGGTCAAGGCAACCCATATGATCGACCTTACTA
TGGGGACCCAAATGTCTTGAGACAACAAATTCCTGGGTATGCTAACTCTC
CTGGAATTTATCCATATTCCCAGCAGCAGCAACAAGATGGTTTTTCAGGG
CGACGACCAGGGCAAGACCAGCTTGGTCTCAATAATCATGCTACCGCCAG
AACCAACAGCTTGACTTCACCTCCACAATCAACCAATCCTTGGATGCACT
CTTACCACAATCAAACACAACCAAATTCTATGAGCCCTAATTTCAATATG
AACATACCGAATATGTTTCATACAAGGTGGGAACAAGACCAAGCCTCACT
TCTACAACAAAGAGAAATGATGCAAAGAGAAGAACATGCAAGGATGATGT
ATCGAGAGCGCTTGCAAATGCAAGAGAGAGAAAATCAGTTGAAAATCCAG
ATGCAGAAGGAGCAAGAGCGAGAGTTGCAACTTCAGCGTGAAAAAGAAGC
ACAACTTCAGCGTGAAAGGGAAGCAAAGGTTCAAAGAGAACGTGAAGCCC
AATTAGAAAGAGAGCGACAAGCTCAACTTCAAAGAGAACGACAAGCTGCT
CTGGAGAAAGAAAGACAGCTACAGTTGCAGAGGGAAAGAGAAGCTCAATT
ACAAAGAGAAGCTCAATTACAATATCAGATGCAAAGAGAAATGCAACTTG
AAAGAGAAAGAGAAGCAATGGCAATAAGAGAAAGAGATGCAATCCTTGAA
CGAGATAGAAAAGCAATGCTCTACAGAGATGCTTATTTTGCACAACAACA
TCAACCACAGCAATttccaaaccattttggttccaTGCAAAATACATTGC
CTAATTTGAATTTCACACAATCCAATGAGTCAATGTCTAATCAATTTAAC
TTCTATAACCAGCCCAGTATGCATTCAAATGGTAATCTTCCTAGCAGTAC
ATCGTCTTCTATACTAAACTTCTCAATGGATCAAATTTTCAACCCTAATA
AGATATCTGAGTCACCTGTCTCCAAAGCAGCAAGTACCAGTTCTTCCTTT
CACTTTCCAATCTCATCACCTTCCACCGTCAGCTCAACAACAACTTCATC
AACAACGACAACCACAACTGCTTTACGTAAAAGCTCATCTAACTCATTTG
ACAATGGAATTATAAATAGTATTGTTTCTGATAAGGGATTTTTAACCTCA
CCCTTGGACAGTAATAGTCAATTCATGAAAACATGGCAAGAACTACAGGA
TATGGATTTGagtgaaattgagaaaaatgtcCTTGGACCTAAAGATCAAG
ATTCCCGAAACACTCCATTAGCAGATACTCCATTTTCAAACCCTACTACA
CCAACAGAAATGAATGGGCTGCCACCAAAACCAATTGATTCTAACTTGAA
TAACATTGTTAATTCTCTACCTGAAAACTCTCTGGATTTAAATAAGCATT
ccattgaaacaaaagaatctttACAAATAACAAACACTGAAGATACACCA
CCACAACAGAATCTATTGAATCATCCAAGAAATTTATTATCAGTATCTCA
AACAGCTCAAGCTAGCTCCAATTATACAAACACCAGTGTAACGCAATCAG
ACATAAACTTGACACATGTATCAGAAAATTTACTTACCCATAATAGGTCT
TGCGTTTCTTCATTTGTTTCGCCTACGTCATCAGATTTGTATTGCAATCA
AGATTTTGATAAGCAATCAAAACGAGGAGATGATATCAAGCATGAAGAAT
ATTCTAATGAACTTCAAAGCAATCACTCAAAATCATATGAAAAACAATCA
TCATCTTCACCTAcaacattaaaacaaaaatcaaaacaatcatttAGTAG
TATTGAAAGTTTCCTTGGTATGAGCAGCGATAGTAAAAAAACTGAAGATA
ATGATAATGAAAGGATTAATGACACCACTAAAAAGCGAGAAAGGATCCCA
TCAAGTGATGTACAAGATCGAATTTCAGTCATAAAACCATTACCAATTTC
ATCACCACAAATTTCAAACACATCCTCTCCTTTGGATATTGTGAATAATG
ATCATGACACATTGAAAAGTCCACAAGCAATTGAAAAGCTGAAATCTcct
gaagaaattcaaaaagtaaTAGATCATTCTGAATCTGCACCTGTCACACT
CATCCATCCATCTATGCGCCTCAAAAAGCAAAGAAGTCTATCAAACAGTT
CAATGACTGCCACCAGTCCACAACCCGTTATGGAAaaggaaaaaccaaaa
acaagtAATAGACGACCGTTACATCCTTCTATGCGATTACAGACcaataa
aaataatacaaaagTTGATAAAGCTGAACCTAAAAAGAGTAAGGTTGAAA
ATCTTGATAACAGTTTTGACAGTGGAAAGAATATCTTACACAGTCCAAAA
ACTGGGCGTTATCAATCTGAACTTACAAGTACTTCCACCAAATCTTCAAC
TAGGAAGTTATCTCCGTTCACTCCTCCAACTGTTACATCACCTTTAACCT
CACCACCACTAGTATCACCTGGAATTCGAAGTCCCTTCAATGGAAAACCC
CTCACTGGAAAACCATTCTCAACTGGTAAGCCTGTTCATGGAGGAAAACC
AGCATCTTATTCAGCTCAAGGTGGTGGTAAACCAATGCATATGGGAGGGA
AACCGACTAGTTTCTCTTCACATATGACTGTCAAAGAGGAAAAGTCACCA
GAAAAAGAGCACACTGGCAAACCTTTATCTTTTTTGAAGTCCATGGTAga
agaatcttccaaaaacaCAAACACACTTCAAGGGAAAAAGATCACTGGCA
AGAAAAGACCCAGAAAGGAAACTATCGAGAAACCAGCttcaaaagaaact
ttaaaaaaagatgACATATCAAAATCCCCTGACTTGAAAACAAGTCGTAT
AACAAAAATGATATCAACCCCACCAAGCTCACAAAAATTGACAGATAATA
TCAAGACTAAGAAACCACCACAAGAAAAACAGGCACCTGTTAAAAAACTA
CCTGTCAAAAGGTCTCCAAAAGTATCACCTCCCAAGAGAGAAGCTGTAAA
AGATTCACCACTGAAAGAAAATCCTTTTAGAAAATCTATCGTCCAAGCAA
AGAGTAAACCAGTActgacaaaacagaaaaatttgaGTAAAGAGAATATT
GAAGAATTGAGCACAAGTGAGGAAAAAGATTCCCCAAAGAAGacattcaa
attcaaagggaTCACATTTGATGCCAAGACTGAAGATGATGATAGCAGTG
ATTCTGATTCAGACAGCTCATCAAATTCTGATTcagGGTCGTCAAGTGAT
AGCAGTGACAACAGTGGAacagaagaagaaattgaagataTTGAAGACGA
AGACGATGACGATACTGCATCTCAAACAAGTTCAGTTACAAGCTCTCCTG
CAAAGAAAACACAAAGAGCTGGTCAAAAACGAAAAGCAGTTCCTGACAAT
GCAGAGGtGATTGCCAGTTTGAAGAAACGAAAAGTTGTTGATTTGGATTT
GATAAAAGCGCCATTAAAATTTggATGGAGAAGGCAGACAAGACTCAGAC
CGAACAATGCTGGTGATGGGCTGAGGGGAGATGTTTATTATTATTCACCT
TGTGGGAAAAAGCTGAGGACGTATCCTGAGTTAAACAGTtACATCTTTCG
AAATGATGTCGTTGATGTAGACTTGAAGAATTTCAGCTTTTCAACCAAAC
TTCGTGTTGGCGAATTCATGCAGGCTAAGGATGGTTCAAAGTTTGTGACA
CTGACTGAAGAAGAGATCGATGAAACATTTGTTATGATGGAAGAAAGGAG
AAGTGCTTCTGCAAAAAGAGCTGaagaaaagaagagagaaaaacgTGAAA
AGGAGGAGAAGCAACGTCAGATACTTGAGGAGAGAAAAAAGAAGAGAGAA
GAAGCCTTGGAAAGAAAGAGATCGAAAGAAGAAGAAAGGAGAAAGGTTCA
AAAAGACAAAGCATTGGAAGCAAAGATGAAGAAGGAGAAAGAAAAGGAAG
CAGCACAAGAAGCCAAACGATTGAAAGAGGAGGCAATAATGTTGAAGAAA
CTAGAAAGGCAAGCTCAAATGGAAGCAAGTCGAATTGCCAAGCGTGAGAA
AGTTCAAAATATGTTGGCTGAAAAGCAGAAGATGAAAGAACAAAGAGAAC
ATGAACGAGTCATGAAGATTGAGAACCAAAAAGTGgagaaagaaatgaaa
ttacAAGCAATCGAAAATgaGAAGGAACGTAAAAGGCTGCAACAAGTGAA
AAGTAAAGTATCAGAAAAAGAAAAGCGAAAACGAGAGCTGGTCATGATGA
AAGCTTATGAAGCACAACGGAGAGCTGAGGAGAGAGAACGCCTCAAAGAA
CAAAAGAAGCTGGAGAAAACCTTGATCAGGCAACGAAAATTGGAACAGAA
AAGATATGAGCGCATGATCtctaaagaattgaaaaaacctATCGATGATA
TGGCTCTGAATGATTTGAAGCCGTTGCCAGAGTTACCAAGGGTAACCAAC
ATCAACATTCCTGGCAAAGCATATGCAGATATCCTGATGGTTCAAGAGTT
TGTTCACGCCTTTGGTCATGTCATTGATATCGATCCAGAGAAGGAGTTTC
CAAGCATGGGAGAGTTGCAATCATCATTGTTGTGTGAATCTGGTAGCGAT
GAAGCAATCTTCACTGCATGCCAAGCACTTCTTTTTTACGCCCTCTACGA
TCCCGGTGTATCTGGGCCTTATGCCAAAACTTCACTGGGTTCAGACCTTA
CGAGTATCGAATTGAACGAGAACAACATATCAGAAGTATTACGTCTTTTC
ATCTTATCACGTAATGAAGGAAAACAACACACACTCAGTGATCAGCTCAC
CAAATATCCTTTAGAAGCTCTCTCACCCAGTAGTAAAGCTGCTGTTCTAG
CTTTCATTGTCAACGAACTGCTTTGTGGAAAATCAGTTAGCAGAGAGATT
GACGGTAGCTTggagaacatttcaaatatgCGAAGGGATAAATGGAACCT
GGAAGGAGATATACGGAAaTTGAAAGCTGATCTATTATCAAAGCAACCCA
AGAAAGCAGCCAGTGATCAACAACAGAAcctaaaaaacaacaaaggaGAG
TCGAAGAAAAGAGACTCTGACGAGGAGAACAATTCGGACGATGAAGGAAC
CACTATCACCACTGCTAAGGAGAGCAATATCGATTTAAACGACACTGCGG
AAGACACAGAAGCTGAAAACCAGCCAGAGATGGTGAATCCTACTACACTC
GACCAAATGGAGAAGAAACTACGTTTGATGGAAAAGAAACACGCTCGCTA
CCGTAAAAAGTTGTTCGATTCTTCACACACGATACGTGGTATAAATTTGG
GTCAAGATCGATACCGGCGCCGTTATTTCGTGCTTCCGAACGCCGGAGGG
ATTTACGTCGAAGGGCTGGAAAGTGGATTTTTTGACGAAGAAACGAACGT
GAAAACAAAGGAAGAAAAGGAAGAATGCAAAGAACATTTAGATAGTTTAC
TGACCACCTTGAAATCTCCAACTGTGTTGAAATCCCCTGTGACTGGCCCC
AAAACACCGGCCACAAATACACCGTCTGTATCAGCATTATCCTCAAATTC
AAACGAACTTTTAAAACCGAAACAAGAGAGTCCTATAcaaacacaacaac
aacaaaaacagataaaagtTGAGAATCCTTGTTCAAGTGATAGTAGTTAT
GTCAAATCTTGGTTTTCCTTACGGACTAAAAAACGTTGCGAGTCTTACAA
AACTTCAGCTATACGTGAAACGCCTAAAGAGCGCAAACATTCGCTCATCG
TTGCACCGAGGATAGAACGACTTGCCGACGACCACCAATTCTTAGAATCT
ATATACTCTTGTTATTCCACTACTTCTCCTGGTGGGAAAAACACTTTATT
ACCTGTCAGCAGATTTCCCTTATCCAAGGAAAGTATGCATCGGAACTCGT
TACTAGGCTTACCGGCTGAATTGGATATGAATTTACTTATACAACAAGAC
CCACAAAAAGCAGCGGAAATTCTTGAAATACAGACTGCCAAGCCTCAAGA
AATTCCGCCTGAAATGCAGGCGGGTTGGTGGCGGATCACCGATCCAGAAC
AAATGCAGCGCCTGAACAAGTGCGCCCACGCCAGGGGTATGAGAGAACGG
AACCTTCAAAAGACGGTGGTGCGATTCCAAGACTACACCAACTCATCGTG
TAAAGTTGACCATCTTGCATtttctcTACTTCTCCCCGACGAAGAAAGTG
AAAGCAAAGACAAAGTAACAGAAGACGACAGCAGCGTTGCCACATCAACG
GATACAAACAAATCGATACAAGATAAATGGTATCCACAGCTGGCGTATGC
AAGTGACAAAGCCATTTTGATTGAAGTCGAAGAATTAGAGGAAAAGGTCT
TCTCGGCTAGTTTGCAAGTCAAGGGCTGGCGTTTGTCTCAAAAGATCTCT
CCAGCACTTCTGCTGAGCACGAGTAACGATCAAGCTGAGTATGATCCACC
CGAAGATAAATATCCCATCAGGATAGCGGCTTCCCGTCTCCTAGCTCTTG
AGCTCGGTATCGAACGACGTTACATGAAGCCTCCATTCCGTACACCAGAC
AGCCTTCCTAAACCGGACGCCCCAGAGGCTAAAGAAGAACCAGTCAAGAA
TCCAAAAGCAACAGCCCAACTGGAGAAATGGCGTGAAGCAGTAAGCGAAG
CAAAATCGTCAGCTCAGCTATCGATGTGTATCACAGCACTCTTCGAATGT
GTCGCTTGGGAGAAGTCCATCATGAAAGTGTTCTGCATACTATGTCGTAA
AAGTGACAACGAAGAAAGATTGTTGCTATGCGACGCATGTGATCGAGGCT
GTCATACGTATTGTTGTAAGCCGAAATTCGATAAGATTCCCGATGGTGAC
TGGTTTTGTCAAGATTGTGTGTTGATGGCGTCTGGTAGTGATCAGTGCTA
CAAATGTAAATCGAAGACCGGACGACGTCTGAAATGTGCATTCTGTCCAC
GTCATTATCACATGGACTGCCTTGAACCACCATTACACAAaACACCTCGT
TCGCCTTGGAGTTGTCCCGTCTGCAAGAAAACACGCTCCAAGAGTAAACC
TCCTCAACGTAAAAAACCACGCGCCGAAGAACTTCTCAAGAAAGAGGAAC
AGAGCAAACAAAAATCCATGTCCAACAGCCGTGTGCAGACGTCCAAAGAC
ATGGAACCGTGTCGTTTCATATTGAACGAAATGGAAAATCACGAATCGTC
ATGGCCCTTTCTCGTCCCTGTCAATATGAAGCAGTTTCCAGAGTATTATA
AAGTGATCAAGCATCCGATGGATTTCCATACCATGAAAACGAAGCTGCGT
GATTACCAATACAAGTCAAAAGAAGAGTTCGCACGTGACGCGCGGTTGGT
GTTTTTCAATTGTAAAACGTACAACGAAGACGAATCGGAGGTTGGATGTG
CAGGTGAAGCGATGCGAagtttcttcgagaaacgttgGACCGCCCTCAAA
AAGGGTGTCTCTTCCACAAACAGTGATAACAAATTCCACACCAACAAGAA
GGGGGAGGGTGTGGAATCATCAGGCGATGAAGGAGAAGACGCTCAGGAGG
AGGGTGAAGGCGATGAAGAAGTATCCAGTTCGAGTTCTGAAGAAATCTCA
TCCGAAAGTGAGAGCAGCGAAGTGGAGGAGGACAGTGAAAACGAGACCGA
CTCAAAAACATGAATGGACAATCGTTCCGGTGGTCAAGGCAACCCATATG
ATCGACCTTACTATGGGGACCCAAATGTCTTGAGACAACAAATTCCTGGG
TATGCTAACTCTCCTGGAATTTATCCATATTCCCAGCAGCAGCAACAAGA
TGGTTTTTCAGGGCGACGACCAGGGCAAGACCAGCTTGGTCTCAATAATC
ATGCTACCGCCAGAACCAACAGCTTGACTTCACCTCCACAATCAACCAAT
CCTTGGATGCACTCTTACCACAATCAAACACAACCAAATTCTATGAGCCC
TAATTTCAATATGAACATACCGAATATGTTTCATACAAGGTGGGAACAAG
ACCAAGCCTCACTTCTACAACAAAGAGAAATGATGCAAAGAGAAGAACAT
GCAAGGATGATGTATCGAGAGCGCTTGCAAATGCAAGAGAGAGAAAATCA
GTTGAAAATCCAGATGCAGAAGGAGCAAGAGCGAGAGTTGCAACTTCAGC
GTGAAAAAGAAGCACAACTTCAGCGTGAAAGGGAAGCAAAGGTTCAAAGA
GAACGTGAAGCCCAATTAGAAAGAGAGCGACAAGCTCAACTTCAAAGAGA
ACGACAAGCTGCTCTGGAGAAAGAAAGACAGCTACAGTTGCAGAGGGAAA
GAGAAGCTCAATTACAAAGAGAAGCTCAATTACAATATCAGATGCAAAGA
GAAATGCAACTTGAAAGAGAAAGAGAAGCAATGGCAATAAGAGAAAGAGA
TGCAATCCTTGAACGAGATAGAAAAGCAATGCTCTACAGAGATGCTTATT
TTGCACAACAACATCAACCACAGCAATttccaaaccattttggttccaTG
CAAAATACATTGCCTAATTTGAATTTCACACAATCCAATGAGTCAATGTC
TAATCAATTTAACTTCTATAACCAGCCCAGTATGCATTCAAATGGTAATC
TTCCTAGCAGTACATCGTCTTCTATACTAAACTTCTCAATGGATCAAATT
TTCAACCCTAATAAGATATCTGAGTCACCTGTCTCCAAAGCAGCAAGTAC
CAGTTCTTCCTTTCACTTTCCAATCTCATCACCTTCCACCGTCAGCTCAA
CAACAACTTCATCAACAACGACAACCACAACTGCTTTACGTAAAAGCTCA
TCTAACTCATTTGACAATGGAATTATAAATAGTATTGTTTCTGATAAGGG
ATTTTTAACCTCACCCTTGGACAGTAATAGTCAATTCATGAAAACATGGC
AAGAACTACAGGATATGGATTTGagtgaaattgagaaaaatgtcCTTGGA
CCTAAAGATCAAGATTCCCGAAACACTCCATTAGCAGATACTCCATTTTC
AAACCCTACTACACCAACAGAAATGAATGGGCTGCCACCAAAACCAATTG
ATTCTAACTTGAATAACATTGTTAATTCTCTACCTGAAAACTCTCTGGAT
TTAAATAAGCATTccattgaaacaaaagaatctttACAAATAACAAACAC
TGAAGATACACCACCACAACAGAATCTATTGAATCATCCAAGAAATTTAT
TATCAGTATCTCAAACAGCTCAAGCTAGCTCCAATTATACAAACACCAGT
GTAACGCAATCAGACATAAACTTGACACATGTATCAGAAAATTTACTTAC
CCATAATAGGTCTTGCGTTTCTTCATTTGTTTCGCCTACGTCATCAGATT
TGTATTGCAATCAAGATTTTGATAAGCAATCAAAACGAGGAGATGATATC
AAGCATGAAGAATATTCTAATGAACTTCAAAGCAATCACTCAAAATCATA
TGAAAAACAATCATCATCTTCACCTAcaacattaaaacaaaaatcaaaac
aatcatttAGTAGTATTGAAAGTTTCCTTGGTATGAGCAGCGATAGTAAA
AAAACTGAAGATAATGATAATGAAAGGATTAATGACACCACTAAAAAGCG
AGAAAGGATCCCATCAAGTGATGTACAAGATCGAATTTCAGTCATAAAAC
CATTACCAATTTCATCACCACAAATTTCAAACACATCCTCTCCTTTGGAT
ATTGTGAATAATGATCATGACACATTGAAAAGTCCACAAGCAATTGAAAA
GCTGAAATCTcctgaagaaattcaaaaagtaaTAGATCATTCTGAATCTG
CACCTGTCACACTCATCCATCCATCTATGCGCCTCAAAAAGCAAAGAAGT
CTATCAAACAGTTCAATGACTGCCACCAGTCCACAACCCGTTATGGAAaa
ggaaaaaccaaaaacaagtAATAGACGACCGTTACATCCTTCTATGCGAT
TACAGACcaataaaaataatacaaaagTTGATAAAGCTGAACCTAAAAAG
AGTAAGGTTGAAAATCTTGATAACAGTTTTGACAGTGGAAAGAATATCTT
ACACAGTCCAAAAACTGGGCGTTATCAATCTGAACTTACAAGTACTTCCA
CCAAATCTTCAACTAGGAAGTTATCTCCGTTCACTCCTCCAACTGTTACA
TCACCTTTAACCTCACCACCACTAGTATCACCTGGAATTCGAAGTCCCTT
CAATGGAAAACCCCTCACTGGAAAACCATTCTCAACTGGTAAGCCTGTTC
ATGGAGGAAAACCAGCATCTTATTCAGCTCAAGGTGGTGGTAAACCAATG
CATATGGGAGGGAAACCGACTAGTTTCTCTTCACATATGACTGTCAAAGA
GGAAAAGTCACCAGAAAAAGAGCACACTGGCAAACCTTTATCTTTTTTGA
AGTCCATGGTAgaagaatcttccaaaaacaCAAACACACTTCAAGGGAAA
AAGATCACTGGCAAGAAAAGACCCAGAAAGGAAACTATCGAGAAACCAGC
ttcaaaagaaactttaaaaaaagatgACATATCAAAATCCCCTGACTTGA
AAACAAGTCGTATAACAAAAATGATATCAACCCCACCAAGCTCACAAAAA
TTGACAGATAATATCAAGACTAAGAAACCACCACAAGAAAAACAGGCACC
TGTTAAAAAACTACCTGTCAAAAGGTCTCCAAAAGTATCACCTCCCAAGA
GAGAAGCTGTAAAAGATTCACCACTGAAAGAAAATCCTTTTAGAAAATCT
ATCGTCCAAGCAAAGAGTAAACCAGTActgacaaaacagaaaaatttgaG
TAAAGAGAATATTGAAGAATTGAGCACAAGTGAGGAAAAAGATTCCCCAA
AGAAGacattcaaattcaaagggaTCACATTTGATGCCAAGACTGAAGAT
GATGATAGCAGTGATTCTGATTCAGACAGCTCATCAAATTCTGATTcagG
GTCGTCAAGTGATAGCAGTGACAACAGTGGAacagaagaagaaattgaag
ataTTGAAGACGAAGACGATGACGATACTGCATCTCAAACAAGTTCAGTT
ACAAGCTCTCCTGCAAAGAAAACACAAAGAGCTGGTCAAAAACGAAAAGC
AGTTCCTGACAATGCAGAGGtGATTGCCAGTTTGAAGAAACGAAAAGTTG
TTGATTTGGATTTGATAAAAGCGCCATTAAAATTTggATGGAGAAGGCAG
ACAAGACTCAGACCGAACAATGCTGGTGATGGGCTGAGGGGAGATGTTTA
TTATTATTCACCTTGTGGGAAAAAGCTGAGGACGTATCCTGAGTTAAACA
GTtACATCTTTCGAAATGATGTCGTTGATGTAGACTTGAAGAATTTCAGC
TTTTCAACCAAACTTCGTGTTGGCGAATTCATGCAGGCTAAGGATGGTTC
AAAGTTTGTGACACTGACTGAAGAAGAGATCGATGAAACATTTGTTATGA
TGGAAGAAAGGAGAAGTGCTTCTGCAAAAAGAGCTGaagaaaagaagaga
gaaaaacgTGAAAAGGAGGAGAAGCAACGTCAGATACTTGAGGAGAGAAA
AAAGAAGAGAGAAGAAGCCTTGGAAAGAAAGAGATCGAAAGAAGAAGAAA
GGAGAAAGGTTCAAAAAGACAAAGCATTGGAAGCAAAGATGAAGAAGGAG
AAAGAAAAGGAAGCAGCACAAGAAGCCAAACGATTGAAAGAGGAGGCAAT
AATGTTGAAGAAACTAGAAAGGCAAGCTCAAATGGAAGCAAGTCGAATTG
CCAAGCGTGAGAAAGTTCAAAATATGTTGGCTGAAAAGCAGAAGATGAAA
GAACAAAGAGAACATGAACGAGTCATGAAGATTGAGAACCAAAAAGTGga
gaaagaaatgaaattacAAGCAATCGAAAATgaGAAGGAACGTAAAAGGC
TGCAACAAGTGAAAAGTAAAGTATCAGAAAAAGAAAAGCGAAAACGAGAG
CTGGTCATGATGAAAGCTTATGAAGCACAACGGAGAGCTGAGGAGAGAGA
ACGCCTCAAAGAACAAAAGAAGCTGGAGAAAACCTTGATCAGGCAACGAA
AATTGGAACAGAAAAGATATGAGCGCATGATCtctaaagaattgaaaaaa
cctATCGATGATATGGCTCTGAATGATTTGAAGCCGTTGCCAGAGTTACC
AAGGGTAACCAACATCAACATTCCTGGCAAAGCATATGCAGATATCCTGA
TGGTTCAAGAGTTTGTTCACGCCTTTGGTCATGTCATTGATATCGATCCA
GAGAAGGAGTTTCCAAGCATGGGAGAGTTGCAATCATCATTGTTGTGTGA
ATCTGGTAGCGATGAAGCAATCTTCACTGCATGCCAAGCACTTCTTTTTT
ACGCCCTCTACGATCCCGGTGTATCTGGGCCTTATGCCAAAACTTCACTG
GGTTCAGACCTTACGAGTATCGAATTGAACGAGAACAACATATCAGAAGT
ATTACGTCTTTTCATCTTATCACGTAATGAAGGAAAACAACACACACTCA
GTGATCAGCTCACCAAATATCCTTTAGAAGCTCTCTCACCCAGTAGTAAA
GCTGCTGTTCTAGCTTTCATTGTCAACGAACTGCTTTGTGGAAAATCAGT
TAGCAGAGAGATTGACGGTAGCTTggagaacatttcaaatatgCGAAGGG
ATAAATGGAACCTGGAAGGAGATATACGGAAaTTGAAAGCTGATCTATTA
TCAAAGCAACCCAAGAAAGCAGCCAGTGATCAACAACAGAAcctaaaaaa
caacaaaggaGAGTCGAAGAAAAGAGACTCTGACGAGGAGAACAATTCGG
ACGATGAAGGAACCACTATCACCACTGCTAAGGAGAGCAATATCGATTTA
AACGACACTGCGGAAGACACAGAAGCTGAAAACCAGCCAGAGATGGTGAA
TCCTACTACACTCGACCAAATGGAGAAGAAACTACGTTTGATGGAAAAGA
AACACGCTCGCTACCGTAAAAAGTTGTTCGATTCTTCACACACGATACGT
GGTATAAATTTGGGTCAAGATCGATACCGGCGCCGTTATTTCGTGCTTCC
GAACGCCGGAGGGATTTACGTCGAAGGGCTGGAAAGTGGATTTTTTGACG
AAGAAACGAACGTGAAAACAAAGGAAGAAAAGGAAGAATGCAAAGAACAT
TTAGATAGTTTACTGACCACCTTGAAATCTCCAACTGTGTTGAAATCCCC
TGTGACTGGCCCCAAAACACCGGCCACAAATACACCGTCTGTATCAGCAT
TATCCTCAAATTCAAACGAACTTTTAAAACCGAAACAAGAGAGTCCTATA
caaacacaacaacaacaaaaacagataaaagtTGAGAATCCTTGTTCAAG
TGATAGTAGTTATGTCAAATCTTGGTTTTCCTTACGGACTAAAAAACGTT
GCGAGTCTTACAAAACTTCAGCTATACGTGAAACGCCTAAAGAGCGCAAA
CATTCGCTCATCGTTGCACCGAGGATAGAACGACTTGCCGACGACCACCA
ATTCTTAGAATCTATATACTCTTGTTATTCCACTACTTCTCCTGGTGGGA
AAAACACTTTATTACCTGTCAGCAGATTTCCCTTATCCAAGGAAAGTATG
CATCGGAACTCGTTACTAGGCTTACCGGCTGAATTGGATATGAATTTACT
TATACAACAAGACCCACAAAAAGCAGCGGAAATTCTTGAAATACAGACTG
CCAAGCCTCAAGAAATTCCGCCTGAAATGCAGGCGGGTTGGTGGCGGATC
ACCGATCCAGAACAAATGCAGCGCCTGAACAAGTGCGCCCACGCCAGGGG
TATGAGAGAACGGAACCTTCAAAAGACGGTGGTGCGATTCCAAGACTACA
CCAACTCATCGTGTAAAGTTGACCATCTTGCATtttctcTACTTCTCCCC
GACGAAGAAAGTGAAAGCAAAGACAAAGTAACAGAAGACGACAGCAGCGT
TGCCACATCAACGGATACAAACAAATCGATACAAGATAAATGGTATCCAC
AGCTGGCGTATGCAAGTGACAAAGCCATTTTGATTGAAGTCGAAGAATTA
GAGGAAAAGGTCTTCTCGGCTAGTTTGCAAGTCAAGGGCTGGCGTTTGTC
TCAAAAGATCTCTCCAGCACTTCTGCTGAGCACGAGTAACGATCAAGCTG
AGTATGATCCACCCGAAGATAAATATCCCATCAGGATAGCGGCTTCCCGT
CTCCTAGCTCTTGAGCTCGGTATCGAACGACGTTACATGAAGCCTCCATT
CCGTACACCAGACAGCCTTCCTAAACCGGACGCCCCAGAGGCTAAAGAAG
AACCAGTCAAGAATCCAAAAGCAACAGCCCAACTGGAGAAATGGCGTGAA
GCAGTAAGCGAAGCAAAATCGTCAGCTCAGCTATCGATGTGTATCACAGC
ACTCTTCGAATGTGTCGCTTGGGAGAAGTCCATCATGAAAGTGTTCTGCA
TACTATGTCGTAAAAGTGACAACGAAGAAAGATTGTTGCTATGCGACGCA
TGTGATCGAGGCTGTCATACGTATTGTTGTAAGCCGAAATTCGATAAGAT
TCCCGATGGTGACTGGTTTTGTCAAGATTGTGTGTTGATGGCGTCTGGTA
GTGATCAGTGCTACAAATGTAAATCGAAGACCGGACGACGTCTGAAATGT
GCATTCTGTCCACGTCATTATCACATGGACTGCCTTGAACCACCATTACA
CAAaACACCTCGTTCGCCTTGGAGTTGTCCCGTCTGCAAGAAAACACGCT
CCAAGAGTAAACCTCCTCAACGTAAAAAACCACGCGCCGAAGAACTTCTC
AAGAAAGAGGAACAGAGCAAACAAAAATCCATGTCCAACAGCCGTGTGCA
GACGTCCAAAGACATGGAACCGTGTCGTTTCATATTGAACGAAATGGAAA
ATCACGAATCGTCATGGCCCTTTCTCGTCCCTGTCAATATGAAGCAGTTT
CCAGAGTATTATAAAGTGATCAAGCATCCGATGGATTTCCATACCATGAA
AACGAAGCTGCGTGATTACCAATACAAGTCAAAAGAAGAGTTCGCACGTG
ACGCGCGGTTGGTGTTTTTCAATTGTAAAACGTACAACGAAGACGAATCG
GAGGTTGGATGTGCAGGTGAAGCGATGCGAagtttcttcgagaaacgttg
GACCGCCCTCAAAAAGGGTGTCTCTTCCACAAACAGTGATAACAAATTCC
ACACCAACAAGAAGGGGGAGGGTGTGGAATCATCAGGCGATGAAGGAGAA
GACGCTCAGGAGGAGGGTGAAGGCGATGAAGAAGTATCCAGTTCGAGTTC
TGAAGAAATCTCATCCGAAAGTGAGAGCAGCGAAGTGGAGGAGGACAGTG
AAAACGAGACCGACTCAAAAACATGAATGGACAATCGTTCCGGTGGTCAA
GGCAACCCATATGATCGACCTTACTATGGGGACCCAAATGTCTTGAGACA
ACAAATTCCTGGGTATGCTAACTCTCCTGGAATTTATCCATATTCCCAGC
AGCAGCAACAAGATGGTTTTTCAGGGCGACGACCAGGGCAAGACCAGCTT
GGTCTCAATAATCATGCTACCGCCAGAACCAACAGCTTGACTTCACCTCC
ACAATCAACCAATCCTTGGATGCACTCTTACCACAATCAAACACAACCAA
ATTCTATGAGCCCTAATTTCAATATGAACATACCGAATATGTTTCATACA
AGGTGGGAACAAGACCAAGCCTCACTTCTACAACAAAGAGAAATGATGCA
AAGAGAAGAACATGCAAGGATGATGTATCGAGAGCGCTTGCAAATGCAAG
AGAGAGAAAATCAGTTGAAAATCCAGATGCAGAAGGAGCAAGAGCGAGAG
TTGCAACTTCAGCGTGAAAAAGAAGCACAACTTCAGCGTGAAAGGGAAGC
AAAGGTTCAAAGAGAACGTGAAGCCCAATTAGAAAGAGAGCGACAAGCTC
AACTTCAAAGAGAACGACAAGCTGCTCTGGAGAAAGAAAGACAGCTACAG
TTGCAGAGGGAAAGAGAAGCTCAATTACAAAGAGAAGCTCAATTACAATA
TCAGATGCAAAGAGAAATGCAACTTGAAAGAGAAAGAGAAGCAATGGCAA
TAAGAGAAAGAGATGCAATCCTTGAACGAGATAGAAAAGCAATGCTCTAC
AGAGATGCTTATTTTGCACAACAACATCAACCACAGCAATttccaaacca
ttttggttccaTGCAAAATACATTGCCTAATTTGAATTTCACACAATCCA
ATGAGTCAATGTCTAATCAATTTAACTTCTATAACCAGCCCAGTATGCAT
TCAAATGGTAATCTTCCTAGCAGTACATCGTCTTCTATACTAAACTTCTC
AATGGATCAAATTTTCAACCCTAATAAGATATCTGAGTCACCTGTCTCCA
AAGCAGCAAGTACCAGTTCTTCCTTTCACTTTCCAATCTCATCACCTTCC
ACCGTCAGCTCAACAACAACTTCATCAACAACGACAACCACAACTGCTTT
ACGTAAAAGCTCATCTAACTCATTTGACAATGGAATTATAAATAGTATTG
TTTCTGATAAGGGATTTTTAACCTCACCCTTGGACAGTAATAGTCAATTC
ATGAAAACATGGCAAGAACTACAGGATATGGATTTGagtgaaattgagaa
aaatgtcCTTGGACCTAAAGATCAAGATTCCCGAAACACTCCATTAGCAG
ATACTCCATTTTCAAACCCTACTACACCAACAGAAATGAATGGGCTGCCA
CCAAAACCAATTGATTCTAACTTGAATAACATTGTTAATTCTCTACCTGA
AAACTCTCTGGATTTAAATAAGCATTccattgaaacaaaagaatctttAC
AAATAACAAACACTGAAGATACACCACCACAACAGAATCTATTGAATCAT
CCAAGAAATTTATTATCAGTATCTCAAACAGCTCAAGCTAGCTCCAATTA
TACAAACACCAGTGTAACGCAATCAGACATAAACTTGACACATGTATCAG
AAAATTTACTTACCCATAATAGGTCTTGCGTTTCTTCATTTGTTTCGCCT
ACGTCATCAGATTTGTATTGCAATCAAGATTTTGATAAGCAATCAAAACG
AGGAGATGATATCAAGCATGAAGAATATTCTAATGAACTTCAAAGCAATC
ACTCAAAATCATATGAAAAACAATCATCATCTTCACCTAcaacattaaaa
caaaaatcaaaacaatcatttAGTAGTATTGAAAGTTTCCTTGGTATGAG
CAGCGATAGTAAAAAAACTGAAGATAATGATAATGAAAGGATTAATGACA
CCACTAAAAAGCGAGAAAGGATCCCATCAAGTGATGTACAAGATCGAATT
TCAGTCATAAAACCATTACCAATTTCATCACCACAAATTTCAAACACATC
CTCTCCTTTGGATATTGTGAATAATGATCATGACACATTGAAAAGTCCAC
AAGCAATTGAAAAGCTGAAATCTcctgaagaaattcaaaaagtaaTAGAT
CATTCTGAATCTGCACCTGTCACACTCATCCATCCATCTATGCGCCTCAA
AAAGCAAAGAAGTCTATCAAACAGTTCAATGACTGCCACCAGTCCACAAC
CCGTTATGGAAaaggaaaaaccaaaaacaagtAATAGACGACCGTTACAT
CCTTCTATGCGATTACAGACcaataaaaataatacaaaagTTGATAAAGC
TGAACCTAAAAAGAGTAAGGTTGAAAATCTTGATAACAGTTTTGACAGTG
GAAAGAATATCTTACACAGTCCAAAAACTGGGCGTTATCAATCTGAACTT
ACAAGTACTTCCACCAAATCTTCAACTAGGAAGTTATCTCCGTTCACTCC
TCCAACTGTTACATCACCTTTAACCTCACCACCACTAGTATCACCTGGAA
TTCGAAGTCCCTTCAATGGAAAACCCCTCACTGGAAAACCATTCTCAACT
GGTAAGCCTGTTCATGGAGGAAAACCAGCATCTTATTCAGCTCAAGGTGG
TGGTAAACCAATGCATATGGGAGGGAAACCGACTAGTTTCTCTTCACATA
TGACTGTCAAAGAGGAAAAGTCACCAGAAAAAGAGCACACTGGCAAACCT
TTATCTTTTTTGAAGTCCATGGTAgaagaatcttccaaaaacaCAAACAC
ACTTCAAGGGAAAAAGATCACTGGCAAGAAAAGACCCAGAAAGGAAACTA
TCGAGAAACCAGCttcaaaagaaactttaaaaaaagatgACATATCAAAA
TCCCCTGACTTGAAAACAAGTCGTATAACAAAAATGATATCAACCCCACC
AAGCTCACAAAAATTGACAGATAATATCAAGACTAAGAAACCACCACAAG
AAAAACAGGCACCTGTTAAAAAACTACCTGTCAAAAGGTCTCCAAAAGTA
TCACCTCCCAAGAGAGAAGCTGTAAAAGATTCACCACTGAAAGAAAATCC
TTTTAGAAAATCTATCGTCCAAGCAAAGAGTAAACCAGTActgacaaaac
agaaaaatttgaGTAAAGAGAATATTGAAGAATTGAGCACAAGTGAGGAA
AAAGATTCCCCAAAGAAGacattcaaattcaaagggaTCACATTTGATGC
CAAGACTGAAGATGATGATAGCAGTGATTCTGATTCAGACAGCTCATCAA
ATTCTGATTcagGGTCGTCAAGTGATAGCAGTGACAACAGTGGAacagaa
gaagaaattgaagataTTGAAGACGAAGACGATGACGATACTGCATCTCA
AACAAGTTCAGTTACAAGCTCTCCTGCAAAGAAAACACAAAGAGCTGGTC
AAAAACGAAAAGCAGTTCCTGACAATGCAGAGGtGATTGCCAGTTTGAAG
AAACGAAAAGTTGTTGATTTGGATTTGATAAAAGCGCCATTAAAATTTgg
ATGGAGAAGGCAGACAAGACTCAGACCGAACAATGCTGGTGATGGGCTGA
GGGGAGATGTTTATTATTATTCACCTTGTGGGAAAAAGCTGAGGACGTAT
CCTGAGTTAAACAGTtACATCTTTCGAAATGATGTCGTTGATGTAGACTT
GAAGAATTTCAGCTTTTCAACCAAACTTCGTGTTGGCGAATTCATGCAGG
CTAAGGATGGTTCAAAGTTTGTGACACTGACTGAAGAAGAGATCGATGAA
ACATTTGTTATGATGGAAGAAAGGAGAAGTGCTTCTGCAAAAAGAGCTGa
agaaaagaagagagaaaaacgTGAAAAGGAGGAGAAGCAACGTCAGATAC
TTGAGGAGAGAAAAAAGAAGAGAGAAGAAGCCTTGGAAAGAAAGAGATCG
AAAGAAGAAGAAAGGAGAAAGGTTCAAAAAGACAAAGCATTGGAAGCAAA
GATGAAGAAGGAGAAAGAAAAGGAAGCAGCACAAGAAGCCAAACGATTGA
AAGAGGAGGCAATAATGTTGAAGAAACTAGAAAGGCAAGCTCAAATGGAA
GCAAGTCGAATTGCCAAGCGTGAGAAAGTTCAAAATATGTTGGCTGAAAA
GCAGAAGATGAAAGAACAAAGAGAACATGAACGAGTCATGAAGATTGAGA
ACCAAAAAGTGgagaaagaaatgaaattacAAGCAATCGAAAATgaGAAG
GAACGTAAAAGGCTGCAACAAGTGAAAAGTAAAGTATCAGAAAAAGAAAA
GCGAAAACGAGAGCTGGTCATGATGAAAGCTTATGAAGCACAACGGAGAG
CTGAGGAGAGAGAACGCCTCAAAGAACAAAAGAAGCTGGAGAAAACCTTG
ATCAGGCAACGAAAATTGGAACAGAAAAGATATGAGCGCATGATCtctaa
agaattgaaaaaacctATCGATGATATGGCTCTGAATGATTTGAAGCCGT
TGCCAGAGTTACCAAGGGTAACCAACATCAACATTCCTGGCAAAGCATAT
GCAGATATCCTGATGGTTCAAGAGTTTGTTCACGCCTTTGGTCATGTCAT
TGATATCGATCCAGAGAAGGAGTTTCCAAGCATGGGAGAGTTGCAATCAT
CATTGTTGTGTGAATCTGGTAGCGATGAAGCAATCTTCACTGCATGCCAA
GCACTTCTTTTTTACGCCCTCTACGATCCCGGTGTATCTGGGCCTTATGC
CAAAACTTCACTGGGTTCAGACCTTACGAGTATCGAATTGAACGAGAACA
ACATATCAGAAGTATTACGTCTTTTCATCTTATCACGTAATGAAGGAAAA
CAACACACACTCAGTGATCAGCTCACCAAATATCCTTTAGAAGCTCTCTC
ACCCAGTAGTAAAGCTGCTGTTCTAGCTTTCATTGTCAACGAACTGCTTT
GTGGAAAATCAGTTAGCAGAGAGATTGACGGTAGCTTggagaacatttca
aatatgCGAAGGGATAAATGGAACCTGGAAGGAGATATACGGAAaTTGAA
AGCTGATCTATTATCAAAGCAACCCAAGAAAGCAGCCAGTGATCAACAAC
AGAAcctaaaaaacaacaaaggaGAGTCGAAGAAAAGAGACTCTGACGAG
GAGAACAATTCGGACGATGAAGGAACCACTATCACCACTGCTAAGGAGAG
CAATATCGATTTAAACGACACTGCGGAAGACACAGAAGCTGAAAACCAGC
CAGAGATGGTGAATCCTACTACACTCGACCAAATGGAGAAGAAACTACGT
TTGATGGAAAAGAAACACGCTCGCTACCGTAAAAAGTTGTTCGATTCTTC
ACACACGATACGTGGTATAAATTTGGGTCAAGATCGATACCGGCGCCGTT
ATTTCGTGCTTCCGAACGCCGGAGGGATTTACGTCGAAGGGCTGGAAAGT
GGATTTTTTGACGAAGAAACGAACGTGAAAACAAAGGAAGAAAAGGAAGA
ATGCAAAGAACATTTAGATAGTTTACTGACCACCTTGAAATCTCCAACTG
TGTTGAAATCCCCTGTGACTGGCCCCAAAACACCGGCCACAAATACACCG
TCTGTATCAGCATTATCCTCAAATTCAAACGAACTTTTAAAACCGAAACA
AGAGAGTCCTATAcaaacacaacaacaacaaaaacagataaaagtTGAGA
ATCCTTGTTCAAGTGATAGTAGTTATGTCAAATCTTGGTTTTCCTTACGG
ACTAAAAAACGTTGCGAGTCTTACAAAACTTCAGCTATACGTGAAACGCC
TAAAGAGCGCAAACATTCGCTCATCGTTGCACCGAGGATAGAACGACTTG
CCGACGACCACCAATTCTTAGAATCTATATACTCTTGTTATTCCACTACT
TCTCCTGGTGGGAAAAACACTTTATTACCTGTCAGCAGATTTCCCTTATC
CAAGGAAAGTATGCATCGGAACTCGTTACTAGGCTTACCGGCTGAATTGG
ATATGAATTTACTTATACAACAAGACCCACAAAAAGCAGCGGAAATTCTT
GAAATACAGACTGCCAAGCCTCAAGAAATTCCGCCTGAAATGCAGGCGGG
TTGGTGGCGGATCACCGATCCAGAACAAATGCAGCGCCTGAACAAGTGCG
CCCACGCCAGGGGTATGAGAGAACGGAACCTTCAAAAGACGGTGGTGCGA
TTCCAAGACTACACCAACTCATCGTGTAAAGTTGACCATCTTGCATtttc
tcTACTTCTCCCCGACGAAGAAAGTGAAAGCAAAGACAAAGTAACAGAAG
ACGACAGCAGCGTTGCCACATCAACGGATACAAACAAATCGATACAAGAT
AAATGGTATCCACAGCTGGCGTATGCAAGTGACAAAGCCATTTTGATTGA
AGTCGAAGAATTAGAGGAAAAGGTCTTCTCGGCTAGTTTGCAAGTCAAGG
GCTGGCGTTTGTCTCAAAAGATCTCTCCAGCACTTCTGCTGAGCACGAGT
AACGATCAAGCTGAGTATGATCCACCCGAAGATAAATATCCCATCAGGAT
AGCGGCTTCCCGTCTCCTAGCTCTTGAGCTCGGTATCGAACGACGTTACA
TGAAGCCTCCATTCCGTACACCAGACAGCCTTCCTAAACCGGACGCCCCA
GAGGCTAAAGAAGAACCAGTCAAGAATCCAAAAGCAACAGCCCAACTGGA
GAAATGGCGTGAAGCAGTAAGCGAAGCAAAATCGTCAGCTCAGCTATCGA
TGTGTATCACAGCACTCTTCGAATGTGTCGCTTGGGAGAAGTCCATCATG
AAAGTGTTCTGCATACTATGTCGTAAAAGTGACAACGAAGAAAGATTGTT
GCTATGCGACGCATGTGATCGAGGCTGTCATACGTATTGTTGTAAGCCGA
AATTCGATAAGATTCCCGATGGTGACTGGTTTTGTCAAGATTGTGTGTTG
ATGGCGTCTGGTAGTGATCAGTGCTACAAATGTAAATCGAAGACCGGACG
ACGTCTGAAATGTGCATTCTGTCCACGTCATTATCACATGGACTGCCTTG
AACCACCATTACACAAaACACCTCGTTCGCCTTGGAGTTGTCCCGTCTGC
AAGAAAACACGCTCCAAGAGTAAACCTCCTCAACGTAAAAAACCACGCGC
CGAAGAACTTCTCAAGAAAGAGGAACAGAGCAAACAAAAATCCATGTCCA
ACAGCCGTGTGCAGACGTCCAAAGACATGGAACCGTGTCGTTTCATATTG
AACGAAATGGAAAATCACGAATCGTCATGGCCCTTTCTCGTCCCTGTCAA
TATGAAGCAGTTTCCAGAGTATTATAAAGTGATCAAGCATCCGATGGATT
TCCATACCATGAAAACGAAGCTGCGTGATTACCAATACAAGTCAAAAGAA
GAGTTCGCACGTGACGCGCGGTTGGTGTTTTTCAATTGTAAAACGTACAA
CGAAGACGAATCGGAGGTTGGATGTGCAGGTGAAGCGATGCGAagtttct
tcgagaaacgttgGACCGCCCTCAAAAAGGGTGTCTCTTCCACAAACAGT
GATAACAAATTCCACACCAACAAGAAGGGGGAGGGTGTGGAATCATCAGG
CGATGAAGGAGAAGACGCTCAGGAGGAGGGTGAAGGCGATGAAGAAGTAT
CCAGTTCGAGTTCTGAAGAAATCTCATCCGAAAGTGAGAGCAGCGAAGTG
GAGGAGGACAGTGAAAACGAGACCGACTCAAAAACATGAATGGACAATCG
TTCCGGTGGTCAAGGCAACCCATATGATCGACCTTACTATGGGGACCCAA
ATGTCTTGAGACAACAAATTCCTGGGTATGCTAACTCTCCTGGAATTTAT
CCATATTCCCAGCAGCAGCAACAAGATGGTTTTTCAGGGCGACGACCAGG
GCAAGACCAGCTTGGTCTCAATAATCATGCTACCGCCAGAACCAACAGCT
TGACTTCACCTCCACAATCAACCAATCCTTGGATGCACTCTTACCACAAT
CAAACACAACCAAATTCTATGAGCCCTAATTTCAATATGAACATACCGAA
TATGTTTCATACAAGGTGGGAACAAGACCAAGCCTCACTTCTACAACAAA
GAGAAATGATGCAAAGAGAAGAACATGCAAGGATGATGTATCGAGAGCGC
TTGCAAATGCAAGAGAGAGAAAATCAGTTGAAAATCCAGATGCAGAAGGA
GCAAGAGCGAGAGTTGCAACTTCAGCGTGAAAAAGAAGCACAACTTCAGC
GTGAAAGGGAAGCAAAGGTTCAAAGAGAACGTGAAGCCCAATTAGAAAGA
GAGCGACAAGCTCAACTTCAAAGAGAACGACAAGCTGCTCTGGAGAAAGA
AAGACAGCTACAGTTGCAGAGGGAAAGAGAAGCTCAATTACAAAGAGAAG
CTCAATTACAATATCAGATGCAAAGAGAAATGCAACTTGAAAGAGAAAGA
GAAGCAATGGCAATAAGAGAAAGAGATGCAATCCTTGAACGAGATAGAAA
AGCAATGCTCTACAGAGATGCTTATTTTGCACAACAACATCAACCACAGC
AATttccaaaccattttggttccaTGCAAAATACATTGCCTAATTTGAAT
TTCACACAATCCAATGAGTCAATGTCTAATCAATTTAACTTCTATAACCA
GCCCAGTATGCATTCAAATGGTAATCTTCCTAGCAGTACATCGTCTTCTA
TACTAAACTTCTCAATGGATCAAATTTTCAACCCTAATAAGATATCTGAG
TCACCTGTCTCCAAAGCAGCAAGTACCAGTTCTTCCTTTCACTTTCCAAT
CTCATCACCTTCCACCGTCAGCTCAACAACAACTTCATCAACAACGACAA
CCACAACTGCTTTACGTAAAAGCTCATCTAACTCATTTGACAATGGAATT
ATAAATAGTATTGTTTCTGATAAGGGATTTTTAACCTCACCCTTGGACAG
TAATAGTCAATTCATGAAAACATGGCAAGAACTACAGGATATGGATTTGa
gtgaaattgagaaaaatgtcCTTGGACCTAAAGATCAAGATTCCCGAAAC
ACTCCATTAGCAGATACTCCATTTTCAAACCCTACTACACCAACAGAAAT
GAATGGGCTGCCACCAAAACCAATTGATTCTAACTTGAATAACATTGTTA
ATTCTCTACCTGAAAACTCTCTGGATTTAAATAAGCATTccattgaaaca
aaagaatctttACAAATAACAAACACTGAAGATACACCACCACAACAGAA
TCTATTGAATCATCCAAGAAATTTATTATCAGTATCTCAAACAGCTCAAG
CTAGCTCCAATTATACAAACACCAGTGTAACGCAATCAGACATAAACTTG
ACACATGTATCAGAAAATTTACTTACCCATAATAGGTCTTGCGTTTCTTC
ATTTGTTTCGCCTACGTCATCAGATTTGTATTGCAATCAAGATTTTGATA
AGCAATCAAAACGAGGAGATGATATCAAGCATGAAGAATATTCTAATGAA
CTTCAAAGCAATCACTCAAAATCATATGAAAAACAATCATCATCTTCACC
TAcaacattaaaacaaaaatcaaaacaatcatttAGTAGTATTGAAAGTT
TCCTTGGTATGAGCAGCGATAGTAAAAAAACTGAAGATAATGATAATGAA
AGGATTAATGACACCACTAAAAAGCGAGAAAGGATCCCATCAAGTGATGT
ACAAGATCGAATTTCAGTCATAAAACCATTACCAATTTCATCACCACAAA
TTTCAAACACATCCTCTCCTTTGGATATTGTGAATAATGATCATGACACA
TTGAAAAGTCCACAAGCAATTGAAAAGCTGAAATCTcctgaagaaattca
aaaagtaaTAGATCATTCTGAATCTGCACCTGTCACACTCATCCATCCAT
CTATGCGCCTCAAAAAGCAAAGAAGTCTATCAAACAGTTCAATGACTGCC
ACCAGTCCACAACCCGTTATGGAAaaggaaaaaccaaaaacaagtAATAG
ACGACCGTTACATCCTTCTATGCGATTACAGACcaataaaaataatacaa
aagTTGATAAAGCTGAACCTAAAAAGAGTAAGGTTGAAAATCTTGATAAC
AGTTTTGACAGTGGAAAGAATATCTTACACAGTCCAAAAACTGGGCGTTA
TCAATCTGAACTTACAAGTACTTCCACCAAATCTTCAACTAGGAAGTTAT
CTCCGTTCACTCCTCCAACTGTTACATCACCTTTAACCTCACCACCACTA
GTATCACCTGGAATTCGAAGTCCCTTCAATGGAAAACCCCTCACTGGAAA
ACCATTCTCAACTGGTAAGCCTGTTCATGGAGGAAAACCAGCATCTTATT
CAGCTCAAGGTGGTGGTAAACCAATGCATATGGGAGGGAAACCGACTAGT
TTCTCTTCACATATGACTGTCAAAGAGGAAAAGTCACCAGAAAAAGAGCA
CACTGGCAAACCTTTATCTTTTTTGAAGTCCATGGTAgaagaatcttcca
aaaacaCAAACACACTTCAAGGGAAAAAGATCACTGGCAAGAAAAGACCC
AGAAAGGAAACTATCGAGAAACCAGCttcaaaagaaactttaaaaaaaga
tgACATATCAAAATCCCCTGACTTGAAAACAAGTCGTATAACAAAAATGA
TATCAACCCCACCAAGCTCACAAAAATTGACAGATAATATCAAGACTAAG
AAACCACCACAAGAAAAACAGGCACCTGTTAAAAAACTACCTGTCAAAAG
GTCTCCAAAAGTATCACCTCCCAAGAGAGAAGCTGTAAAAGATTCACCAC
TGAAAGAAAATCCTTTTAGAAAATCTATCGTCCAAGCAAAGAGTAAACCA
GTActgacaaaacagaaaaatttgaGTAAAGAGAATATTGAAGAATTGAG
CACAAGTGAGGAAAAAGATTCCCCAAAGAAGacattcaaattcaaaggga
TCACATTTGATGCCAAGACTGAAGATGATGATAGCAGTGATTCTGATTCA
GACAGCTCATCAAATTCTGATTcagGGTCGTCAAGTGATAGCAGTGACAA
CAGTGGAacagaagaagaaattgaagataTTGAAGACGAAGACGATGACG
ATACTGCATCTCAAACAAGTTCAGTTACAAGCTCTCCTGCAAAGAAAACA
CAAAGAGCTGGTCAAAAACGAAAAGCAGTTCCTGACAATGCAGAGGtGAT
TGCCAGTTTGAAGAAACGAAAAGTTGTTGATTTGGATTTGATAAAAGCGC
CATTAAAATTTggATGGAGAAGGCAGACAAGACTCAGACCGAACAATGCT
GGTGATGGGCTGAGGGGAGATGTTTATTATTATTCACCTTGTGGGAAAAA
GCTGAGGACGTATCCTGAGTTAAACAGTtACATCTTTCGAAATGATGTCG
TTGATGTAGACTTGAAGAATTTCAGCTTTTCAACCAAACTTCGTGTTGGC
GAATTCATGCAGGCTAAGGATGGTTCAAAGTTTGTGACACTGACTGAAGA
AGAGATCGATGAAACATTTGTTATGATGGAAGAAAGGAGAAGTGCTTCTG
CAAAAAGAGCTGaagaaaagaagagagaaaaacgTGAAAAGGAGGAGAAG
CAACGTCAGATACTTGAGGAGAGAAAAAAGAAGAGAGAAGAAGCCTTGGA
AAGAAAGAGATCGAAAGAAGAAGAAAGGAGAAAGGTTCAAAAAGACAAAG
CATTGGAAGCAAAGATGAAGAAGGAGAAAGAAAAGGAAGCAGCACAAGAA
GCCAAACGATTGAAAGAGGAGGCAATAATGTTGAAGAAACTAGAAAGGCA
AGCTCAAATGGAAGCAAGTCGAATTGCCAAGCGTGAGAAAGTTCAAAATA
TGTTGGCTGAAAAGCAGAAGATGAAAGAACAAAGAGAACATGAACGAGTC
ATGAAGATTGAGAACCAAAAAGTGgagaaagaaatgaaattacAAGCAAT
CGAAAATgaGAAGGAACGTAAAAGGCTGCAACAAGTGAAAAGTAAAGTAT
CAGAAAAAGAAAAGCGAAAACGAGAGCTGGTCATGATGAAAGCTTATGAA
GCACAACGGAGAGCTGAGGAGAGAGAACGCCTCAAAGAACAAAAGAAGCT
GGAGAAAACCTTGATCAGGCAACGAAAATTGGAACAGAAAAGATATGAGC
GCATGATCtctaaagaattgaaaaaacctATCGATGATATGGCTCTGAAT
GATTTGAAGCCGTTGCCAGAGTTACCAAGGGTAACCAACATCAACATTCC
TGGCAAAGCATATGCAGATATCCTGATGGTTCAAGAGTTTGTTCACGCCT
TTGGTCATGTCATTGATATCGATCCAGAGAAGGAGTTTCCAAGCATGGGA
GAGTTGCAATCATCATTGTTGTGTGAATCTGGTAGCGATGAAGCAATCTT
CACTGCATGCCAAGCACTTCTTTTTTACGCCCTCTACGATCCCGGTGTAT
CTGGGCCTTATGCCAAAACTTCACTGGGTTCAGACCTTACGAGTATCGAA
TTGAACGAGAACAACATATCAGAAGTATTACGTCTTTTCATCTTATCACG
TAATGAAGGAAAACAACACACACTCAGTGATCAGCTCACCAAATATCCTT
TAGAAGCTCTCTCACCCAGTAGTAAAGCTGCTGTTCTAGCTTTCATTGTC
AACGAACTGCTTTGTGGAAAATCAGTTAGCAGAGAGATTGACGGTAGCTT
ggagaacatttcaaatatgCGAAGGGATAAATGGAACCTGGAAGGAGATA
TACGGAAaTTGAAAGCTGATCTATTATCAAAGCAACCCAAGAAAGCAGCC
AGTGATCAACAACAGAAcctaaaaaacaacaaaggaGAGTCGAAGAAAAG
AGACTCTGACGAGGAGAACAATTCGGACGATGAAGGAACCACTATCACCA
CTGCTAAGGAGAGCAATATCGATTTAAACGACACTGCGGAAGACACAGAA
GCTGAAAACCAGCCAGAGATGGTGAATCCTACTACACTCGACCAAATGGA
GAAGAAACTACGTTTGATGGAAAAGAAACACGCTCGCTACCGTAAAAAGT
TGTTCGATTCTTCACACACGATACGTGGTATAAATTTGGGTCAAGATCGA
TACCGGCGCCGTTATTTCGTGCTTCCGAACGCCGGAGGGATTTACGTCGA
AGGGCTGGAAAGTGGATTTTTTGACGAAGAAACGAACGTGAAAACAAAGG
AAGAAAAGGAAGAATGCAAAGAACATTTAGATAGTTTACTGACCACCTTG
AAATCTCCAACTGTGTTGAAATCCCCTGTGACTGGCCCCAAAACACCGGC
CACAAATACACCGTCTGTATCAGCATTATCCTCAAATTCAAACGAACTTT
TAAAACCGAAACAAGAGAGTCCTATAcaaacacaacaacaacaaaaacag
ataaaagtTGAGAATCCTTGTTCAAGTGATAGTAGTTATGTCAAATCTTG
GTTTTCCTTACGGACTAAAAAACGTTGCGAGTCTTACAAAACTTCAGCTA
TACGTGAAACGCCTAAAGAGCGCAAACATTCGCTCATCGTTGCACCGAGG
ATAGAACGACTTGCCGACGACCACCAATTCTTAGAATCTATATACTCTTG
TTATTCCACTACTTCTCCTGGTGGGAAAAACACTTTATTACCTGTCAGCA
GATTTCCCTTATCCAAGGAAAGTATGCATCGGAACTCGTTACTAGGCTTA
CCGGCTGAATTGGATATGAATTTACTTATACAACAAGACCCACAAAAAGC
AGCGGAAATTCTTGAAATACAGACTGCCAAGCCTCAAGAAATTCCGCCTG
AAATGCAGGCGGGTTGGTGGCGGATCACCGATCCAGAACAAATGCAGCGC
CTGAACAAGTGCGCCCACGCCAGGGGTATGAGAGAACGGAACCTTCAAAA
GACGGTGGTGCGATTCCAAGACTACACCAACTCATCGTGTAAAGTTGACC
ATCTTGCATtttctcTACTTCTCCCCGACGAAGAAAGTGAAAGCAAAGAC
AAAGTAACAGAAGACGACAGCAGCGTTGCCACATCAACGGATACAAACAA
ATCGATACAAGATAAATGGTATCCACAGCTGGCGTATGCAAGTGACAAAG
CCATTTTGATTGAAGTCGAAGAATTAGAGGAAAAGGTCTTCTCGGCTAGT
TTGCAAGTCAAGGGCTGGCGTTTGTCTCAAAAGATCTCTCCAGCACTTCT
GCTGAGCACGAGTAACGATCAAGCTGAGTATGATCCACCCGAAGATAAAT
ATCCCATCAGGATAGCGGCTTCCCGTCTCCTAGCTCTTGAGCTCGGTATC
GAACGACGTTACATGAAGCCTCCATTCCGTACACCAGACAGCCTTCCTAA
ACCGGACGCCCCAGAGGCTAAAGAAGAACCAGTCAAGAATCCAAAAGCAA
CAGCCCAACTGGAGAAATGGCGTGAAGCAGTAAGCGAAGCAAAATCGTCA
GCTCAGCTATCGATGTGTATCACAGCACTCTTCGAATGTGTCGCTTGGGA
GAAGTCCATCATGAAAGTGTTCTGCATACTATGTCGTAAAAGTGACAACG
AAGAAAGATTGTTGCTATGCGACGCATGTGATCGAGGCTGTCATACGTAT
TGTTGTAAGCCGAAATTCGATAAGATTCCCGATGGTGACTGGTTTTGTCA
AGATTGTGTGTTGATGGCGTCTGGTAGTGATCAGTGCTACAAATGTAAAT
CGAAGACCGGACGACGTCTGAAATGTGCATTCTGTCCACGTCATTATCAC
ATGGACTGCCTTGAACCACCATTACACAAaACACCTCGTTCGCCTTGGAG
TTGTCCCGTCTGCAAGAAAACACGCTCCAAGAGTAAACCTCCTCAACGTA
AAAAACCACGCGCCGAAGAACTTCTCAAGAAAGAGGAACAGAGCAAACAA
AAATCCATGTCCAACAGCCGTGTGCAGACGTCCAAAGACATGGAACCGTG
TCGTTTCATATTGAACGAAATGGAAAATCACGAATCGTCATGGCCCTTTC
TCGTCCCTGTCAATATGAAGCAGTTTCCAGAGTATTATAAAGTGATCAAG
CATCCGATGGATTTCCATACCATGAAAACGAAGCTGCGTGATTACCAATA
CAAGTCAAAAGAAGAGTTCGCACGTGACGCGCGGTTGGTGTTTTTCAATT
GTAAAACGTACAACGAAGACGAATCGGAGGTTGGATGTGCAGGTGAAGCG
ATGCGAagtttcttcgagaaacgttgGACCGCCCTCAAAAAGGGTGTCTC
TTCCACAAACAGTGATAACAAATTCCACACCAACAAGAAGGGGGAGGGTG
TGGAATCATCAGGCGATGAAGGAGAAGACGCTCAGGAGGAGGGTGAAGGC
GATGAAGAAGTATCCAGTTCGAGTTCTGAAGAAATCTCATCCGAAAGTGA
GAGCAGCGAAGTGGAGGAGGACAGTGAAAACGAGACCGACTCAAAAACAT
GAATGGACAATCGTTCCGGTGGTCAAGGCAACCCATATGATCGACCTTAC
TATGGGGACCCAAATGTCTTGAGACAACAAATTCCTGGGTATGCTAACTC
TCCTGGAATTTATCCATATTCCCAGCAGCAGCAACAAGATGGTTTTTCAG
GGCGACGACCAGGGCAAGACCAGCTTGGTCTCAATAATCATGCTACCGCC
AGAACCAACAGCTTGACTTCACCTCCACAATCAACCAATCCTTGGATGCA
CTCTTACCACAATCAAACACAACCAAATTCTATGAGCCCTAATTTCAATA
TGAACATACCGAATATGTTTCATACAAGGTGGGAACAAGACCAAGCCTCA
CTTCTACAACAAAGAGAAATGATGCAAAGAGAAGAACATGCAAGGATGAT
GTATCGAGAGCGCTTGCAAATGCAAGAGAGAGAAAATCAGTTGAAAATCC
AGATGCAGAAGGAGCAAGAGCGAGAGTTGCAACTTCAGCGTGAAAAAGAA
GCACAACTTCAGCGTGAAAGGGAAGCAAAGGTTCAAAGAGAACGTGAAGC
CCAATTAGAAAGAGAGCGACAAGCTCAACTTCAAAGAGAACGACAAGCTG
CTCTGGAGAAAGAAAGACAGCTACAGTTGCAGAGGGAAAGAGAAGCTCAA
TTACAAAGAGAAGCTCAATTACAATATCAGATGCAAAGAGAAATGCAACT
TGAAAGAGAAAGAGAAGCAATGGCAATAAGAGAAAGAGATGCAATCCTTG
AACGAGATAGAAAAGCAATGCTCTACAGAGATGCTTATTTTGCACAACAA
CATCAACCACAGCAATttccaaaccattttggttccaTGCAAAATACATT
GCCTAATTTGAATTTCACACAATCCAATGAGTCAATGTCTAATCAATTTA
ACTTCTATAACCAGCCCAGTATGCATTCAAATGGTAATCTTCCTAGCAGT
ACATCGTCTTCTATACTAAACTTCTCAATGGATCAAATTTTCAACCCTAA
TAAGATATCTGAGTCACCTGTCTCCAAAGCAGCAAGTACCAGTTCTTCCT
TTCACTTTCCAATCTCATCACCTTCCACCGTCAGCTCAACAACAACTTCA
TCAACAACGACAACCACAACTGCTTTACGTAAAAGCTCATCTAACTCATT
TGACAATGGAATTATAAATAGTATTGTTTCTGATAAGGGATTTTTAACCT
CACCCTTGGACAGTAATAGTCAATTCATGAAAACATGGCAAGAACTACAG
GATATGGATTTGagtgaaattgagaaaaatgtcCTTGGACCTAAAGATCA
AGATTCCCGAAACACTCCATTAGCAGATACTCCATTTTCAAACCCTACTA
CACCAACAGAAATGAATGGGCTGCCACCAAAACCAATTGATTCTAACTTG
AATAACATTGTTAATTCTCTACCTGAAAACTCTCTGGATTTAAATAAGCA
TTccattgaaacaaaagaatctttACAAATAACAAACACTGAAGATACAC
CACCACAACAGAATCTATTGAATCATCCAAGAAATTTATTATCAGTATCT
CAAACAGCTCAAGCTAGCTCCAATTATACAAACACCAGTGTAACGCAATC
AGACATAAACTTGACACATGTATCAGAAAATTTACTTACCCATAATAGGT
CTTGCGTTTCTTCATTTGTTTCGCCTACGTCATCAGATTTGTATTGCAAT
CAAGATTTTGATAAGCAATCAAAACGAGGAGATGATATCAAGCATGAAGA
ATATTCTAATGAACTTCAAAGCAATCACTCAAAATCATATGAAAAACAAT
CATCATCTTCACCTAcaacattaaaacaaaaatcaaaacaatcatttAGT
AGTATTGAAAGTTTCCTTGGTATGAGCAGCGATAGTAAAAAAACTGAAGA
TAATGATAATGAAAGGATTAATGACACCACTAAAAAGCGAGAAAGGATCC
CATCAAGTGATGTACAAGATCGAATTTCAGTCATAAAACCATTACCAATT
TCATCACCACAAATTTCAAACACATCCTCTCCTTTGGATATTGTGAATAA
TGATCATGACACATTGAAAAGTCCACAAGCAATTGAAAAGCTGAAATCTc
ctgaagaaattcaaaaagtaaTAGATCATTCTGAATCTGCACCTGTCACA
CTCATCCATCCATCTATGCGCCTCAAAAAGCAAAGAAGTCTATCAAACAG
TTCAATGACTGCCACCAGTCCACAACCCGTTATGGAAaaggaaaaaccaa
aaacaagtAATAGACGACCGTTACATCCTTCTATGCGATTACAGACcaat
aaaaataatacaaaagTTGATAAAGCTGAACCTAAAAAGAGTAAGGTTGA
AAATCTTGATAACAGTTTTGACAGTGGAAAGAATATCTTACACAGTCCAA
AAACTGGGCGTTATCAATCTGAACTTACAAGTACTTCCACCAAATCTTCA
ACTAGGAAGTTATCTCCGTTCACTCCTCCAACTGTTACATCACCTTTAAC
CTCACCACCACTAGTATCACCTGGAATTCGAAGTCCCTTCAATGGAAAAC
CCCTCACTGGAAAACCATTCTCAACTGGTAAGCCTGTTCATGGAGGAAAA
CCAGCATCTTATTCAGCTCAAGGTGGTGGTAAACCAATGCATATGGGAGG
GAAACCGACTAGTTTCTCTTCACATATGACTGTCAAAGAGGAAAAGTCAC
CAGAAAAAGAGCACACTGGCAAACCTTTATCTTTTTTGAAGTCCATGGTA
gaagaatcttccaaaaacaCAAACACACTTCAAGGGAAAAAGATCACTGG
CAAGAAAAGACCCAGAAAGGAAACTATCGAGAAACCAGCttcaaaagaaa
ctttaaaaaaagatgACATATCAAAATCCCCTGACTTGAAAACAAGTCGT
ATAACAAAAATGATATCAACCCCACCAAGCTCACAAAAATTGACAGATAA
TATCAAGACTAAGAAACCACCACAAGAAAAACAGGCACCTGTTAAAAAAC
TACCTGTCAAAAGGTCTCCAAAAGTATCACCTCCCAAGAGAGAAGCTGTA
AAAGATTCACCACTGAAAGAAAATCCTTTTAGAAAATCTATCGTCCAAGC
AAAGAGTAAACCAGTActgacaaaacagaaaaatttgaGTAAAGAGAATA
TTGAAGAATTGAGCACAAGTGAGGAAAAAGATTCCCCAAAGAAGacattc
aaattcaaagggaTCACATTTGATGCCAAGACTGAAGATGATGATAGCAG
TGATTCTGATTCAGACAGCTCATCAAATTCTGATTcagGGTCGTCAAGTG
ATAGCAGTGACAACAGTGGAacagaagaagaaattgaagataTTGAAGAC
GAAGACGATGACGATACTGCATCTCAAACAAGTTCAGTTACAAGCTCTCC
TGCAAAGAAAACACAAAGAGCTGGTCAAAAACGAAAAGCAGTTCCTGACA
ATGCAGAGGtGATTGCCAGTTTGAAGAAACGAAAAGTTGTTGATTTGGAT
TTGATAAAAGCGCCATTAAAATTTggATGGAGAAGGCAGACAAGACTCAG
ACCGAACAATGCTGGTGATGGGCTGAGGGGAGATGTTTATTATTATTCAC
CTTGTGGGAAAAAGCTGAGGACGTATCCTGAGTTAAACAGTtACATCTTT
CGAAATGATGTCGTTGATGTAGACTTGAAGAATTTCAGCTTTTCAACCAA
ACTTCGTGTTGGCGAATTCATGCAGGCTAAGGATGGTTCAAAGTTTGTGA
CACTGACTGAAGAAGAGATCGATGAAACATTTGTTATGATGGAAGAAAGG
AGAAGTGCTTCTGCAAAAAGAGCTGaagaaaagaagagagaaaaacgTGA
AAAGGAGGAGAAGCAACGTCAGATACTTGAGGAGAGAAAAAAGAAGAGAG
AAGAAGCCTTGGAAAGAAAGAGATCGAAAGAAGAAGAAAGGAGAAAGGTT
CAAAAAGACAAAGCATTGGAAGCAAAGATGAAGAAGGAGAAAGAAAAGGA
AGCAGCACAAGAAGCCAAACGATTGAAAGAGGAGGCAATAATGTTGAAGA
AACTAGAAAGGCAAGCTCAAATGGAAGCAAGTCGAATTGCCAAGCGTGAG
AAAGTTCAAAATATGTTGGCTGAAAAGCAGAAGATGAAAGAACAAAGAGA
ACATGAACGAGTCATGAAGATTGAGAACCAAAAAGTGgagaaagaaatga
aattacAAGCAATCGAAAATgaGAAGGAACGTAAAAGGCTGCAACAAGTG
AAAAGTAAAGTATCAGAAAAAGAAAAGCGAAAACGAGAGCTGGTCATGAT
GAAAGCTTATGAAGCACAACGGAGAGCTGAGGAGAGAGAACGCCTCAAAG
AACAAAAGAAGCTGGAGAAAACCTTGATCAGGCAACGAAAATTGGAACAG
AAAAGATATGAGCGCATGATCtctaaagaattgaaaaaacctATCGATGA
TATGGCTCTGAATGATTTGAAGCCGTTGCCAGAGTTACCAAGGGTAACCA
ACATCAACATTCCTGGCAAAGCATATGCAGATATCCTGATGGTTCAAGAG
TTTGTTCACGCCTTTGGTCATGTCATTGATATCGATCCAGAGAAGGAGTT
TCCAAGCATGGGAGAGTTGCAATCATCATTGTTGTGTGAATCTGGTAGCG
ATGAAGCAATCTTCACTGCATGCCAAGCACTTCTTTTTTACGCCCTCTAC
GATCCCGGTGTATCTGGGCCTTATGCCAAAACTTCACTGGGTTCAGACCT
TACGAGTATCGAATTGAACGAGAACAACATATCAGAAGTATTACGTCTTT
TCATCTTATCACGTAATGAAGGAAAACAACACACACTCAGTGATCAGCTC
ACCAAATATCCTTTAGAAGCTCTCTCACCCAGTAGTAAAGCTGCTGTTCT
AGCTTTCATTGTCAACGAACTGCTTTGTGGAAAATCAGTTAGCAGAGAGA
TTGACGGTAGCTTggagaacatttcaaatatgCGAAGGGATAAATGGAAC
CTGGAAGGAGATATACGGAAaTTGAAAGCTGATCTATTATCAAAGCAACC
CAAGAAAGCAGCCAGTGATCAACAACAGAAcctaaaaaacaacaaaggaG
AGTCGAAGAAAAGAGACTCTGACGAGGAGAACAATTCGGACGATGAAGGA
ACCACTATCACCACTGCTAAGGAGAGCAATATCGATTTAAACGACACTGC
GGAAGACACAGAAGCTGAAAACCAGCCAGAGATGGTGAATCCTACTACAC
TCGACCAAATGGAGAAGAAACTACGTTTGATGGAAAAGAAACACGCTCGC
TACCGTAAAAAGTTGTTCGATTCTTCACACACGATACGTGGTATAAATTT
GGGTCAAGATCGATACCGGCGCCGTTATTTCGTGCTTCCGAACGCCGGAG
GGATTTACGTCGAAGGGCTGGAAAGTGGATTTTTTGACGAAGAAACGAAC
GTGAAAACAAAGGAAGAAAAGGAAGAATGCAAAGAACATTTAGATAGTTT
ACTGACCACCTTGAAATCTCCAACTGTGTTGAAATCCCCTGTGACTGGCC
CCAAAACACCGGCCACAAATACACCGTCTGTATCAGCATTATCCTCAAAT
TCAAACGAACTTTTAAAACCGAAACAAGAGAGTCCTATAcaaacacaaca
acaacaaaaacagataaaagtTGAGAATCCTTGTTCAAGTGATAGTAGTT
ATGTCAAATCTTGGTTTTCCTTACGGACTAAAAAACGTTGCGAGTCTTAC
AAAACTTCAGCTATACGTGAAACGCCTAAAGAGCGCAAACATTCGCTCAT
CGTTGCACCGAGGATAGAACGACTTGCCGACGACCACCAATTCTTAGAAT
CTATATACTCTTGTTATTCCACTACTTCTCCTGGTGGGAAAAACACTTTA
TTACCTGTCAGCAGATTTCCCTTATCCAAGGAAAGTATGCATCGGAACTC
GTTACTAGGCTTACCGGCTGAATTGGATATGAATTTACTTATACAACAAG
ACCCACAAAAAGCAGCGGAAATTCTTGAAATACAGACTGCCAAGCCTCAA
GAAATTCCGCCTGAAATGCAGGCGGGTTGGTGGCGGATCACCGATCCAGA
ACAAATGCAGCGCCTGAACAAGTGCGCCCACGCCAGGGGTATGAGAGAAC
GGAACCTTCAAAAGACGGTGGTGCGATTCCAAGACTACACCAACTCATCG
TGTAAAGTTGACCATCTTGCATtttctcTACTTCTCCCCGACGAAGAAAG
TGAAAGCAAAGACAAAGTAACAGAAGACGACAGCAGCGTTGCCACATCAA
CGGATACAAACAAATCGATACAAGATAAATGGTATCCACAGCTGGCGTAT
GCAAGTGACAAAGCCATTTTGATTGAAGTCGAAGAATTAGAGGAAAAGGT
CTTCTCGGCTAGTTTGCAAGTCAAGGGCTGGCGTTTGTCTCAAAAGATCT
CTCCAGCACTTCTGCTGAGCACGAGTAACGATCAAGCTGAGTATGATCCA
CCCGAAGATAAATATCCCATCAGGATAGCGGCTTCCCGTCTCCTAGCTCT
TGAGCTCGGTATCGAACGACGTTACATGAAGCCTCCATTCCGTACACCAG
ACAGCCTTCCTAAACCGGACGCCCCAGAGGCTAAAGAAGAACCAGTCAAG
AATCCAAAAGCAACAGCCCAACTGGAGAAATGGCGTGAAGCAGTAAGCGA
AGCAAAATCGTCAGCTCAGCTATCGATGTGTATCACAGCACTCTTCGAAT
GTGTCGCTTGGGAGAAGTCCATCATGAAAGTGTTCTGCATACTATGTCGT
AAAAGTGACAACGAAGAAAGATTGTTGCTATGCGACGCATGTGATCGAGG
CTGTCATACGTATTGTTGTAAGCCGAAATTCGATAAGATTCCCGATGGTG
ACTGGTTTTGTCAAGATTGTGTGTTGATGGCGTCTGGTAGTGATCAGTGC
TACAAATGTAAATCGAAGACCGGACGACGTCTGAAATGTGCATTCTGTCC
ACGTCATTATCACATGGACTGCCTTGAACCACCATTACACAAaACACCTC
GTTCGCCTTGGAGTTGTCCCGTCTGCAAGAAAACACGCTCCAAGAGTAAA
CCTCCTCAACGTAAAAAACCACGCGCCGAAGAACTTCTCAAGAAAGAGGA
ACAGAGCAAACAAAAATCCATGTCCAACAGCCGTGTGCAGACGTCCAAAG
ACATGGAACCGTGTCGTTTCATATTGAACGAAATGGAAAATCACGAATCG
TCATGGCCCTTTCTCGTCCCTGTCAATATGAAGCAGTTTCCAGAGTATTA
TAAAGTGATCAAGCATCCGATGGATTTCCATACCATGAAAACGAAGCTGC
GTGATTACCAATACAAGTCAAAAGAAGAGTTCGCACGTGACGCGCGGTTG
GTGTTTTTCAATTGTAAAACGTACAACGAAGACGAATCGGAGGTTGGATG
TGCAGGTGAAGCGATGCGAagtttcttcgagaaacgttgGACCGCCCTCA
AAAAGGGTGTCTCTTCCACAAACAGTGATAACAAATTCCACACCAACAAG
AAGGGGGAGGGTGTGGAATCATCAGGCGATGAAGGAGAAGACGCTCAGGA
GGAGGGTGAAGGCGATGAAGAAGTATCCAGTTCGAGTTCTGAAGAAATCT
CATCCGAAAGTGAGAGCAGCGAAGTGGAGGAGGACAGTGAAAACGAGACC
GACTCAAAAACATGAATGGACAATCGTTCCGGTGGTCAAGGCAACCCATA
TGATCGACCTTACTATGGGGACCCAAATGTCTTGAGACAACAAATTCCTG
GGTATGCTAACTCTCCTGGAATTTATCCATATTCCCAGCAGCAGCAACAA
GATGGTTTTTCAGGGCGACGACCAGGGCAAGACCAGCTTGGTCTCAATAA
TCATGCTACCGCCAGAACCAACAGCTTGACTTCACCTCCACAATCAACCA
ATCCTTGGATGCACTCTTACCACAATCAAACACAACCAAATTCTATGAGC
CCTAATTTCAATATGAACATACCGAATATGTTTCATACAAGGTGGGAACA
AGACCAAGCCTCACTTCTACAACAAAGAGAAATGATGCAAAGAGAAGAAC
ATGCAAGGATGATGTATCGAGAGCGCTTGCAAATGCAAGAGAGAGAAAAT
CAGTTGAAAATCCAGATGCAGAAGGAGCAAGAGCGAGAGTTGCAACTTCA
GCGTGAAAAAGAAGCACAACTTCAGCGTGAAAGGGAAGCAAAGGTTCAAA
GAGAACGTGAAGCCCAATTAGAAAGAGAGCGACAAGCTCAACTTCAAAGA
GAACGACAAGCTGCTCTGGAGAAAGAAAGACAGCTACAGTTGCAGAGGGA
AAGAGAAGCTCAATTACAAAGAGAAGCTCAATTACAATATCAGATGCAAA
GAGAAATGCAACTTGAAAGAGAAAGAGAAGCAATGGCAATAAGAGAAAGA
GATGCAATCCTTGAACGAGATAGAAAAGCAATGCTCTACAGAGATGCTTA
TTTTGCACAACAACATCAACCACAGCAATttccaaaccattttggttcca
TGCAAAATACATTGCCTAATTTGAATTTCACACAATCCAATGAGTCAATG
TCTAATCAATTTAACTTCTATAACCAGCCCAGTATGCATTCAAATGGTAA
TCTTCCTAGCAGTACATCGTCTTCTATACTAAACTTCTCAATGGATCAAA
TTTTCAACCCTAATAAGATATCTGAGTCACCTGTCTCCAAAGCAGCAAGT
ACCAGTTCTTCCTTTCACTTTCCAATCTCATCACCTTCCACCGTCAGCTC
AACAACAACTTCATCAACAACGACAACCACAACTGCTTTACGTAAAAGCT
CATCTAACTCATTTGACAATGGAATTATAAATAGTATTGTTTCTGATAAG
GGATTTTTAACCTCACCCTTGGACAGTAATAGTCAATTCATGAAAACATG
GCAAGAACTACAGGATATGGATTTGagtgaaattgagaaaaatgtcCTTG
GACCTAAAGATCAAGATTCCCGAAACACTCCATTAGCAGATACTCCATTT
TCAAACCCTACTACACCAACAGAAATGAATGGGCTGCCACCAAAACCAAT
TGATTCTAACTTGAATAACATTGTTAATTCTCTACCTGAAAACTCTCTGG
ATTTAAATAAGCATTccattgaaacaaaagaatctttACAAATAACAAAC
ACTGAAGATACACCACCACAACAGAATCTATTGAATCATCCAAGAAATTT
ATTATCAGTATCTCAAACAGCTCAAGCTAGCTCCAATTATACAAACACCA
GTGTAACGCAATCAGACATAAACTTGACACATGTATCAGAAAATTTACTT
ACCCATAATAGGTCTTGCGTTTCTTCATTTGTTTCGCCTACGTCATCAGA
TTTGTATTGCAATCAAGATTTTGATAAGCAATCAAAACGAGGAGATGATA
TCAAGCATGAAGAATATTCTAATGAACTTCAAAGCAATCACTCAAAATCA
TATGAAAAACAATCATCATCTTCACCTAcaacattaaaacaaaaatcaaa
acaatcatttAGTAGTATTGAAAGTTTCCTTGGTATGAGCAGCGATAGTA
AAAAAACTGAAGATAATGATAATGAAAGGATTAATGACACCACTAAAAAG
CGAGAAAGGATCCCATCAAGTGATGTACAAGATCGAATTTCAGTCATAAA
ACCATTACCAATTTCATCACCACAAATTTCAAACACATCCTCTCCTTTGG
ATATTGTGAATAATGATCATGACACATTGAAAAGTCCACAAGCAATTGAA
AAGCTGAAATCTcctgaagaaattcaaaaagtaaTAGATCATTCTGAATC
TGCACCTGTCACACTCATCCATCCATCTATGCGCCTCAAAAAGCAAAGAA
GTCTATCAAACAGTTCAATGACTGCCACCAGTCCACAACCCGTTATGGAA
aaggaaaaaccaaaaacaagtAATAGACGACCGTTACATCCTTCTATGCG
ATTACAGACcaataaaaataatacaaaagTTGATAAAGCTGAACCTAAAA
AGAGTAAGGTTGAAAATCTTGATAACAGTTTTGACAGTGGAAAGAATATC
TTACACAGTCCAAAAACTGGGCGTTATCAATCTGAACTTACAAGTACTTC
CACCAAATCTTCAACTAGGAAGTTATCTCCGTTCACTCCTCCAACTGTTA
CATCACCTTTAACCTCACCACCACTAGTATCACCTGGAATTCGAAGTCCC
TTCAATGGAAAACCCCTCACTGGAAAACCATTCTCAACTGGTAAGCCTGT
TCATGGAGGAAAACCAGCATCTTATTCAGCTCAAGGTGGTGGTAAACCAA
TGCATATGGGAGGGAAACCGACTAGTTTCTCTTCACATATGACTGTCAAA
GAGGAAAAGTCACCAGAAAAAGAGCACACTGGCAAACCTTTATCTTTTTT
GAAGTCCATGGTAgaagaatcttccaaaaacaCAAACACACTTCAAGGGA
AAAAGATCACTGGCAAGAAAAGACCCAGAAAGGAAACTATCGAGAAACCA
GCttcaaaagaaactttaaaaaaagatgACATATCAAAATCCCCTGACTT
GAAAACAAGTCGTATAACAAAAATGATATCAACCCCACCAAGCTCACAAA
AATTGACAGATAATATCAAGACTAAGAAACCACCACAAGAAAAACAGGCA
CCTGTTAAAAAACTACCTGTCAAAAGGTCTCCAAAAGTATCACCTCCCAA
GAGAGAAGCTGTAAAAGATTCACCACTGAAAGAAAATCCTTTTAGAAAAT
CTATCGTCCAAGCAAAGAGTAAACCAGTActgacaaaacagaaaaatttg
aGTAAAGAGAATATTGAAGAATTGAGCACAAGTGAGGAAAAAGATTCCCC
AAAGAAGacattcaaattcaaagggaTCACATTTGATGCCAAGACTGAAG
ATGATGATAGCAGTGATTCTGATTCAGACAGCTCATCAAATTCTGATTca
gGGTCGTCAAGTGATAGCAGTGACAACAGTGGAacagaagaagaaattga
agataTTGAAGACGAAGACGATGACGATACTGCATCTCAAACAAGTTCAG
TTACAAGCTCTCCTGCAAAGAAAACACAAAGAGCTGGTCAAAAACGAAAA
GCAGTTCCTGACAATGCAGAGGtGATTGCCAGTTTGAAGAAACGAAAAGT
TGTTGATTTGGATTTGATAAAAGCGCCATTAAAATTTggATGGAGAAGGC
AGACAAGACTCAGACCGAACAATGCTGGTGATGGGCTGAGGGGAGATGTT
TATTATTATTCACCTTGTGGGAAAAAGCTGAGGACGTATCCTGAGTTAAA
CAGTtACATCTTTCGAAATGATGTCGTTGATGTAGACTTGAAGAATTTCA
GCTTTTCAACCAAACTTCGTGTTGGCGAATTCATGCAGGCTAAGGATGGT
TCAAAGTTTGTGACACTGACTGAAGAAGAGATCGATGAAACATTTGTTAT
GATGGAAGAAAGGAGAAGTGCTTCTGCAAAAAGAGCTGaagaaaagaaga
gagaaaaacgTGAAAAGGAGGAGAAGCAACGTCAGATACTTGAGGAGAGA
AAAAAGAAGAGAGAAGAAGCCTTGGAAAGAAAGAGATCGAAAGAAGAAGA
AAGGAGAAAGGTTCAAAAAGACAAAGCATTGGAAGCAAAGATGAAGAAGG
AGAAAGAAAAGGAAGCAGCACAAGAAGCCAAACGATTGAAAGAGGAGGCA
ATAATGTTGAAGAAACTAGAAAGGCAAGCTCAAATGGAAGCAAGTCGAAT
TGCCAAGCGTGAGAAAGTTCAAAATATGTTGGCTGAAAAGCAGAAGATGA
AAGAACAAAGAGAACATGAACGAGTCATGAAGATTGAGAACCAAAAAGTG
gagaaagaaatgaaattacAAGCAATCGAAAATgaGAAGGAACGTAAAAG
GCTGCAACAAGTGAAAAGTAAAGTATCAGAAAAAGAAAAGCGAAAACGAG
AGCTGGTCATGATGAAAGCTTATGAAGCACAACGGAGAGCTGAGGAGAGA
GAACGCCTCAAAGAACAAAAGAAGCTGGAGAAAACCTTGATCAGGCAACG
AAAATTGGAACAGAAAAGATATGAGCGCATGATCtctaaagaattgaaaa
aacctATCGATGATATGGCTCTGAATGATTTGAAGCCGTTGCCAGAGTTA
CCAAGGGTAACCAACATCAACATTCCTGGCAAAGCATATGCAGATATCCT
GATGGTTCAAGAGTTTGTTCACGCCTTTGGTCATGTCATTGATATCGATC
CAGAGAAGGAGTTTCCAAGCATGGGAGAGTTGCAATCATCATTGTTGTGT
GAATCTGGTAGCGATGAAGCAATCTTCACTGCATGCCAAGCACTTCTTTT
TTACGCCCTCTACGATCCCGGTGTATCTGGGCCTTATGCCAAAACTTCAC
TGGGTTCAGACCTTACGAGTATCGAATTGAACGAGAACAACATATCAGAA
GTATTACGTCTTTTCATCTTATCACGTAATGAAGGAAAACAACACACACT
CAGTGATCAGCTCACCAAATATCCTTTAGAAGCTCTCTCACCCAGTAGTA
AAGCTGCTGTTCTAGCTTTCATTGTCAACGAACTGCTTTGTGGAAAATCA
GTTAGCAGAGAGATTGACGGTAGCTTggagaacatttcaaatatgCGAAG
GGATAAATGGAACCTGGAAGGAGATATACGGAAaTTGAAAGCTGATCTAT
TATCAAAGCAACCCAAGAAAGCAGCCAGTGATCAACAACAGAAcctaaaa
aacaacaaaggaGAGTCGAAGAAAAGAGACTCTGACGAGGAGAACAATTC
GGACGATGAAGGAACCACTATCACCACTGCTAAGGAGAGCAATATCGATT
TAAACGACACTGCGGAAGACACAGAAGCTGAAAACCAGCCAGAGATGGTG
AATCCTACTACACTCGACCAAATGGAGAAGAAACTACGTTTGATGGAAAA
GAAACACGCTCGCTACCGTAAAAAGTTGTTCGATTCTTCACACACGATAC
GTGGTATAAATTTGGGTCAAGATCGATACCGGCGCCGTTATTTCGTGCTT
CCGAACGCCGGAGGGATTTACGTCGAAGGGCTGGAAAGTGGATTTTTTGA
CGAAGAAACGAACGTGAAAACAAAGGAAGAAAAGGAAGAATGCAAAGAAC
ATTTAGATAGTTTACTGACCACCTTGAAATCTCCAACTGTGTTGAAATCC
CCTGTGACTGGCCCCAAAACACCGGCCACAAATACACCGTCTGTATCAGC
ATTATCCTCAAATTCAAACGAACTTTTAAAACCGAAACAAGAGAGTCCTA
TAcaaacacaacaacaacaaaaacagataaaagtTGAGAATCCTTGTTCA
AGTGATAGTAGTTATGTCAAATCTTGGTTTTCCTTACGGACTAAAAAACG
TTGCGAGTCTTACAAAACTTCAGCTATACGTGAAACGCCTAAAGAGCGCA
AACATTCGCTCATCGTTGCACCGAGGATAGAACGACTTGCCGACGACCAC
CAATTCTTAGAATCTATATACTCTTGTTATTCCACTACTTCTCCTGGTGG
GAAAAACACTTTATTACCTGTCAGCAGATTTCCCTTATCCAAGGAAAGTA
TGCATCGGAACTCGTTACTAGGCTTACCGGCTGAATTGGATATGAATTTA
CTTATACAACAAGACCCACAAAAAGCAGCGGAAATTCTTGAAATACAGAC
TGCCAAGCCTCAAGAAATTCCGCCTGAAATGCAGGCGGGTTGGTGGCGGA
TCACCGATCCAGAACAAATGCAGCGCCTGAACAAGTGCGCCCACGCCAGG
GGTATGAGAGAACGGAACCTTCAAAAGACGGTGGTGCGATTCCAAGACTA
CACCAACTCATCGTGTAAAGTTGACCATCTTGCATtttctcTACTTCTCC
CCGACGAAGAAAGTGAAAGCAAAGACAAAGTAACAGAAGACGACAGCAGC
GTTGCCACATCAACGGATACAAACAAATCGATACAAGATAAATGGTATCC
ACAGCTGGCGTATGCAAGTGACAAAGCCATTTTGATTGAAGTCGAAGAAT
TAGAGGAAAAGGTCTTCTCGGCTAGTTTGCAAGTCAAGGGCTGGCGTTTG
TCTCAAAAGATCTCTCCAGCACTTCTGCTGAGCACGAGTAACGATCAAGC
TGAGTATGATCCACCCGAAGATAAATATCCCATCAGGATAGCGGCTTCCC
GTCTCCTAGCTCTTGAGCTCGGTATCGAACGACGTTACATGAAGCCTCCA
TTCCGTACACCAGACAGCCTTCCTAAACCGGACGCCCCAGAGGCTAAAGA
AGAACCAGTCAAGAATCCAAAAGCAACAGCCCAACTGGAGAAATGGCGTG
AAGCAGTAAGCGAAGCAAAATCGTCAGCTCAGCTATCGATGTGTATCACA
GCACTCTTCGAATGTGTCGCTTGGGAGAAGTCCATCATGAAAGTGTTCTG
CATACTATGTCGTAAAAGTGACAACGAAGAAAGATTGTTGCTATGCGACG
CATGTGATCGAGGCTGTCATACGTATTGTTGTAAGCCGAAATTCGATAAG
ATTCCCGATGGTGACTGGTTTTGTCAAGATTGTGTGTTGATGGCGTCTGG
TAGTGATCAGTGCTACAAATGTAAATCGAAGACCGGACGACGTCTGAAAT
GTGCATTCTGTCCACGTCATTATCACATGGACTGCCTTGAACCACCATTA
CACAAaACACCTCGTTCGCCTTGGAGTTGTCCCGTCTGCAAGAAAACACG
CTCCAAGAGTAAACCTCCTCAACGTAAAAAACCACGCGCCGAAGAACTTC
TCAAGAAAGAGGAACAGAGCAAACAAAAATCCATGTCCAACAGCCGTGTG
CAGACGTCCAAAGACATGGAACCGTGTCGTTTCATATTGAACGAAATGGA
AAATCACGAATCGTCATGGCCCTTTCTCGTCCCTGTCAATATGAAGCAGT
TTCCAGAGTATTATAAAGTGATCAAGCATCCGATGGATTTCCATACCATG
AAAACGAAGCTGCGTGATTACCAATACAAGTCAAAAGAAGAGTTCGCACG
TGACGCGCGGTTGGTGTTTTTCAATTGTAAAACGTACAACGAAGACGAAT
CGGAGGTTGGATGTGCAGGTGAAGCGATGCGAagtttcttcgagaaacgt
tgGACCGCCCTCAAAAAGGGTGTCTCTTCCACAAACAGTGATAACAAATT
CCACACCAACAAGAAGGGGGAGGGTGTGGAATCATCAGGCGATGAAGGAG
AAGACGCTCAGGAGGAGGGTGAAGGCGATGAAGAAGTATCCAGTTCGAGT
TCTGAAGAAATCTCATCCGAAAGTGAGAGCAGCGAAGTGGAGGAGGACAG
TGAAAACGAGACCGACTCAAAAACATGAATGGACAATCGTTCCGGTGGTC
AAGGCAACCCATATGATCGACCTTACTATGGGGACCCAAATGTCTTGAGA
CAACAAATTCCTGGGTATGCTAACTCTCCTGGAATTTATCCATATTCCCA
GCAGCAGCAACAAGATGGTTTTTCAGGGCGACGACCAGGGCAAGACCAGC
TTGGTCTCAATAATCATGCTACCGCCAGAACCAACAGCTTGACTTCACCT
CCACAATCAACCAATCCTTGGATGCACTCTTACCACAATCAAACACAACC
AAATTCTATGAGCCCTAATTTCAATATGAACATACCGAATATGTTTCATA
CAAGGTGGGAACAAGACCAAGCCTCACTTCTACAACAAAGAGAAATGATG
CAAAGAGAAGAACATGCAAGGATGATGTATCGAGAGCGCTTGCAAATGCA
AGAGAGAGAAAATCAGTTGAAAATCCAGATGCAGAAGGAGCAAGAGCGAG
AGTTGCAACTTCAGCGTGAAAAAGAAGCACAACTTCAGCGTGAAAGGGAA
GCAAAGGTTCAAAGAGAACGTGAAGCCCAATTAGAAAGAGAGCGACAAGC
TCAACTTCAAAGAGAACGACAAGCTGCTCTGGAGAAAGAAAGACAGCTAC
AGTTGCAGAGGGAAAGAGAAGCTCAATTACAAAGAGAAGCTCAATTACAA
TATCAGATGCAAAGAGAAATGCAACTTGAAAGAGAAAGAGAAGCAATGGC
AATAAGAGAAAGAGATGCAATCCTTGAACGAGATAGAAAAGCAATGCTCT
ACAGAGATGCTTATTTTGCACAACAACATCAACCACAGCAATttccaaac
cattttggttccaTGCAAAATACATTGCCTAATTTGAATTTCACACAATC
CAATGAGTCAATGTCTAATCAATTTAACTTCTATAACCAGCCCAGTATGC
ATTCAAATGGTAATCTTCCTAGCAGTACATCGTCTTCTATACTAAACTTC
TCAATGGATCAAATTTTCAACCCTAATAAGATATCTGAGTCACCTGTCTC
CAAAGCAGCAAGTACCAGTTCTTCCTTTCACTTTCCAATCTCATCACCTT
CCACCGTCAGCTCAACAACAACTTCATCAACAACGACAACCACAACTGCT
TTACGTAAAAGCTCATCTAACTCATTTGACAATGGAATTATAAATAGTAT
TGTTTCTGATAAGGGATTTTTAACCTCACCCTTGGACAGTAATAGTCAAT
TCATGAAAACATGGCAAGAACTACAGGATATGGATTTGagtgaaattgag
aaaaatgtcCTTGGACCTAAAGATCAAGATTCCCGAAACACTCCATTAGC
AGATACTCCATTTTCAAACCCTACTACACCAACAGAAATGAATGGGCTGC
CACCAAAACCAATTGATTCTAACTTGAATAACATTGTTAATTCTCTACCT
GAAAACTCTCTGGATTTAAATAAGCATTccattgaaacaaaagaatcttt
ACAAATAACAAACACTGAAGATACACCACCACAACAGAATCTATTGAATC
ATCCAAGAAATTTATTATCAGTATCTCAAACAGCTCAAGCTAGCTCCAAT
TATACAAACACCAGTGTAACGCAATCAGACATAAACTTGACACATGTATC
AGAAAATTTACTTACCCATAATAGGTCTTGCGTTTCTTCATTTGTTTCGC
CTACGTCATCAGATTTGTATTGCAATCAAGATTTTGATAAGCAATCAAAA
CGAGGAGATGATATCAAGCATGAAGAATATTCTAATGAACTTCAAAGCAA
TCACTCAAAATCATATGAAAAACAATCATCATCTTCACCTAcaacattaa
aacaaaaatcaaaacaatcatttAGTAGTATTGAAAGTTTCCTTGGTATG
AGCAGCGATAGTAAAAAAACTGAAGATAATGATAATGAAAGGATTAATGA
CACCACTAAAAAGCGAGAAAGGATCCCATCAAGTGATGTACAAGATCGAA
TTTCAGTCATAAAACCATTACCAATTTCATCACCACAAATTTCAAACACA
TCCTCTCCTTTGGATATTGTGAATAATGATCATGACACATTGAAAAGTCC
ACAAGCAATTGAAAAGCTGAAATCTcctgaagaaattcaaaaagtaaTAG
ATCATTCTGAATCTGCACCTGTCACACTCATCCATCCATCTATGCGCCTC
AAAAAGCAAAGAAGTCTATCAAACAGTTCAATGACTGCCACCAGTCCACA
ACCCGTTATGGAAaaggaaaaaccaaaaacaagtAATAGACGACCGTTAC
ATCCTTCTATGCGATTACAGACcaataaaaataatacaaaagTTGATAAA
GCTGAACCTAAAAAGAGTAAGGTTGAAAATCTTGATAACAGTTTTGACAG
TGGAAAGAATATCTTACACAGTCCAAAAACTGGGCGTTATCAATCTGAAC
TTACAAGTACTTCCACCAAATCTTCAACTAGGAAGTTATCTCCGTTCACT
CCTCCAACTGTTACATCACCTTTAACCTCACCACCACTAGTATCACCTGG
AATTCGAAGTCCCTTCAATGGAAAACCCCTCACTGGAAAACCATTCTCAA
CTGGTAAGCCTGTTCATGGAGGAAAACCAGCATCTTATTCAGCTCAAGGT
GGTGGTAAACCAATGCATATGGGAGGGAAACCGACTAGTTTCTCTTCACA
TATGACTGTCAAAGAGGAAAAGTCACCAGAAAAAGAGCACACTGGCAAAC
CTTTATCTTTTTTGAAGTCCATGGTAgaagaatcttccaaaaacaCAAAC
ACACTTCAAGGGAAAAAGATCACTGGCAAGAAAAGACCCAGAAAGGAAAC
TATCGAGAAACCAGCttcaaaagaaactttaaaaaaagatgACATATCAA
AATCCCCTGACTTGAAAACAAGTCGTATAACAAAAATGATATCAACCCCA
CCAAGCTCACAAAAATTGACAGATAATATCAAGACTAAGAAACCACCACA
AGAAAAACAGGCACCTGTTAAAAAACTACCTGTCAAAAGGTCTCCAAAAG
TATCACCTCCCAAGAGAGAAGCTGTAAAAGATTCACCACTGAAAGAAAAT
CCTTTTAGAAAATCTATCGTCCAAGCAAAGAGTAAACCAGTActgacaaa
acagaaaaatttgaGTAAAGAGAATATTGAAGAATTGAGCACAAGTGAGG
AAAAAGATTCCCCAAAGAAGacattcaaattcaaagggaTCACATTTGAT
GCCAAGACTGAAGATGATGATAGCAGTGATTCTGATTCAGACAGCTCATC
AAATTCTGATTcagGGTCGTCAAGTGATAGCAGTGACAACAGTGGAacag
aagaagaaattgaagataTTGAAGACGAAGACGATGACGATACTGCATCT
CAAACAAGTTCAGTTACAAGCTCTCCTGCAAAGAAAACACAAAGAGCTGG
TCAAAAACGAAAAGCAGTTCCTGACAATGCAGAGGtGATTGCCAGTTTGA
AGAAACGAAAAGTTGTTGATTTGGATTTGATAAAAGCGCCATTAAAATTT
ggATGGAGAAGGCAGACAAGACTCAGACCGAACAATGCTGGTGATGGGCT
GAGGGGAGATGTTTATTATTATTCACCTTGTGGGAAAAAGCTGAGGACGT
ATCCTGAGTTAAACAGTtACATCTTTCGAAATGATGTCGTTGATGTAGAC
TTGAAGAATTTCAGCTTTTCAACCAAACTTCGTGTTGGCGAATTCATGCA
GGCTAAGGATGGTTCAAAGTTTGTGACACTGACTGAAGAAGAGATCGATG
AAACATTTGTTATGATGGAAGAAAGGAGAAGTGCTTCTGCAAAAAGAGCT
GaagaaaagaagagagaaaaacgTGAAAAGGAGGAGAAGCAACGTCAGAT
ACTTGAGGAGAGAAAAAAGAAGAGAGAAGAAGCCTTGGAAAGAAAGAGAT
CGAAAGAAGAAGAAAGGAGAAAGGTTCAAAAAGACAAAGCATTGGAAGCA
AAGATGAAGAAGGAGAAAGAAAAGGAAGCAGCACAAGAAGCCAAACGATT
GAAAGAGGAGGCAATAATGTTGAAGAAACTAGAAAGGCAAGCTCAAATGG
AAGCAAGTCGAATTGCCAAGCGTGAGAAAGTTCAAAATATGTTGGCTGAA
AAGCAGAAGATGAAAGAACAAAGAGAACATGAACGAGTCATGAAGATTGA
GAACCAAAAAGTGgagaaagaaatgaaattacAAGCAATCGAAAATgaGA
AGGAACGTAAAAGGCTGCAACAAGTGAAAAGTAAAGTATCAGAAAAAGAA
AAGCGAAAACGAGAGCTGGTCATGATGAAAGCTTATGAAGCACAACGGAG
AGCTGAGGAGAGAGAACGCCTCAAAGAACAAAAGAAGCTGGAGAAAACCT
TGATCAGGCAACGAAAATTGGAACAGAAAAGATATGAGCGCATGATCtct
aaagaattgaaaaaacctATCGATGATATGGCTCTGAATGATTTGAAGCC
GTTGCCAGAGTTACCAAGGGTAACCAACATCAACATTCCTGGCAAAGCAT
ATGCAGATATCCTGATGGTTCAAGAGTTTGTTCACGCCTTTGGTCATGTC
ATTGATATCGATCCAGAGAAGGAGTTTCCAAGCATGGGAGAGTTGCAATC
ATCATTGTTGTGTGAATCTGGTAGCGATGAAGCAATCTTCACTGCATGCC
AAGCACTTCTTTTTTACGCCCTCTACGATCCCGGTGTATCTGGGCCTTAT
GCCAAAACTTCACTGGGTTCAGACCTTACGAGTATCGAATTGAACGAGAA
CAACATATCAGAAGTATTACGTCTTTTCATCTTATCACGTAATGAAGGAA
AACAACACACACTCAGTGATCAGCTCACCAAATATCCTTTAGAAGCTCTC
TCACCCAGTAGTAAAGCTGCTGTTCTAGCTTTCATTGTCAACGAACTGCT
TTGTGGAAAATCAGTTAGCAGAGAGATTGACGGTAGCTTggagaacattt
caaatatgCGAAGGGATAAATGGAACCTGGAAGGAGATATACGGAAaTTG
AAAGCTGATCTATTATCAAAGCAACCCAAGAAAGCAGCCAGTGATCAACA
ACAGAAcctaaaaaacaacaaaggaGAGTCGAAGAAAAGAGACTCTGACG
AGGAGAACAATTCGGACGATGAAGGAACCACTATCACCACTGCTAAGGAG
AGCAATATCGATTTAAACGACACTGCGGAAGACACAGAAGCTGAAAACCA
GCCAGAGATGGTGAATCCTACTACACTCGACCAAATGGAGAAGAAACTAC
GTTTGATGGAAAAGAAACACGCTCGCTACCGTAAAAAGTTGTTCGATTCT
TCACACACGATACGTGGTATAAATTTGGGTCAAGATCGATACCGGCGCCG
TTATTTCGTGCTTCCGAACGCCGGAGGGATTTACGTCGAAGGGCTGGAAA
GTGGATTTTTTGACGAAGAAACGAACGTGAAAACAAAGGAAGAAAAGGAA
GAATGCAAAGAACATTTAGATAGTTTACTGACCACCTTGAAATCTCCAAC
TGTGTTGAAATCCCCTGTGACTGGCCCCAAAACACCGGCCACAAATACAC
CGTCTGTATCAGCATTATCCTCAAATTCAAACGAACTTTTAAAACCGAAA
CAAGAGAGTCCTATAcaaacacaacaacaacaaaaacagataaaagtTGA
GAATCCTTGTTCAAGTGATAGTAGTTATGTCAAATCTTGGTTTTCCTTAC
GGACTAAAAAACGTTGCGAGTCTTACAAAACTTCAGCTATACGTGAAACG
CCTAAAGAGCGCAAACATTCGCTCATCGTTGCACCGAGGATAGAACGACT
TGCCGACGACCACCAATTCTTAGAATCTATATACTCTTGTTATTCCACTA
CTTCTCCTGGTGGGAAAAACACTTTATTACCTGTCAGCAGATTTCCCTTA
TCCAAGGAAAGTATGCATCGGAACTCGTTACTAGGCTTACCGGCTGAATT
GGATATGAATTTACTTATACAACAAGACCCACAAAAAGCAGCGGAAATTC
TTGAAATACAGACTGCCAAGCCTCAAGAAATTCCGCCTGAAATGCAGGCG
GGTTGGTGGCGGATCACCGATCCAGAACAAATGCAGCGCCTGAACAAGTG
CGCCCACGCCAGGGGTATGAGAGAACGGAACCTTCAAAAGACGGTGGTGC
GATTCCAAGACTACACCAACTCATCGTGTAAAGTTGACCATCTTGCATtt
tctcTACTTCTCCCCGACGAAGAAAGTGAAAGCAAAGACAAAGTAACAGA
AGACGACAGCAGCGTTGCCACATCAACGGATACAAACAAATCGATACAAG
ATAAATGGTATCCACAGCTGGCGTATGCAAGTGACAAAGCCATTTTGATT
GAAGTCGAAGAATTAGAGGAAAAGGTCTTCTCGGCTAGTTTGCAAGTCAA
GGGCTGGCGTTTGTCTCAAAAGATCTCTCCAGCACTTCTGCTGAGCACGA
GTAACGATCAAGCTGAGTATGATCCACCCGAAGATAAATATCCCATCAGG
ATAGCGGCTTCCCGTCTCCTAGCTCTTGAGCTCGGTATCGAACGACGTTA
CATGAAGCCTCCATTCCGTACACCAGACAGCCTTCCTAAACCGGACGCCC
CAGAGGCTAAAGAAGAACCAGTCAAGAATCCAAAAGCAACAGCCCAACTG
GAGAAATGGCGTGAAGCAGTAAGCGAAGCAAAATCGTCAGCTCAGCTATC
GATGTGTATCACAGCACTCTTCGAATGTGTCGCTTGGGAGAAGTCCATCA
TGAAAGTGTTCTGCATACTATGTCGTAAAAGTGACAACGAAGAAAGATTG
TTGCTATGCGACGCATGTGATCGAGGCTGTCATACGTATTGTTGTAAGCC
GAAATTCGATAAGATTCCCGATGGTGACTGGTTTTGTCAAGATTGTGTGT
TGATGGCGTCTGGTAGTGATCAGTGCTACAAATGTAAATCGAAGACCGGA
CGACGTCTGAAATGTGCATTCTGTCCACGTCATTATCACATGGACTGCCT
TGAACCACCATTACACAAaACACCTCGTTCGCCTTGGAGTTGTCCCGTCT
GCAAGAAAACACGCTCCAAGAGTAAACCTCCTCAACGTAAAAAACCACGC
GCCGAAGAACTTCTCAAGAAAGAGGAACAGAGCAAACAAAAATCCATGTC
CAACAGCCGTGTGCAGACGTCCAAAGACATGGAACCGTGTCGTTTCATAT
TGAACGAAATGGAAAATCACGAATCGTCATGGCCCTTTCTCGTCCCTGTC
AATATGAAGCAGTTTCCAGAGTATTATAAAGTGATCAAGCATCCGATGGA
TTTCCATACCATGAAAACGAAGCTGCGTGATTACCAATACAAGTCAAAAG
AAGAGTTCGCACGTGACGCGCGGTTGGTGTTTTTCAATTGTAAAACGTAC
AACGAAGACGAATCGGAGGTTGGATGTGCAGGTGAAGCGATGCGAagttt
cttcgagaaacgttgGACCGCCCTCAAAAAGGGTGTCTCTTCCACAAACA
GTGATAACAAATTCCACACCAACAAGAAGGGGGAGGGTGTGGAATCATCA
GGCGATGAAGGAGAAGACGCTCAGGAGGAGGGTGAAGGCGATGAAGAAGT
ATCCAGTTCGAGTTCTGAAGAAATCTCATCCGAAAGTGAGAGCAGCGAAG
TGGAGGAGGACAGTGAAAACGAGACCGACTCAAAAACATGAATGGACAAT
CGTTCCGGTGGTCAAGGCAACCCATATGATCGACCTTACTATGGGGACCC
AAATGTCTTGAGACAACAAATTCCTGGGTATGCTAACTCTCCTGGAATTT
ATCCATATTCCCAGCAGCAGCAACAAGATGGTTTTTCAGGGCGACGACCA
GGGCAAGACCAGCTTGGTCTCAATAATCATGCTACCGCCAGAACCAACAG
CTTGACTTCACCTCCACAATCAACCAATCCTTGGATGCACTCTTACCACA
ATCAAACACAACCAAATTCTATGAGCCCTAATTTCAATATGAACATACCG
AATATGTTTCATACAAGGTGGGAACAAGACCAAGCCTCACTTCTACAACA
AAGAGAAATGATGCAAAGAGAAGAACATGCAAGGATGATGTATCGAGAGC
GCTTGCAAATGCAAGAGAGAGAAAATCAGTTGAAAATCCAGATGCAGAAG
GAGCAAGAGCGAGAGTTGCAACTTCAGCGTGAAAAAGAAGCACAACTTCA
GCGTGAAAGGGAAGCAAAGGTTCAAAGAGAACGTGAAGCCCAATTAGAAA
GAGAGCGACAAGCTCAACTTCAAAGAGAACGACAAGCTGCTCTGGAGAAA
GAAAGACAGCTACAGTTGCAGAGGGAAAGAGAAGCTCAATTACAAAGAGA
AGCTCAATTACAATATCAGATGCAAAGAGAAATGCAACTTGAAAGAGAAA
GAGAAGCAATGGCAATAAGAGAAAGAGATGCAATCCTTGAACGAGATAGA
AAAGCAATGCTCTACAGAGATGCTTATTTTGCACAACAACATCAACCACA
GCAATttccaaaccattttggttccaTGCAAAATACATTGCCTAATTTGA
ATTTCACACAATCCAATGAGTCAATGTCTAATCAATTTAACTTCTATAAC
CAGCCCAGTATGCATTCAAATGGTAATCTTCCTAGCAGTACATCGTCTTC
TATACTAAACTTCTCAATGGATCAAATTTTCAACCCTAATAAGATATCTG
AGTCACCTGTCTCCAAAGCAGCAAGTACCAGTTCTTCCTTTCACTTTCCA
ATCTCATCACCTTCCACCGTCAGCTCAACAACAACTTCATCAACAACGAC
AACCACAACTGCTTTACGTAAAAGCTCATCTAACTCATTTGACAATGGAA
TTATAAATAGTATTGTTTCTGATAAGGGATTTTTAACCTCACCCTTGGAC
AGTAATAGTCAATTCATGAAAACATGGCAAGAACTACAGGATATGGATTT
GagtgaaattgagaaaaatgtcCTTGGACCTAAAGATCAAGATTCCCGAA
ACACTCCATTAGCAGATACTCCATTTTCAAACCCTACTACACCAACAGAA
ATGAATGGGCTGCCACCAAAACCAATTGATTCTAACTTGAATAACATTGT
TAATTCTCTACCTGAAAACTCTCTGGATTTAAATAAGCATTccattgaaa
caaaagaatctttACAAATAACAAACACTGAAGATACACCACCACAACAG
AATCTATTGAATCATCCAAGAAATTTATTATCAGTATCTCAAACAGCTCA
AGCTAGCTCCAATTATACAAACACCAGTGTAACGCAATCAGACATAAACT
TGACACATGTATCAGAAAATTTACTTACCCATAATAGGTCTTGCGTTTCT
TCATTTGTTTCGCCTACGTCATCAGATTTGTATTGCAATCAAGATTTTGA
TAAGCAATCAAAACGAGGAGATGATATCAAGCATGAAGAATATTCTAATG
AACTTCAAAGCAATCACTCAAAATCATATGAAAAACAATCATCATCTTCA
CCTAcaacattaaaacaaaaatcaaaacaatcatttAGTAGTATTGAAAG
TTTCCTTGGTATGAGCAGCGATAGTAAAAAAACTGAAGATAATGATAATG
AAAGGATTAATGACACCACTAAAAAGCGAGAAAGGATCCCATCAAGTGAT
GTACAAGATCGAATTTCAGTCATAAAACCATTACCAATTTCATCACCACA
AATTTCAAACACATCCTCTCCTTTGGATATTGTGAATAATGATCATGACA
CATTGAAAAGTCCACAAGCAATTGAAAAGCTGAAATCTcctgaagaaatt
caaaaagtaaTAGATCATTCTGAATCTGCACCTGTCACACTCATCCATCC
ATCTATGCGCCTCAAAAAGCAAAGAAGTCTATCAAACAGTTCAATGACTG
CCACCAGTCCACAACCCGTTATGGAAaaggaaaaaccaaaaacaagtAAT
AGACGACCGTTACATCCTTCTATGCGATTACAGACcaataaaaataatac
aaaagTTGATAAAGCTGAACCTAAAAAGAGTAAGGTTGAAAATCTTGATA
ACAGTTTTGACAGTGGAAAGAATATCTTACACAGTCCAAAAACTGGGCGT
TATCAATCTGAACTTACAAGTACTTCCACCAAATCTTCAACTAGGAAGTT
ATCTCCGTTCACTCCTCCAACTGTTACATCACCTTTAACCTCACCACCAC
TAGTATCACCTGGAATTCGAAGTCCCTTCAATGGAAAACCCCTCACTGGA
AAACCATTCTCAACTGGTAAGCCTGTTCATGGAGGAAAACCAGCATCTTA
TTCAGCTCAAGGTGGTGGTAAACCAATGCATATGGGAGGGAAACCGACTA
GTTTCTCTTCACATATGACTGTCAAAGAGGAAAAGTCACCAGAAAAAGAG
CACACTGGCAAACCTTTATCTTTTTTGAAGTCCATGGTAgaagaatcttc
caaaaacaCAAACACACTTCAAGGGAAAAAGATCACTGGCAAGAAAAGAC
CCAGAAAGGAAACTATCGAGAAACCAGCttcaaaagaaactttaaaaaaa
gatgACATATCAAAATCCCCTGACTTGAAAACAAGTCGTATAACAAAAAT
GATATCAACCCCACCAAGCTCACAAAAATTGACAGATAATATCAAGACTA
AGAAACCACCACAAGAAAAACAGGCACCTGTTAAAAAACTACCTGTCAAA
AGGTCTCCAAAAGTATCACCTCCCAAGAGAGAAGCTGTAAAAGATTCACC
ACTGAAAGAAAATCCTTTTAGAAAATCTATCGTCCAAGCAAAGAGTAAAC
CAGTActgacaaaacagaaaaatttgaGTAAAGAGAATATTGAAGAATTG
AGCACAAGTGAGGAAAAAGATTCCCCAAAGAAGacattcaaattcaaagg
gaTCACATTTGATGCCAAGACTGAAGATGATGATAGCAGTGATTCTGATT
CAGACAGCTCATCAAATTCTGATTcagGGTCGTCAAGTGATAGCAGTGAC
AACAGTGGAacagaagaagaaattgaagataTTGAAGACGAAGACGATGA
CGATACTGCATCTCAAACAAGTTCAGTTACAAGCTCTCCTGCAAAGAAAA
CACAAAGAGCTGGTCAAAAACGAAAAGCAGTTCCTGACAATGCAGAGGtG
ATTGCCAGTTTGAAGAAACGAAAAGTTGTTGATTTGGATTTGATAAAAGC
GCCATTAAAATTTggATGGAGAAGGCAGACAAGACTCAGACCGAACAATG
CTGGTGATGGGCTGAGGGGAGATGTTTATTATTATTCACCTTGTGGGAAA
AAGCTGAGGACGTATCCTGAGTTAAACAGTtACATCTTTCGAAATGATGT
CGTTGATGTAGACTTGAAGAATTTCAGCTTTTCAACCAAACTTCGTGTTG
GCGAATTCATGCAGGCTAAGGATGGTTCAAAGTTTGTGACACTGACTGAA
GAAGAGATCGATGAAACATTTGTTATGATGGAAGAAAGGAGAAGTGCTTC
TGCAAAAAGAGCTGaagaaaagaagagagaaaaacgTGAAAAGGAGGAGA
AGCAACGTCAGATACTTGAGGAGAGAAAAAAGAAGAGAGAAGAAGCCTTG
GAAAGAAAGAGATCGAAAGAAGAAGAAAGGAGAAAGGTTCAAAAAGACAA
AGCATTGGAAGCAAAGATGAAGAAGGAGAAAGAAAAGGAAGCAGCACAAG
AAGCCAAACGATTGAAAGAGGAGGCAATAATGTTGAAGAAACTAGAAAGG
CAAGCTCAAATGGAAGCAAGTCGAATTGCCAAGCGTGAGAAAGTTCAAAA
TATGTTGGCTGAAAAGCAGAAGATGAAAGAACAAAGAGAACATGAACGAG
TCATGAAGATTGAGAACCAAAAAGTGgagaaagaaatgaaattacAAGCA
ATCGAAAATgaGAAGGAACGTAAAAGGCTGCAACAAGTGAAAAGTAAAGT
ATCAGAAAAAGAAAAGCGAAAACGAGAGCTGGTCATGATGAAAGCTTATG
AAGCACAACGGAGAGCTGAGGAGAGAGAACGCCTCAAAGAACAAAAGAAG
CTGGAGAAAACCTTGATCAGGCAACGAAAATTGGAACAGAAAAGATATGA
GCGCATGATCtctaaagaattgaaaaaacctATCGATGATATGGCTCTGA
ATGATTTGAAGCCGTTGCCAGAGTTACCAAGGGTAACCAACATCAACATT
CCTGGCAAAGCATATGCAGATATCCTGATGGTTCAAGAGTTTGTTCACGC
CTTTGGTCATGTCATTGATATCGATCCAGAGAAGGAGTTTCCAAGCATGG
GAGAGTTGCAATCATCATTGTTGTGTGAATCTGGTAGCGATGAAGCAATC
TTCACTGCATGCCAAGCACTTCTTTTTTACGCCCTCTACGATCCCGGTGT
ATCTGGGCCTTATGCCAAAACTTCACTGGGTTCAGACCTTACGAGTATCG
AATTGAACGAGAACAACATATCAGAAGTATTACGTCTTTTCATCTTATCA
CGTAATGAAGGAAAACAACACACACTCAGTGATCAGCTCACCAAATATCC
TTTAGAAGCTCTCTCACCCAGTAGTAAAGCTGCTGTTCTAGCTTTCATTG
TCAACGAACTGCTTTGTGGAAAATCAGTTAGCAGAGAGATTGACGGTAGC
TTggagaacatttcaaatatgCGAAGGGATAAATGGAACCTGGAAGGAGA
TATACGGAAaTTGAAAGCTGATCTATTATCAAAGCAACCCAAGAAAGCAG
CCAGTGATCAACAACAGAAcctaaaaaacaacaaaggaGAGTCGAAGAAA
AGAGACTCTGACGAGGAGAACAATTCGGACGATGAAGGAACCACTATCAC
CACTGCTAAGGAGAGCAATATCGATTTAAACGACACTGCGGAAGACACAG
AAGCTGAAAACCAGCCAGAGATGGTGAATCCTACTACACTCGACCAAATG
GAGAAGAAACTACGTTTGATGGAAAAGAAACACGCTCGCTACCGTAAAAA
GTTGTTCGATTCTTCACACACGATACGTGGTATAAATTTGGGTCAAGATC
GATACCGGCGCCGTTATTTCGTGCTTCCGAACGCCGGAGGGATTTACGTC
GAAGGGCTGGAAAGTGGATTTTTTGACGAAGAAACGAACGTGAAAACAAA
GGAAGAAAAGGAAGAATGCAAAGAACATTTAGATAGTTTACTGACCACCT
TGAAATCTCCAACTGTGTTGAAATCCCCTGTGACTGGCCCCAAAACACCG
GCCACAAATACACCGTCTGTATCAGCATTATCCTCAAATTCAAACGAACT
TTTAAAACCGAAACAAGAGAGTCCTATAcaaacacaacaacaacaaaaac
agataaaagtTGAGAATCCTTGTTCAAGTGATAGTAGTTATGTCAAATCT
TGGTTTTCCTTACGGACTAAAAAACGTTGCGAGTCTTACAAAACTTCAGC
TATACGTGAAACGCCTAAAGAGCGCAAACATTCGCTCATCGTTGCACCGA
GGATAGAACGACTTGCCGACGACCACCAATTCTTAGAATCTATATACTCT
TGTTATTCCACTACTTCTCCTGGTGGGAAAAACACTTTATTACCTGTCAG
CAGATTTCCCTTATCCAAGGAAAGTATGCATCGGAACTCGTTACTAGGCT
TACCGGCTGAATTGGATATGAATTTACTTATACAACAAGACCCACAAAAA
GCAGCGGAAATTCTTGAAATACAGACTGCCAAGCCTCAAGAAATTCCGCC
TGAAATGCAGGCGGGTTGGTGGCGGATCACCGATCCAGAACAAATGCAGC
GCCTGAACAAGTGCGCCCACGCCAGGGGTATGAGAGAACGGAACCTTCAA
AAGACGGTGGTGCGATTCCAAGACTACACCAACTCATCGTGTAAAGTTGA
CCATCTTGCATtttctcTACTTCTCCCCGACGAAGAAAGTGAAAGCAAAG
ACAAAGTAACAGAAGACGACAGCAGCGTTGCCACATCAACGGATACAAAC
AAATCGATACAAGATAAATGGTATCCACAGCTGGCGTATGCAAGTGACAA
AGCCATTTTGATTGAAGTCGAAGAATTAGAGGAAAAGGTCTTCTCGGCTA
GTTTGCAAGTCAAGGGCTGGCGTTTGTCTCAAAAGATCTCTCCAGCACTT
CTGCTGAGCACGAGTAACGATCAAGCTGAGTATGATCCACCCGAAGATAA
ATATCCCATCAGGATAGCGGCTTCCCGTCTCCTAGCTCTTGAGCTCGGTA
TCGAACGACGTTACATGAAGCCTCCATTCCGTACACCAGACAGCCTTCCT
AAACCGGACGCCCCAGAGGCTAAAGAAGAACCAGTCAAGAATCCAAAAGC
AACAGCCCAACTGGAGAAATGGCGTGAAGCAGTAAGCGAAGCAAAATCGT
CAGCTCAGCTATCGATGTGTATCACAGCACTCTTCGAATGTGTCGCTTGG
GAGAAGTCCATCATGAAAGTGTTCTGCATACTATGTCGTAAAAGTGACAA
CGAAGAAAGATTGTTGCTATGCGACGCATGTGATCGAGGCTGTCATACGT
ATTGTTGTAAGCCGAAATTCGATAAGATTCCCGATGGTGACTGGTTTTGT
CAAGATTGTGTGTTGATGGCGTCTGGTAGTGATCAGTGCTACAAATGTAA
ATCGAAGACCGGACGACGTCTGAAATGTGCATTCTGTCCACGTCATTATC
ACATGGACTGCCTTGAACCACCATTACACAAaACACCTCGTTCGCCTTGG
AGTTGTCCCGTCTGCAAGAAAACACGCTCCAAGAGTAAACCTCCTCAACG
TAAAAAACCACGCGCCGAAGAACTTCTCAAGAAAGAGGAACAGAGCAAAC
AAAAATCCATGTCCAACAGCCGTGTGCAGACGTCCAAAGACATGGAACCG
TGTCGTTTCATATTGAACGAAATGGAAAATCACGAATCGTCATGGCCCTT
TCTCGTCCCTGTCAATATGAAGCAGTTTCCAGAGTATTATAAAGTGATCA
AGCATCCGATGGATTTCCATACCATGAAAACGAAGCTGCGTGATTACCAA
TACAAGTCAAAAGAAGAGTTCGCACGTGACGCGCGGTTGGTGTTTTTCAA
TTGTAAAACGTACAACGAAGACGAATCGGAGGTTGGATGTGCAGGTGAAG
CGATGCGAagtttcttcgagaaacgttgGACCGCCCTCAAAAAGGGTGTC
TCTTCCACAAACAGTGATAACAAATTCCACACCAACAAGAAGGGGGAGGG
TGTGGAATCATCAGGCGATGAAGGAGAAGACGCTCAGGAGGAGGGTGAAG
GCGATGAAGAAGTATCCAGTTCGAGTTCTGAAGAAATCTCATCCGAAAGT
GAGAGCAGCGAAGTGGAGGAGGACAGTGAAAACGAGACCGACTCAAAAAC
ATGAATGGACAATCGTTCCGGTGGTCAAGGCAACCCATATGATCGACCTT
ACTATGGGGACCCAAATGTCTTGAGACAACAAATTCCTGGGTATGCTAAC
TCTCCTGGAATTTATCCATATTCCCAGCAGCAGCAACAAGATGGTTTTTC
AGGGCGACGACCAGGGCAAGACCAGCTTGGTCTCAATAATCATGCTACCG
CCAGAACCAACAGCTTGACTTCACCTCCACAATCAACCAATCCTTGGATG
CACTCTTACCACAATCAAACACAACCAAATTCTATGAGCCCTAATTTCAA
TATGAACATACCGAATATGTTTCATACAAGGTGGGAACAAGACCAAGCCT
CACTTCTACAACAAAGAGAAATGATGCAAAGAGAAGAACATGCAAGGATG
ATGTATCGAGAGCGCTTGCAAATGCAAGAGAGAGAAAATCAGTTGAAAAT
CCAGATGCAGAAGGAGCAAGAGCGAGAGTTGCAACTTCAGCGTGAAAAAG
AAGCACAACTTCAGCGTGAAAGGGAAGCAAAGGTTCAAAGAGAACGTGAA
GCCCAATTAGAAAGAGAGCGACAAGCTCAACTTCAAAGAGAACGACAAGC
TGCTCTGGAGAAAGAAAGACAGCTACAGTTGCAGAGGGAAAGAGAAGCTC
AATTACAAAGAGAAGCTCAATTACAATATCAGATGCAAAGAGAAATGCAA
CTTGAAAGAGAAAGAGAAGCAATGGCAATAAGAGAAAGAGATGCAATCCT
TGAACGAGATAGAAAAGCAATGCTCTACAGAGATGCTTATTTTGCACAAC
AACATCAACCACAGCAATttccaaaccattttggttccaTGCAAAATACA
TTGCCTAATTTGAATTTCACACAATCCAATGAGTCAATGTCTAATCAATT
TAACTTCTATAACCAGCCCAGTATGCATTCAAATGGTAATCTTCCTAGCA
GTACATCGTCTTCTATACTAAACTTCTCAATGGATCAAATTTTCAACCCT
AATAAGATATCTGAGTCACCTGTCTCCAAAGCAGCAAGTACCAGTTCTTC
CTTTCACTTTCCAATCTCATCACCTTCCACCGTCAGCTCAACAACAACTT
CATCAACAACGACAACCACAACTGCTTTACGTAAAAGCTCATCTAACTCA
TTTGACAATGGAATTATAAATAGTATTGTTTCTGATAAGGGATTTTTAAC
CTCACCCTTGGACAGTAATAGTCAATTCATGAAAACATGGCAAGAACTAC
AGGATATGGATTTGagtgaaattgagaaaaatgtcCTTGGACCTAAAGAT
CAAGATTCCCGAAACACTCCATTAGCAGATACTCCATTTTCAAACCCTAC
TACACCAACAGAAATGAATGGGCTGCCACCAAAACCAATTGATTCTAACT
TGAATAACATTGTTAATTCTCTACCTGAAAACTCTCTGGATTTAAATAAG
CATTccattgaaacaaaagaatctttACAAATAACAAACACTGAAGATAC
ACCACCACAACAGAATCTATTGAATCATCCAAGAAATTTATTATCAGTAT
CTCAAACAGCTCAAGCTAGCTCCAATTATACAAACACCAGTGTAACGCAA
TCAGACATAAACTTGACACATGTATCAGAAAATTTACTTACCCATAATAG
GTCTTGCGTTTCTTCATTTGTTTCGCCTACGTCATCAGATTTGTATTGCA
ATCAAGATTTTGATAAGCAATCAAAACGAGGAGATGATATCAAGCATGAA
GAATATTCTAATGAACTTCAAAGCAATCACTCAAAATCATATGAAAAACA
ATCATCATCTTCACCTAcaacattaaaacaaaaatcaaaacaatcatttA
GTAGTATTGAAAGTTTCCTTGGTATGAGCAGCGATAGTAAAAAAACTGAA
GATAATGATAATGAAAGGATTAATGACACCACTAAAAAGCGAGAAAGGAT
CCCATCAAGTGATGTACAAGATCGAATTTCAGTCATAAAACCATTACCAA
TTTCATCACCACAAATTTCAAACACATCCTCTCCTTTGGATATTGTGAAT
AATGATCATGACACATTGAAAAGTCCACAAGCAATTGAAAAGCTGAAATC
TcctgaagaaattcaaaaagtaaTAGATCATTCTGAATCTGCACCTGTCA
CACTCATCCATCCATCTATGCGCCTCAAAAAGCAAAGAAGTCTATCAAAC
AGTTCAATGACTGCCACCAGTCCACAACCCGTTATGGAAaaggaaaaacc
aaaaacaagtAATAGACGACCGTTACATCCTTCTATGCGATTACAGACca
ataaaaataatacaaaagTTGATAAAGCTGAACCTAAAAAGAGTAAGGTT
GAAAATCTTGATAACAGTTTTGACAGTGGAAAGAATATCTTACACAGTCC
AAAAACTGGGCGTTATCAATCTGAACTTACAAGTACTTCCACCAAATCTT
CAACTAGGAAGTTATCTCCGTTCACTCCTCCAACTGTTACATCACCTTTA
ACCTCACCACCACTAGTATCACCTGGAATTCGAAGTCCCTTCAATGGAAA
ACCCCTCACTGGAAAACCATTCTCAACTGGTAAGCCTGTTCATGGAGGAA
AACCAGCATCTTATTCAGCTCAAGGTGGTGGTAAACCAATGCATATGGGA
GGGAAACCGACTAGTTTCTCTTCACATATGACTGTCAAAGAGGAAAAGTC
ACCAGAAAAAGAGCACACTGGCAAACCTTTATCTTTTTTGAAGTCCATGG
TAgaagaatcttccaaaaacaCAAACACACTTCAAGGGAAAAAGATCACT
GGCAAGAAAAGACCCAGAAAGGAAACTATCGAGAAACCAGCttcaaaaga
aactttaaaaaaagatgACATATCAAAATCCCCTGACTTGAAAACAAGTC
GTATAACAAAAATGATATCAACCCCACCAAGCTCACAAAAATTGACAGAT
AATATCAAGACTAAGAAACCACCACAAGAAAAACAGGCACCTGTTAAAAA
ACTACCTGTCAAAAGGTCTCCAAAAGTATCACCTCCCAAGAGAGAAGCTG
TAAAAGATTCACCACTGAAAGAAAATCCTTTTAGAAAATCTATCGTCCAA
GCAAAGAGTAAACCAGTActgacaaaacagaaaaatttgaGTAAAGAGAA
TATTGAAGAATTGAGCACAAGTGAGGAAAAAGATTCCCCAAAGAAGacat
tcaaattcaaagggaTCACATTTGATGCCAAGACTGAAGATGATGATAGC
AGTGATTCTGATTCAGACAGCTCATCAAATTCTGATTcagGGTCGTCAAG
TGATAGCAGTGACAACAGTGGAacagaagaagaaattgaagataTTGAAG
ACGAAGACGATGACGATACTGCATCTCAAACAAGTTCAGTTACAAGCTCT
CCTGCAAAGAAAACACAAAGAGCTGGTCAAAAACGAAAAGCAGTTCCTGA
CAATGCAGAGGtGATTGCCAGTTTGAAGAAACGAAAAGTTGTTGATTTGG
ATTTGATAAAAGCGCCATTAAAATTTggATGGAGAAGGCAGACAAGACTC
AGACCGAACAATGCTGGTGATGGGCTGAGGGGAGATGTTTATTATTATTC
ACCTTGTGGGAAAAAGCTGAGGACGTATCCTGAGTTAAACAGTtACATCT
TTCGAAATGATGTCGTTGATGTAGACTTGAAGAATTTCAGCTTTTCAACC
AAACTTCGTGTTGGCGAATTCATGCAGGCTAAGGATGGTTCAAAGTTTGT
GACACTGACTGAAGAAGAGATCGATGAAACATTTGTTATGATGGAAGAAA
GGAGAAGTGCTTCTGCAAAAAGAGCTGaagaaaagaagagagaaaaacgT
GAAAAGGAGGAGAAGCAACGTCAGATACTTGAGGAGAGAAAAAAGAAGAG
AGAAGAAGCCTTGGAAAGAAAGAGATCGAAAGAAGAAGAAAGGAGAAAGG
TTCAAAAAGACAAAGCATTGGAAGCAAAGATGAAGAAGGAGAAAGAAAAG
GAAGCAGCACAAGAAGCCAAACGATTGAAAGAGGAGGCAATAATGTTGAA
GAAACTAGAAAGGCAAGCTCAAATGGAAGCAAGTCGAATTGCCAAGCGTG
AGAAAGTTCAAAATATGTTGGCTGAAAAGCAGAAGATGAAAGAACAAAGA
GAACATGAACGAGTCATGAAGATTGAGAACCAAAAAGTGgagaaagaaat
gaaattacAAGCAATCGAAAATgaGAAGGAACGTAAAAGGCTGCAACAAG
TGAAAAGTAAAGTATCAGAAAAAGAAAAGCGAAAACGAGAGCTGGTCATG
ATGAAAGCTTATGAAGCACAACGGAGAGCTGAGGAGAGAGAACGCCTCAA
AGAACAAAAGAAGCTGGAGAAAACCTTGATCAGGCAACGAAAATTGGAAC
AGAAAAGATATGAGCGCATGATCtctaaagaattgaaaaaacctATCGAT
GATATGGCTCTGAATGATTTGAAGCCGTTGCCAGAGTTACCAAGGGTAAC
CAACATCAACATTCCTGGCAAAGCATATGCAGATATCCTGATGGTTCAAG
AGTTTGTTCACGCCTTTGGTCATGTCATTGATATCGATCCAGAGAAGGAG
TTTCCAAGCATGGGAGAGTTGCAATCATCATTGTTGTGTGAATCTGGTAG
CGATGAAGCAATCTTCACTGCATGCCAAGCACTTCTTTTTTACGCCCTCT
ACGATCCCGGTGTATCTGGGCCTTATGCCAAAACTTCACTGGGTTCAGAC
CTTACGAGTATCGAATTGAACGAGAACAACATATCAGAAGTATTACGTCT
TTTCATCTTATCACGTAATGAAGGAAAACAACACACACTCAGTGATCAGC
TCACCAAATATCCTTTAGAAGCTCTCTCACCCAGTAGTAAAGCTGCTGTT
CTAGCTTTCATTGTCAACGAACTGCTTTGTGGAAAATCAGTTAGCAGAGA
GATTGACGGTAGCTTggagaacatttcaaatatgCGAAGGGATAAATGGA
ACCTGGAAGGAGATATACGGAAaTTGAAAGCTGATCTATTATCAAAGCAA
CCCAAGAAAGCAGCCAGTGATCAACAACAGAAcctaaaaaacaacaaagg
aGAGTCGAAGAAAAGAGACTCTGACGAGGAGAACAATTCGGACGATGAAG
GAACCACTATCACCACTGCTAAGGAGAGCAATATCGATTTAAACGACACT
GCGGAAGACACAGAAGCTGAAAACCAGCCAGAGATGGTGAATCCTACTAC
ACTCGACCAAATGGAGAAGAAACTACGTTTGATGGAAAAGAAACACGCTC
GCTACCGTAAAAAGTTGTTCGATTCTTCACACACGATACGTGGTATAAAT
TTGGGTCAAGATCGATACCGGCGCCGTTATTTCGTGCTTCCGAACGCCGG
AGGGATTTACGTCGAAGGGCTGGAAAGTGGATTTTTTGACGAAGAAACGA
ACGTGAAAACAAAGGAAGAAAAGGAAGAATGCAAAGAACATTTAGATAGT
TTACTGACCACCTTGAAATCTCCAACTGTGTTGAAATCCCCTGTGACTGG
CCCCAAAACACCGGCCACAAATACACCGTCTGTATCAGCATTATCCTCAA
ATTCAAACGAACTTTTAAAACCGAAACAAGAGAGTCCTATAcaaacacaa
caacaacaaaaacagataaaagtTGAGAATCCTTGTTCAAGTGATAGTAG
TTATGTCAAATCTTGGTTTTCCTTACGGACTAAAAAACGTTGCGAGTCTT
ACAAAACTTCAGCTATACGTGAAACGCCTAAAGAGCGCAAACATTCGCTC
ATCGTTGCACCGAGGATAGAACGACTTGCCGACGACCACCAATTCTTAGA
ATCTATATACTCTTGTTATTCCACTACTTCTCCTGGTGGGAAAAACACTT
TATTACCTGTCAGCAGATTTCCCTTATCCAAGGAAAGTATGCATCGGAAC
TCGTTACTAGGCTTACCGGCTGAATTGGATATGAATTTACTTATACAACA
AGACCCACAAAAAGCAGCGGAAATTCTTGAAATACAGACTGCCAAGCCTC
AAGAAATTCCGCCTGAAATGCAGGCGGGTTGGTGGCGGATCACCGATCCA
GAACAAATGCAGCGCCTGAACAAGTGCGCCCACGCCAGGGGTATGAGAGA
ACGGAACCTTCAAAAGACGGTGGTGCGATTCCAAGACTACACCAACTCAT
CGTGTAAAGTTGACCATCTTGCATtttctcTACTTCTCCCCGACGAAGAA
AGTGAAAGCAAAGACAAAGTAACAGAAGACGACAGCAGCGTTGCCACATC
AACGGATACAAACAAATCGATACAAGATAAATGGTATCCACAGCTGGCGT
ATGCAAGTGACAAAGCCATTTTGATTGAAGTCGAAGAATTAGAGGAAAAG
GTCTTCTCGGCTAGTTTGCAAGTCAAGGGCTGGCGTTTGTCTCAAAAGAT
CTCTCCAGCACTTCTGCTGAGCACGAGTAACGATCAAGCTGAGTATGATC
CACCCGAAGATAAATATCCCATCAGGATAGCGGCTTCCCGTCTCCTAGCT
CTTGAGCTCGGTATCGAACGACGTTACATGAAGCCTCCATTCCGTACACC
AGACAGCCTTCCTAAACCGGACGCCCCAGAGGCTAAAGAAGAACCAGTCA
AGAATCCAAAAGCAACAGCCCAACTGGAGAAATGGCGTGAAGCAGTAAGC
GAAGCAAAATCGTCAGCTCAGCTATCGATGTGTATCACAGCACTCTTCGA
ATGTGTCGCTTGGGAGAAGTCCATCATGAAAGTGTTCTGCATACTATGTC
GTAAAAGTGACAACGAAGAAAGATTGTTGCTATGCGACGCATGTGATCGA
GGCTGTCATACGTATTGTTGTAAGCCGAAATTCGATAAGATTCCCGATGG
TGACTGGTTTTGTCAAGATTGTGTGTTGATGGCGTCTGGTAGTGATCAGT
GCTACAAATGTAAATCGAAGACCGGACGACGTCTGAAATGTGCATTCTGT
CCACGTCATTATCACATGGACTGCCTTGAACCACCATTACACAAaACACC
TCGTTCGCCTTGGAGTTGTCCCGTCTGCAAGAAAACACGCTCCAAGAGTA
AACCTCCTCAACGTAAAAAACCACGCGCCGAAGAACTTCTCAAGAAAGAG
GAACAGAGCAAACAAAAATCCATGTCCAACAGCCGTGTGCAGACGTCCAA
AGACATGGAACCGTGTCGTTTCATATTGAACGAAATGGAAAATCACGAAT
CGTCATGGCCCTTTCTCGTCCCTGTCAATATGAAGCAGTTTCCAGAGTAT
TATAAAGTGATCAAGCATCCGATGGATTTCCATACCATGAAAACGAAGCT
GCGTGATTACCAATACAAGTCAAAAGAAGAGTTCGCACGTGACGCGCGGT
TGGTGTTTTTCAATTGTAAAACGTACAACGAAGACGAATCGGAGGTTGGA
TGTGCAGGTGAAGCGATGCGAagtttcttcgagaaacgttgGACCGCCCT
CAAAAAGGGTGTCTCTTCCACAAACAGTGATAACAAATTCCACACCAACA
AGAAGGGGGAGGGTGTGGAATCATCAGGCGATGAAGGAGAAGACGCTCAG
GAGGAGGGTGAAGGCGATGAAGAAGTATCCAGTTCGAGTTCTGAAGAAAT
CTCATCCGAAAGTGAGAGCAGCGAAGTGGAGGAGGACAGTGAAAACGAGA
CCGACTCAAAAACATGAATGGACAATCGTTCCGGTGGTCAAGGCAACCCA
TATGATCGACCTTACTATGGGGACCCAAATGTCTTGAGACAACAAATTCC
TGGGTATGCTAACTCTCCTGGAATTTATCCATATTCCCAGCAGCAGCAAC
AAGATGGTTTTTCAGGGCGACGACCAGGGCAAGACCAGCTTGGTCTCAAT
AATCATGCTACCGCCAGAACCAACAGCTTGACTTCACCTCCACAATCAAC
CAATCCTTGGATGCACTCTTACCACAATCAAACACAACCAAATTCTATGA
GCCCTAATTTCAATATGAACATACCGAATATGTTTCATACAAGGTGGGAA
CAAGACCAAGCCTCACTTCTACAACAAAGAGAAATGATGCAAAGAGAAGA
ACATGCAAGGATGATGTATCGAGAGCGCTTGCAAATGCAAGAGAGAGAAA
ATCAGTTGAAAATCCAGATGCAGAAGGAGCAAGAGCGAGAGTTGCAACTT
CAGCGTGAAAAAGAAGCACAACTTCAGCGTGAAAGGGAAGCAAAGGTTCA
AAGAGAACGTGAAGCCCAATTAGAAAGAGAGCGACAAGCTCAACTTCAAA
GAGAACGACAAGCTGCTCTGGAGAAAGAAAGACAGCTACAGTTGCAGAGG
GAAAGAGAAGCTCAATTACAAAGAGAAGCTCAATTACAATATCAGATGCA
AAGAGAAATGCAACTTGAAAGAGAAAGAGAAGCAATGGCAATAAGAGAAA
GAGATGCAATCCTTGAACGAGATAGAAAAGCAATGCTCTACAGAGATGCT
TATTTTGCACAACAACATCAACCACAGCAATttccaaaccattttggttc
caTGCAAAATACATTGCCTAATTTGAATTTCACACAATCCAATGAGTCAA
TGTCTAATCAATTTAACTTCTATAACCAGCCCAGTATGCATTCAAATGGT
AATCTTCCTAGCAGTACATCGTCTTCTATACTAAACTTCTCAATGGATCA
AATTTTCAACCCTAATAAGATATCTGAGTCACCTGTCTCCAAAGCAGCAA
GTACCAGTTCTTCCTTTCACTTTCCAATCTCATCACCTTCCACCGTCAGC
TCAACAACAACTTCATCAACAACGACAACCACAACTGCTTTACGTAAAAG
CTCATCTAACTCATTTGACAATGGAATTATAAATAGTATTGTTTCTGATA
AGGGATTTTTAACCTCACCCTTGGACAGTAATAGTCAATTCATGAAAACA
TGGCAAGAACTACAGGATATGGATTTGagtgaaattgagaaaaatgtcCT
TGGACCTAAAGATCAAGATTCCCGAAACACTCCATTAGCAGATACTCCAT
TTTCAAACCCTACTACACCAACAGAAATGAATGGGCTGCCACCAAAACCA
ATTGATTCTAACTTGAATAACATTGTTAATTCTCTACCTGAAAACTCTCT
GGATTTAAATAAGCATTccattgaaacaaaagaatctttACAAATAACAA
ACACTGAAGATACACCACCACAACAGAATCTATTGAATCATCCAAGAAAT
TTATTATCAGTATCTCAAACAGCTCAAGCTAGCTCCAATTATACAAACAC
CAGTGTAACGCAATCAGACATAAACTTGACACATGTATCAGAAAATTTAC
TTACCCATAATAGGTCTTGCGTTTCTTCATTTGTTTCGCCTACGTCATCA
GATTTGTATTGCAATCAAGATTTTGATAAGCAATCAAAACGAGGAGATGA
TATCAAGCATGAAGAATATTCTAATGAACTTCAAAGCAATCACTCAAAAT
CATATGAAAAACAATCATCATCTTCACCTAcaacattaaaacaaaaatca
aaacaatcatttAGTAGTATTGAAAGTTTCCTTGGTATGAGCAGCGATAG
TAAAAAAACTGAAGATAATGATAATGAAAGGATTAATGACACCACTAAAA
AGCGAGAAAGGATCCCATCAAGTGATGTACAAGATCGAATTTCAGTCATA
AAACCATTACCAATTTCATCACCACAAATTTCAAACACATCCTCTCCTTT
GGATATTGTGAATAATGATCATGACACATTGAAAAGTCCACAAGCAATTG
AAAAGCTGAAATCTcctgaagaaattcaaaaagtaaTAGATCATTCTGAA
TCTGCACCTGTCACACTCATCCATCCATCTATGCGCCTCAAAAAGCAAAG
AAGTCTATCAAACAGTTCAATGACTGCCACCAGTCCACAACCCGTTATGG
AAaaggaaaaaccaaaaacaagtAATAGACGACCGTTACATCCTTCTATG
CGATTACAGACcaataaaaataatacaaaagTTGATAAAGCTGAACCTAA
AAAGAGTAAGGTTGAAAATCTTGATAACAGTTTTGACAGTGGAAAGAATA
TCTTACACAGTCCAAAAACTGGGCGTTATCAATCTGAACTTACAAGTACT
TCCACCAAATCTTCAACTAGGAAGTTATCTCCGTTCACTCCTCCAACTGT
TACATCACCTTTAACCTCACCACCACTAGTATCACCTGGAATTCGAAGTC
CCTTCAATGGAAAACCCCTCACTGGAAAACCATTCTCAACTGGTAAGCCT
GTTCATGGAGGAAAACCAGCATCTTATTCAGCTCAAGGTGGTGGTAAACC
AATGCATATGGGAGGGAAACCGACTAGTTTCTCTTCACATATGACTGTCA
AAGAGGAAAAGTCACCAGAAAAAGAGCACACTGGCAAACCTTTATCTTTT
TTGAAGTCCATGGTAgaagaatcttccaaaaacaCAAACACACTTCAAGG
GAAAAAGATCACTGGCAAGAAAAGACCCAGAAAGGAAACTATCGAGAAAC
CAGCttcaaaagaaactttaaaaaaagatgACATATCAAAATCCCCTGAC
TTGAAAACAAGTCGTATAACAAAAATGATATCAACCCCACCAAGCTCACA
AAAATTGACAGATAATATCAAGACTAAGAAACCACCACAAGAAAAACAGG
CACCTGTTAAAAAACTACCTGTCAAAAGGTCTCCAAAAGTATCACCTCCC
AAGAGAGAAGCTGTAAAAGATTCACCACTGAAAGAAAATCCTTTTAGAAA
ATCTATCGTCCAAGCAAAGAGTAAACCAGTActgacaaaacagaaaaatt
tgaGTAAAGAGAATATTGAAGAATTGAGCACAAGTGAGGAAAAAGATTCC
CCAAAGAAGacattcaaattcaaagggaTCACATTTGATGCCAAGACTGA
AGATGATGATAGCAGTGATTCTGATTCAGACAGCTCATCAAATTCTGATT
cagGGTCGTCAAGTGATAGCAGTGACAACAGTGGAacagaagaagaaatt
gaagataTTGAAGACGAAGACGATGACGATACTGCATCTCAAACAAGTTC
AGTTACAAGCTCTCCTGCAAAGAAAACACAAAGAGCTGGTCAAAAACGAA
AAGCAGTTCCTGACAATGCAGAGGtGATTGCCAGTTTGAAGAAACGAAAA
GTTGTTGATTTGGATTTGATAAAAGCGCCATTAAAATTTggATGGAGAAG
GCAGACAAGACTCAGACCGAACAATGCTGGTGATGGGCTGAGGGGAGATG
TTTATTATTATTCACCTTGTGGGAAAAAGCTGAGGACGTATCCTGAGTTA
AACAGTtACATCTTTCGAAATGATGTCGTTGATGTAGACTTGAAGAATTT
CAGCTTTTCAACCAAACTTCGTGTTGGCGAATTCATGCAGGCTAAGGATG
GTTCAAAGTTTGTGACACTGACTGAAGAAGAGATCGATGAAACATTTGTT
ATGATGGAAGAAAGGAGAAGTGCTTCTGCAAAAAGAGCTGaagaaaagaa
gagagaaaaacgTGAAAAGGAGGAGAAGCAACGTCAGATACTTGAGGAGA
GAAAAAAGAAGAGAGAAGAAGCCTTGGAAAGAAAGAGATCGAAAGAAGAA
GAAAGGAGAAAGGTTCAAAAAGACAAAGCATTGGAAGCAAAGATGAAGAA
GGAGAAAGAAAAGGAAGCAGCACAAGAAGCCAAACGATTGAAAGAGGAGG
CAATAATGTTGAAGAAACTAGAAAGGCAAGCTCAAATGGAAGCAAGTCGA
ATTGCCAAGCGTGAGAAAGTTCAAAATATGTTGGCTGAAAAGCAGAAGAT
GAAAGAACAAAGAGAACATGAACGAGTCATGAAGATTGAGAACCAAAAAG
TGgagaaagaaatgaaattacAAGCAATCGAAAATgaGAAGGAACGTAAA
AGGCTGCAACAAGTGAAAAGTAAAGTATCAGAAAAAGAAAAGCGAAAACG
AGAGCTGGTCATGATGAAAGCTTATGAAGCACAACGGAGAGCTGAGGAGA
GAGAACGCCTCAAAGAACAAAAGAAGCTGGAGAAAACCTTGATCAGGCAA
CGAAAATTGGAACAGAAAAGATATGAGCGCATGATCtctaaagaattgaa
aaaacctATCGATGATATGGCTCTGAATGATTTGAAGCCGTTGCCAGAGT
TACCAAGGGTAACCAACATCAACATTCCTGGCAAAGCATATGCAGATATC
CTGATGGTTCAAGAGTTTGTTCACGCCTTTGGTCATGTCATTGATATCGA
TCCAGAGAAGGAGTTTCCAAGCATGGGAGAGTTGCAATCATCATTGTTGT
GTGAATCTGGTAGCGATGAAGCAATCTTCACTGCATGCCAAGCACTTCTT
TTTTACGCCCTCTACGATCCCGGTGTATCTGGGCCTTATGCCAAAACTTC
ACTGGGTTCAGACCTTACGAGTATCGAATTGAACGAGAACAACATATCAG
AAGTATTACGTCTTTTCATCTTATCACGTAATGAAGGAAAACAACACACA
CTCAGTGATCAGCTCACCAAATATCCTTTAGAAGCTCTCTCACCCAGTAG
TAAAGCTGCTGTTCTAGCTTTCATTGTCAACGAACTGCTTTGTGGAAAAT
CAGTTAGCAGAGAGATTGACGGTAGCTTggagaacatttcaaatatgCGA
AGGGATAAATGGAACCTGGAAGGAGATATACGGAAaTTGAAAGCTGATCT
ATTATCAAAGCAACCCAAGAAAGCAGCCAGTGATCAACAACAGAAcctaa
aaaacaacaaaggaGAGTCGAAGAAAAGAGACTCTGACGAGGAGAACAAT
TCGGACGATGAAGGAACCACTATCACCACTGCTAAGGAGAGCAATATCGA
TTTAAACGACACTGCGGAAGACACAGAAGCTGAAAACCAGCCAGAGATGG
TGAATCCTACTACACTCGACCAAATGGAGAAGAAACTACGTTTGATGGAA
AAGAAACACGCTCGCTACCGTAAAAAGTTGTTCGATTCTTCACACACGAT
ACGTGGTATAAATTTGGGTCAAGATCGATACCGGCGCCGTTATTTCGTGC
TTCCGAACGCCGGAGGGATTTACGTCGAAGGGCTGGAAAGTGGATTTTTT
GACGAAGAAACGAACGTGAAAACAAAGGAAGAAAAGGAAGAATGCAAAGA
ACATTTAGATAGTTTACTGACCACCTTGAAATCTCCAACTGTGTTGAAAT
CCCCTGTGACTGGCCCCAAAACACCGGCCACAAATACACCGTCTGTATCA
GCATTATCCTCAAATTCAAACGAACTTTTAAAACCGAAACAAGAGAGTCC
TATAcaaacacaacaacaacaaaaacagataaaagtTGAGAATCCTTGTT
CAAGTGATAGTAGTTATGTCAAATCTTGGTTTTCCTTACGGACTAAAAAA
CGTTGCGAGTCTTACAAAACTTCAGCTATACGTGAAACGCCTAAAGAGCG
CAAACATTCGCTCATCGTTGCACCGAGGATAGAACGACTTGCCGACGACC
ACCAATTCTTAGAATCTATATACTCTTGTTATTCCACTACTTCTCCTGGT
GGGAAAAACACTTTATTACCTGTCAGCAGATTTCCCTTATCCAAGGAAAG
TATGCATCGGAACTCGTTACTAGGCTTACCGGCTGAATTGGATATGAATT
TACTTATACAACAAGACCCACAAAAAGCAGCGGAAATTCTTGAAATACAG
ACTGCCAAGCCTCAAGAAATTCCGCCTGAAATGCAGGCGGGTTGGTGGCG
GATCACCGATCCAGAACAAATGCAGCGCCTGAACAAGTGCGCCCACGCCA
GGGGTATGAGAGAACGGAACCTTCAAAAGACGGTGGTGCGATTCCAAGAC
TACACCAACTCATCGTGTAAAGTTGACCATCTTGCATtttctcTACTTCT
CCCCGACGAAGAAAGTGAAAGCAAAGACAAAGTAACAGAAGACGACAGCA
GCGTTGCCACATCAACGGATACAAACAAATCGATACAAGATAAATGGTAT
CCACAGCTGGCGTATGCAAGTGACAAAGCCATTTTGATTGAAGTCGAAGA
ATTAGAGGAAAAGGTCTTCTCGGCTAGTTTGCAAGTCAAGGGCTGGCGTT
TGTCTCAAAAGATCTCTCCAGCACTTCTGCTGAGCACGAGTAACGATCAA
GCTGAGTATGATCCACCCGAAGATAAATATCCCATCAGGATAGCGGCTTC
CCGTCTCCTAGCTCTTGAGCTCGGTATCGAACGACGTTACATGAAGCCTC
CATTCCGTACACCAGACAGCCTTCCTAAACCGGACGCCCCAGAGGCTAAA
GAAGAACCAGTCAAGAATCCAAAAGCAACAGCCCAACTGGAGAAATGGCG
TGAAGCAGTAAGCGAAGCAAAATCGTCAGCTCAGCTATCGATGTGTATCA
CAGCACTCTTCGAATGTGTCGCTTGGGAGAAGTCCATCATGAAAGTGTTC
TGCATACTATGTCGTAAAAGTGACAACGAAGAAAGATTGTTGCTATGCGA
CGCATGTGATCGAGGCTGTCATACGTATTGTTGTAAGCCGAAATTCGATA
AGATTCCCGATGGTGACTGGTTTTGTCAAGATTGTGTGTTGATGGCGTCT
GGTAGTGATCAGTGCTACAAATGTAAATCGAAGACCGGACGACGTCTGAA
ATGTGCATTCTGTCCACGTCATTATCACATGGACTGCCTTGAACCACCAT
TACACAAaACACCTCGTTCGCCTTGGAGTTGTCCCGTCTGCAAGAAAACA
CGCTCCAAGAGTAAACCTCCTCAACGTAAAAAACCACGCGCCGAAGAACT
TCTCAAGAAAGAGGAACAGAGCAAACAAAAATCCATGTCCAACAGCCGTG
TGCAGACGTCCAAAGACATGGAACCGTGTCGTTTCATATTGAACGAAATG
GAAAATCACGAATCGTCATGGCCCTTTCTCGTCCCTGTCAATATGAAGCA
GTTTCCAGAGTATTATAAAGTGATCAAGCATCCGATGGATTTCCATACCA
TGAAAACGAAGCTGCGTGATTACCAATACAAGTCAAAAGAAGAGTTCGCA
CGTGACGCGCGGTTGGTGTTTTTCAATTGTAAAACGTACAACGAAGACGA
ATCGGAGGTTGGATGTGCAGGTGAAGCGATGCGAagtttcttcgagaaac
gttgGACCGCCCTCAAAAAGGGTGTCTCTTCCACAAACAGTGATAACAAA
TTCCACACCAACAAGAAGGGGGAGGGTGTGGAATCATCAGGCGATGAAGG
AGAAGACGCTCAGGAGGAGGGTGAAGGCGATGAAGAAGTATCCAGTTCGA
GTTCTGAAGAAATCTCATCCGAAAGTGAGAGCAGCGAAGTGGAGGAGGAC
AGTGAAAACGAGACCGACTCAAAAACATGAATGGACAATCGTTCCGGTGG
TCAAGGCAACCCATATGATCGACCTTACTATGGGGACCCAAATGTCTTGA
GACAACAAATTCCTGGGTATGCTAACTCTCCTGGAATTTATCCATATTCC
CAGCAGCAGCAACAAGATGGTTTTTCAGGGCGACGACCAGGGCAAGACCA
GCTTGGTCTCAATAATCATGCTACCGCCAGAACCAACAGCTTGACTTCAC
CTCCACAATCAACCAATCCTTGGATGCACTCTTACCACAATCAAACACAA
CCAAATTCTATGAGCCCTAATTTCAATATGAACATACCGAATATGTTTCA
TACAAGGTGGGAACAAGACCAAGCCTCACTTCTACAACAAAGAGAAATGA
TGCAAAGAGAAGAACATGCAAGGATGATGTATCGAGAGCGCTTGCAAATG
CAAGAGAGAGAAAATCAGTTGAAAATCCAGATGCAGAAGGAGCAAGAGCG
AGAGTTGCAACTTCAGCGTGAAAAAGAAGCACAACTTCAGCGTGAAAGGG
AAGCAAAGGTTCAAAGAGAACGTGAAGCCCAATTAGAAAGAGAGCGACAA
GCTCAACTTCAAAGAGAACGACAAGCTGCTCTGGAGAAAGAAAGACAGCT
ACAGTTGCAGAGGGAAAGAGAAGCTCAATTACAAAGAGAAGCTCAATTAC
AATATCAGATGCAAAGAGAAATGCAACTTGAAAGAGAAAGAGAAGCAATG
GCAATAAGAGAAAGAGATGCAATCCTTGAACGAGATAGAAAAGCAATGCT
CTACAGAGATGCTTATTTTGCACAACAACATCAACCACAGCAATttccaa
accattttggttccaTGCAAAATACATTGCCTAATTTGAATTTCACACAA
TCCAATGAGTCAATGTCTAATCAATTTAACTTCTATAACCAGCCCAGTAT
GCATTCAAATGGTAATCTTCCTAGCAGTACATCGTCTTCTATACTAAACT
TCTCAATGGATCAAATTTTCAACCCTAATAAGATATCTGAGTCACCTGTC
TCCAAAGCAGCAAGTACCAGTTCTTCCTTTCACTTTCCAATCTCATCACC
TTCCACCGTCAGCTCAACAACAACTTCATCAACAACGACAACCACAACTG
CTTTACGTAAAAGCTCATCTAACTCATTTGACAATGGAATTATAAATAGT
ATTGTTTCTGATAAGGGATTTTTAACCTCACCCTTGGACAGTAATAGTCA
ATTCATGAAAACATGGCAAGAACTACAGGATATGGATTTGagtgaaattg
agaaaaatgtcCTTGGACCTAAAGATCAAGATTCCCGAAACACTCCATTA
GCAGATACTCCATTTTCAAACCCTACTACACCAACAGAAATGAATGGGCT
GCCACCAAAACCAATTGATTCTAACTTGAATAACATTGTTAATTCTCTAC
CTGAAAACTCTCTGGATTTAAATAAGCATTccattgaaacaaaagaatct
ttACAAATAACAAACACTGAAGATACACCACCACAACAGAATCTATTGAA
TCATCCAAGAAATTTATTATCAGTATCTCAAACAGCTCAAGCTAGCTCCA
ATTATACAAACACCAGTGTAACGCAATCAGACATAAACTTGACACATGTA
TCAGAAAATTTACTTACCCATAATAGGTCTTGCGTTTCTTCATTTGTTTC
GCCTACGTCATCAGATTTGTATTGCAATCAAGATTTTGATAAGCAATCAA
AACGAGGAGATGATATCAAGCATGAAGAATATTCTAATGAACTTCAAAGC
AATCACTCAAAATCATATGAAAAACAATCATCATCTTCACCTAcaacatt
aaaacaaaaatcaaaacaatcatttAGTAGTATTGAAAGTTTCCTTGGTA
TGAGCAGCGATAGTAAAAAAACTGAAGATAATGATAATGAAAGGATTAAT
GACACCACTAAAAAGCGAGAAAGGATCCCATCAAGTGATGTACAAGATCG
AATTTCAGTCATAAAACCATTACCAATTTCATCACCACAAATTTCAAACA
CATCCTCTCCTTTGGATATTGTGAATAATGATCATGACACATTGAAAAGT
CCACAAGCAATTGAAAAGCTGAAATCTcctgaagaaattcaaaaagtaaT
AGATCATTCTGAATCTGCACCTGTCACACTCATCCATCCATCTATGCGCC
TCAAAAAGCAAAGAAGTCTATCAAACAGTTCAATGACTGCCACCAGTCCA
CAACCCGTTATGGAAaaggaaaaaccaaaaacaagtAATAGACGACCGTT
ACATCCTTCTATGCGATTACAGACcaataaaaataatacaaaagTTGATA
AAGCTGAACCTAAAAAGAGTAAGGTTGAAAATCTTGATAACAGTTTTGAC
AGTGGAAAGAATATCTTACACAGTCCAAAAACTGGGCGTTATCAATCTGA
ACTTACAAGTACTTCCACCAAATCTTCAACTAGGAAGTTATCTCCGTTCA
CTCCTCCAACTGTTACATCACCTTTAACCTCACCACCACTAGTATCACCT
GGAATTCGAAGTCCCTTCAATGGAAAACCCCTCACTGGAAAACCATTCTC
AACTGGTAAGCCTGTTCATGGAGGAAAACCAGCATCTTATTCAGCTCAAG
GTGGTGGTAAACCAATGCATATGGGAGGGAAACCGACTAGTTTCTCTTCA
CATATGACTGTCAAAGAGGAAAAGTCACCAGAAAAAGAGCACACTGGCAA
ACCTTTATCTTTTTTGAAGTCCATGGTAgaagaatcttccaaaaacaCAA
ACACACTTCAAGGGAAAAAGATCACTGGCAAGAAAAGACCCAGAAAGGAA
ACTATCGAGAAACCAGCttcaaaagaaactttaaaaaaagatgACATATC
AAAATCCCCTGACTTGAAAACAAGTCGTATAACAAAAATGATATCAACCC
CACCAAGCTCACAAAAATTGACAGATAATATCAAGACTAAGAAACCACCA
CAAGAAAAACAGGCACCTGTTAAAAAACTACCTGTCAAAAGGTCTCCAAA
AGTATCACCTCCCAAGAGAGAAGCTGTAAAAGATTCACCACTGAAAGAAA
ATCCTTTTAGAAAATCTATCGTCCAAGCAAAGAGTAAACCAGTActgaca
aaacagaaaaatttgaGTAAAGAGAATATTGAAGAATTGAGCACAAGTGA
GGAAAAAGATTCCCCAAAGAAGacattcaaattcaaagggaTCACATTTG
ATGCCAAGACTGAAGATGATGATAGCAGTGATTCTGATTCAGACAGCTCA
TCAAATTCTGATTcagGGTCGTCAAGTGATAGCAGTGACAACAGTGGAac
agaagaagaaattgaagataTTGAAGACGAAGACGATGACGATACTGCAT
CTCAAACAAGTTCAGTTACAAGCTCTCCTGCAAAGAAAACACAAAGAGCT
GGTCAAAAACGAAAAGCAGTTCCTGACAATGCAGAGGtGATTGCCAGTTT
GAAGAAACGAAAAGTTGTTGATTTGGATTTGATAAAAGCGCCATTAAAAT
TTggATGGAGAAGGCAGACAAGACTCAGACCGAACAATGCTGGTGATGGG
CTGAGGGGAGATGTTTATTATTATTCACCTTGTGGGAAAAAGCTGAGGAC
GTATCCTGAGTTAAACAGTtACATCTTTCGAAATGATGTCGTTGATGTAG
ACTTGAAGAATTTCAGCTTTTCAACCAAACTTCGTGTTGGCGAATTCATG
CAGGCTAAGGATGGTTCAAAGTTTGTGACACTGACTGAAGAAGAGATCGA
TGAAACATTTGTTATGATGGAAGAAAGGAGAAGTGCTTCTGCAAAAAGAG
CTGaagaaaagaagagagaaaaacgTGAAAAGGAGGAGAAGCAACGTCAG
ATACTTGAGGAGAGAAAAAAGAAGAGAGAAGAAGCCTTGGAAAGAAAGAG
ATCGAAAGAAGAAGAAAGGAGAAAGGTTCAAAAAGACAAAGCATTGGAAG
CAAAGATGAAGAAGGAGAAAGAAAAGGAAGCAGCACAAGAAGCCAAACGA
TTGAAAGAGGAGGCAATAATGTTGAAGAAACTAGAAAGGCAAGCTCAAAT
GGAAGCAAGTCGAATTGCCAAGCGTGAGAAAGTTCAAAATATGTTGGCTG
AAAAGCAGAAGATGAAAGAACAAAGAGAACATGAACGAGTCATGAAGATT
GAGAACCAAAAAGTGgagaaagaaatgaaattacAAGCAATCGAAAATga
GAAGGAACGTAAAAGGCTGCAACAAGTGAAAAGTAAAGTATCAGAAAAAG
AAAAGCGAAAACGAGAGCTGGTCATGATGAAAGCTTATGAAGCACAACGG
AGAGCTGAGGAGAGAGAACGCCTCAAAGAACAAAAGAAGCTGGAGAAAAC
CTTGATCAGGCAACGAAAATTGGAACAGAAAAGATATGAGCGCATGATCt
ctaaagaattgaaaaaacctATCGATGATATGGCTCTGAATGATTTGAAG
CCGTTGCCAGAGTTACCAAGGGTAACCAACATCAACATTCCTGGCAAAGC
ATATGCAGATATCCTGATGGTTCAAGAGTTTGTTCACGCCTTTGGTCATG
TCATTGATATCGATCCAGAGAAGGAGTTTCCAAGCATGGGAGAGTTGCAA
TCATCATTGTTGTGTGAATCTGGTAGCGATGAAGCAATCTTCACTGCATG
CCAAGCACTTCTTTTTTACGCCCTCTACGATCCCGGTGTATCTGGGCCTT
ATGCCAAAACTTCACTGGGTTCAGACCTTACGAGTATCGAATTGAACGAG
AACAACATATCAGAAGTATTACGTCTTTTCATCTTATCACGTAATGAAGG
AAAACAACACACACTCAGTGATCAGCTCACCAAATATCCTTTAGAAGCTC
TCTCACCCAGTAGTAAAGCTGCTGTTCTAGCTTTCATTGTCAACGAACTG
CTTTGTGGAAAATCAGTTAGCAGAGAGATTGACGGTAGCTTggagaacat
ttcaaatatgCGAAGGGATAAATGGAACCTGGAAGGAGATATACGGAAaT
TGAAAGCTGATCTATTATCAAAGCAACCCAAGAAAGCAGCCAGTGATCAA
CAACAGAAcctaaaaaacaacaaaggaGAGTCGAAGAAAAGAGACTCTGA
CGAGGAGAACAATTCGGACGATGAAGGAACCACTATCACCACTGCTAAGG
AGAGCAATATCGATTTAAACGACACTGCGGAAGACACAGAAGCTGAAAAC
CAGCCAGAGATGGTGAATCCTACTACACTCGACCAAATGGAGAAGAAACT
ACGTTTGATGGAAAAGAAACACGCTCGCTACCGTAAAAAGTTGTTCGATT
CTTCACACACGATACGTGGTATAAATTTGGGTCAAGATCGATACCGGCGC
CGTTATTTCGTGCTTCCGAACGCCGGAGGGATTTACGTCGAAGGGCTGGA
AAGTGGATTTTTTGACGAAGAAACGAACGTGAAAACAAAGGAAGAAAAGG
AAGAATGCAAAGAACATTTAGATAGTTTACTGACCACCTTGAAATCTCCA
ACTGTGTTGAAATCCCCTGTGACTGGCCCCAAAACACCGGCCACAAATAC
ACCGTCTGTATCAGCATTATCCTCAAATTCAAACGAACTTTTAAAACCGA
AACAAGAGAGTCCTATAcaaacacaacaacaacaaaaacagataaaagtT
GAGAATCCTTGTTCAAGTGATAGTAGTTATGTCAAATCTTGGTTTTCCTT
ACGGACTAAAAAACGTTGCGAGTCTTACAAAACTTCAGCTATACGTGAAA
CGCCTAAAGAGCGCAAACATTCGCTCATCGTTGCACCGAGGATAGAACGA
CTTGCCGACGACCACCAATTCTTAGAATCTATATACTCTTGTTATTCCAC
TACTTCTCCTGGTGGGAAAAACACTTTATTACCTGTCAGCAGATTTCCCT
TATCCAAGGAAAGTATGCATCGGAACTCGTTACTAGGCTTACCGGCTGAA
TTGGATATGAATTTACTTATACAACAAGACCCACAAAAAGCAGCGGAAAT
TCTTGAAATACAGACTGCCAAGCCTCAAGAAATTCCGCCTGAAATGCAGG
CGGGTTGGTGGCGGATCACCGATCCAGAACAAATGCAGCGCCTGAACAAG
TGCGCCCACGCCAGGGGTATGAGAGAACGGAACCTTCAAAAGACGGTGGT
GCGATTCCAAGACTACACCAACTCATCGTGTAAAGTTGACCATCTTGCAT
tttctcTACTTCTCCCCGACGAAGAAAGTGAAAGCAAAGACAAAGTAACA
GAAGACGACAGCAGCGTTGCCACATCAACGGATACAAACAAATCGATACA
AGATAAATGGTATCCACAGCTGGCGTATGCAAGTGACAAAGCCATTTTGA
TTGAAGTCGAAGAATTAGAGGAAAAGGTCTTCTCGGCTAGTTTGCAAGTC
AAGGGCTGGCGTTTGTCTCAAAAGATCTCTCCAGCACTTCTGCTGAGCAC
GAGTAACGATCAAGCTGAGTATGATCCACCCGAAGATAAATATCCCATCA
GGATAGCGGCTTCCCGTCTCCTAGCTCTTGAGCTCGGTATCGAACGACGT
TACATGAAGCCTCCATTCCGTACACCAGACAGCCTTCCTAAACCGGACGC
CCCAGAGGCTAAAGAAGAACCAGTCAAGAATCCAAAAGCAACAGCCCAAC
TGGAGAAATGGCGTGAAGCAGTAAGCGAAGCAAAATCGTCAGCTCAGCTA
TCGATGTGTATCACAGCACTCTTCGAATGTGTCGCTTGGGAGAAGTCCAT
CATGAAAGTGTTCTGCATACTATGTCGTAAAAGTGACAACGAAGAAAGAT
TGTTGCTATGCGACGCATGTGATCGAGGCTGTCATACGTATTGTTGTAAG
CCGAAATTCGATAAGATTCCCGATGGTGACTGGTTTTGTCAAGATTGTGT
GTTGATGGCGTCTGGTAGTGATCAGTGCTACAAATGTAAATCGAAGACCG
GACGACGTCTGAAATGTGCATTCTGTCCACGTCATTATCACATGGACTGC
CTTGAACCACCATTACACAAaACACCTCGTTCGCCTTGGAGTTGTCCCGT
CTGCAAGAAAACACGCTCCAAGAGTAAACCTCCTCAACGTAAAAAACCAC
GCGCCGAAGAACTTCTCAAGAAAGAGGAACAGAGCAAACAAAAATCCATG
TCCAACAGCCGTGTGCAGACGTCCAAAGACATGGAACCGTGTCGTTTCAT
ATTGAACGAAATGGAAAATCACGAATCGTCATGGCCCTTTCTCGTCCCTG
TCAATATGAAGCAGTTTCCAGAGTATTATAAAGTGATCAAGCATCCGATG
GATTTCCATACCATGAAAACGAAGCTGCGTGATTACCAATACAAGTCAAA
AGAAGAGTTCGCACGTGACGCGCGGTTGGTGTTTTTCAATTGTAAAACGT
ACAACGAAGACGAATCGGAGGTTGGATGTGCAGGTGAAGCGATGCGAagt
ttcttcgagaaacgttgGACCGCCCTCAAAAAGGGTGTCTCTTCCACAAA
CAGTGATAACAAATTCCACACCAACAAGAAGGGGGAGGGTGTGGAATCAT
CAGGCGATGAAGGAGAAGACGCTCAGGAGGAGGGTGAAGGCGATGAAGAA
GTATCCAGTTCGAGTTCTGAAGAAATCTCATCCGAAAGTGAGAGCAGCGA
AGTGGAGGAGGACAGTGAAAACGAGACCGACTCAAAAACATGAATGGACA
ATCGTTCCGGTGGTCAAGGCAACCCATATGATCGACCTTACTATGGGGAC
CCAAATGTCTTGAGACAACAAATTCCTGGGTATGCTAACTCTCCTGGAAT
TTATCCATATTCCCAGCAGCAGCAACAAGATGGTTTTTCAGGGCGACGAC
CAGGGCAAGACCAGCTTGGTCTCAATAATCATGCTACCGCCAGAACCAAC
AGCTTGACTTCACCTCCACAATCAACCAATCCTTGGATGCACTCTTACCA
CAATCAAACACAACCAAATTCTATGAGCCCTAATTTCAATATGAACATAC
CGAATATGTTTCATACAAGGTGGGAACAAGACCAAGCCTCACTTCTACAA
CAAAGAGAAATGATGCAAAGAGAAGAACATGCAAGGATGATGTATCGAGA
GCGCTTGCAAATGCAAGAGAGAGAAAATCAGTTGAAAATCCAGATGCAGA
AGGAGCAAGAGCGAGAGTTGCAACTTCAGCGTGAAAAAGAAGCACAACTT
CAGCGTGAAAGGGAAGCAAAGGTTCAAAGAGAACGTGAAGCCCAATTAGA
AAGAGAGCGACAAGCTCAACTTCAAAGAGAACGACAAGCTGCTCTGGAGA
AAGAAAGACAGCTACAGTTGCAGAGGGAAAGAGAAGCTCAATTACAAAGA
GAAGCTCAATTACAATATCAGATGCAAAGAGAAATGCAACTTGAAAGAGA
AAGAGAAGCAATGGCAATAAGAGAAAGAGATGCAATCCTTGAACGAGATA
GAAAAGCAATGCTCTACAGAGATGCTTATTTTGCACAACAACATCAACCA
CAGCAATttccaaaccattttggttccaTGCAAAATACATTGCCTAATTT
GAATTTCACACAATCCAATGAGTCAATGTCTAATCAATTTAACTTCTATA
ACCAGCCCAGTATGCATTCAAATGGTAATCTTCCTAGCAGTACATCGTCT
TCTATACTAAACTTCTCAATGGATCAAATTTTCAACCCTAATAAGATATC
TGAGTCACCTGTCTCCAAAGCAGCAAGTACCAGTTCTTCCTTTCACTTTC
CAATCTCATCACCTTCCACCGTCAGCTCAACAACAACTTCATCAACAACG
ACAACCACAACTGCTTTACGTAAAAGCTCATCTAACTCATTTGACAATGG
AATTATAAATAGTATTGTTTCTGATAAGGGATTTTTAACCTCACCCTTGG
ACAGTAATAGTCAATTCATGAAAACATGGCAAGAACTACAGGATATGGAT
TTGagtgaaattgagaaaaatgtcCTTGGACCTAAAGATCAAGATTCCCG
AAACACTCCATTAGCAGATACTCCATTTTCAAACCCTACTACACCAACAG
AAATGAATGGGCTGCCACCAAAACCAATTGATTCTAACTTGAATAACATT
GTTAATTCTCTACCTGAAAACTCTCTGGATTTAAATAAGCATTccattga
aacaaaagaatctttACAAATAACAAACACTGAAGATACACCACCACAAC
AGAATCTATTGAATCATCCAAGAAATTTATTATCAGTATCTCAAACAGCT
CAAGCTAGCTCCAATTATACAAACACCAGTGTAACGCAATCAGACATAAA
CTTGACACATGTATCAGAAAATTTACTTACCCATAATAGGTCTTGCGTTT
CTTCATTTGTTTCGCCTACGTCATCAGATTTGTATTGCAATCAAGATTTT
GATAAGCAATCAAAACGAGGAGATGATATCAAGCATGAAGAATATTCTAA
TGAACTTCAAAGCAATCACTCAAAATCATATGAAAAACAATCATCATCTT
CACCTAcaacattaaaacaaaaatcaaaacaatcatttAGTAGTATTGAA
AGTTTCCTTGGTATGAGCAGCGATAGTAAAAAAACTGAAGATAATGATAA
TGAAAGGATTAATGACACCACTAAAAAGCGAGAAAGGATCCCATCAAGTG
ATGTACAAGATCGAATTTCAGTCATAAAACCATTACCAATTTCATCACCA
CAAATTTCAAACACATCCTCTCCTTTGGATATTGTGAATAATGATCATGA
CACATTGAAAAGTCCACAAGCAATTGAAAAGCTGAAATCTcctgaagaaa
ttcaaaaagtaaTAGATCATTCTGAATCTGCACCTGTCACACTCATCCAT
CCATCTATGCGCCTCAAAAAGCAAAGAAGTCTATCAAACAGTTCAATGAC
TGCCACCAGTCCACAACCCGTTATGGAAaaggaaaaaccaaaaacaagtA
ATAGACGACCGTTACATCCTTCTATGCGATTACAGACcaataaaaataat
acaaaagTTGATAAAGCTGAACCTAAAAAGAGTAAGGTTGAAAATCTTGA
TAACAGTTTTGACAGTGGAAAGAATATCTTACACAGTCCAAAAACTGGGC
GTTATCAATCTGAACTTACAAGTACTTCCACCAAATCTTCAACTAGGAAG
TTATCTCCGTTCACTCCTCCAACTGTTACATCACCTTTAACCTCACCACC
ACTAGTATCACCTGGAATTCGAAGTCCCTTCAATGGAAAACCCCTCACTG
GAAAACCATTCTCAACTGGTAAGCCTGTTCATGGAGGAAAACCAGCATCT
TATTCAGCTCAAGGTGGTGGTAAACCAATGCATATGGGAGGGAAACCGAC
TAGTTTCTCTTCACATATGACTGTCAAAGAGGAAAAGTCACCAGAAAAAG
AGCACACTGGCAAACCTTTATCTTTTTTGAAGTCCATGGTAgaagaatct
tccaaaaacaCAAACACACTTCAAGGGAAAAAGATCACTGGCAAGAAAAG
ACCCAGAAAGGAAACTATCGAGAAACCAGCttcaaaagaaactttaaaaa
aagatgACATATCAAAATCCCCTGACTTGAAAACAAGTCGTATAACAAAA
ATGATATCAACCCCACCAAGCTCACAAAAATTGACAGATAATATCAAGAC
TAAGAAACCACCACAAGAAAAACAGGCACCTGTTAAAAAACTACCTGTCA
AAAGGTCTCCAAAAGTATCACCTCCCAAGAGAGAAGCTGTAAAAGATTCA
CCACTGAAAGAAAATCCTTTTAGAAAATCTATCGTCCAAGCAAAGAGTAA
ACCAGTActgacaaaacagaaaaatttgaGTAAAGAGAATATTGAAGAAT
TGAGCACAAGTGAGGAAAAAGATTCCCCAAAGAAGacattcaaattcaaa
gggaTCACATTTGATGCCAAGACTGAAGATGATGATAGCAGTGATTCTGA
TTCAGACAGCTCATCAAATTCTGATTcagGGTCGTCAAGTGATAGCAGTG
ACAACAGTGGAacagaagaagaaattgaagataTTGAAGACGAAGACGAT
GACGATACTGCATCTCAAACAAGTTCAGTTACAAGCTCTCCTGCAAAGAA
AACACAAAGAGCTGGTCAAAAACGAAAAGCAGTTCCTGACAATGCAGAGG
tGATTGCCAGTTTGAAGAAACGAAAAGTTGTTGATTTGGATTTGATAAAA
GCGCCATTAAAATTTggATGGAGAAGGCAGACAAGACTCAGACCGAACAA
TGCTGGTGATGGGCTGAGGGGAGATGTTTATTATTATTCACCTTGTGGGA
AAAAGCTGAGGACGTATCCTGAGTTAAACAGTtACATCTTTCGAAATGAT
GTCGTTGATGTAGACTTGAAGAATTTCAGCTTTTCAACCAAACTTCGTGT
TGGCGAATTCATGCAGGCTAAGGATGGTTCAAAGTTTGTGACACTGACTG
AAGAAGAGATCGATGAAACATTTGTTATGATGGAAGAAAGGAGAAGTGCT
TCTGCAAAAAGAGCTGaagaaaagaagagagaaaaacgTGAAAAGGAGGA
GAAGCAACGTCAGATACTTGAGGAGAGAAAAAAGAAGAGAGAAGAAGCCT
TGGAAAGAAAGAGATCGAAAGAAGAAGAAAGGAGAAAGGTTCAAAAAGAC
AAAGCATTGGAAGCAAAGATGAAGAAGGAGAAAGAAAAGGAAGCAGCACA
AGAAGCCAAACGATTGAAAGAGGAGGCAATAATGTTGAAGAAACTAGAAA
GGCAAGCTCAAATGGAAGCAAGTCGAATTGCCAAGCGTGAGAAAGTTCAA
AATATGTTGGCTGAAAAGCAGAAGATGAAAGAACAAAGAGAACATGAACG
AGTCATGAAGATTGAGAACCAAAAAGTGgagaaagaaatgaaattacAAG
CAATCGAAAATgaGAAGGAACGTAAAAGGCTGCAACAAGTGAAAAGTAAA
GTATCAGAAAAAGAAAAGCGAAAACGAGAGCTGGTCATGATGAAAGCTTA
TGAAGCACAACGGAGAGCTGAGGAGAGAGAACGCCTCAAAGAACAAAAGA
AGCTGGAGAAAACCTTGATCAGGCAACGAAAATTGGAACAGAAAAGATAT
GAGCGCATGATCtctaaagaattgaaaaaacctATCGATGATATGGCTCT
GAATGATTTGAAGCCGTTGCCAGAGTTACCAAGGGTAACCAACATCAACA
TTCCTGGCAAAGCATATGCAGATATCCTGATGGTTCAAGAGTTTGTTCAC
GCCTTTGGTCATGTCATTGATATCGATCCAGAGAAGGAGTTTCCAAGCAT
GGGAGAGTTGCAATCATCATTGTTGTGTGAATCTGGTAGCGATGAAGCAA
TCTTCACTGCATGCCAAGCACTTCTTTTTTACGCCCTCTACGATCCCGGT
GTATCTGGGCCTTATGCCAAAACTTCACTGGGTTCAGACCTTACGAGTAT
CGAATTGAACGAGAACAACATATCAGAAGTATTACGTCTTTTCATCTTAT
CACGTAATGAAGGAAAACAACACACACTCAGTGATCAGCTCACCAAATAT
CCTTTAGAAGCTCTCTCACCCAGTAGTAAAGCTGCTGTTCTAGCTTTCAT
TGTCAACGAACTGCTTTGTGGAAAATCAGTTAGCAGAGAGATTGACGGTA
GCTTggagaacatttcaaatatgCGAAGGGATAAATGGAACCTGGAAGGA
GATATACGGAAaTTGAAAGCTGATCTATTATCAAAGCAACCCAAGAAAGC
AGCCAGTGATCAACAACAGAAcctaaaaaacaacaaaggaGAGTCGAAGA
AAAGAGACTCTGACGAGGAGAACAATTCGGACGATGAAGGAACCACTATC
ACCACTGCTAAGGAGAGCAATATCGATTTAAACGACACTGCGGAAGACAC
AGAAGCTGAAAACCAGCCAGAGATGGTGAATCCTACTACACTCGACCAAA
TGGAGAAGAAACTACGTTTGATGGAAAAGAAACACGCTCGCTACCGTAAA
AAGTTGTTCGATTCTTCACACACGATACGTGGTATAAATTTGGGTCAAGA
TCGATACCGGCGCCGTTATTTCGTGCTTCCGAACGCCGGAGGGATTTACG
TCGAAGGGCTGGAAAGTGGATTTTTTGACGAAGAAACGAACGTGAAAACA
AAGGAAGAAAAGGAAGAATGCAAAGAACATTTAGATAGTTTACTGACCAC
CTTGAAATCTCCAACTGTGTTGAAATCCCCTGTGACTGGCCCCAAAACAC
CGGCCACAAATACACCGTCTGTATCAGCATTATCCTCAAATTCAAACGAA
CTTTTAAAACCGAAACAAGAGAGTCCTATAcaaacacaacaacaacaaaa
acagataaaagtTGAGAATCCTTGTTCAAGTGATAGTAGTTATGTCAAAT
CTTGGTTTTCCTTACGGACTAAAAAACGTTGCGAGTCTTACAAAACTTCA
GCTATACGTGAAACGCCTAAAGAGCGCAAACATTCGCTCATCGTTGCACC
GAGGATAGAACGACTTGCCGACGACCACCAATTCTTAGAATCTATATACT
CTTGTTATTCCACTACTTCTCCTGGTGGGAAAAACACTTTATTACCTGTC
AGCAGATTTCCCTTATCCAAGGAAAGTATGCATCGGAACTCGTTACTAGG
CTTACCGGCTGAATTGGATATGAATTTACTTATACAACAAGACCCACAAA
AAGCAGCGGAAATTCTTGAAATACAGACTGCCAAGCCTCAAGAAATTCCG
CCTGAAATGCAGGCGGGTTGGTGGCGGATCACCGATCCAGAACAAATGCA
GCGCCTGAACAAGTGCGCCCACGCCAGGGGTATGAGAGAACGGAACCTTC
AAAAGACGGTGGTGCGATTCCAAGACTACACCAACTCATCGTGTAAAGTT
GACCATCTTGCATtttctcTACTTCTCCCCGACGAAGAAAGTGAAAGCAA
AGACAAAGTAACAGAAGACGACAGCAGCGTTGCCACATCAACGGATACAA
ACAAATCGATACAAGATAAATGGTATCCACAGCTGGCGTATGCAAGTGAC
AAAGCCATTTTGATTGAAGTCGAAGAATTAGAGGAAAAGGTCTTCTCGGC
TAGTTTGCAAGTCAAGGGCTGGCGTTTGTCTCAAAAGATCTCTCCAGCAC
TTCTGCTGAGCACGAGTAACGATCAAGCTGAGTATGATCCACCCGAAGAT
AAATATCCCATCAGGATAGCGGCTTCCCGTCTCCTAGCTCTTGAGCTCGG
TATCGAACGACGTTACATGAAGCCTCCATTCCGTACACCAGACAGCCTTC
CTAAACCGGACGCCCCAGAGGCTAAAGAAGAACCAGTCAAGAATCCAAAA
GCAACAGCCCAACTGGAGAAATGGCGTGAAGCAGTAAGCGAAGCAAAATC
GTCAGCTCAGCTATCGATGTGTATCACAGCACTCTTCGAATGTGTCGCTT
GGGAGAAGTCCATCATGAAAGTGTTCTGCATACTATGTCGTAAAAGTGAC
AACGAAGAAAGATTGTTGCTATGCGACGCATGTGATCGAGGCTGTCATAC
GTATTGTTGTAAGCCGAAATTCGATAAGATTCCCGATGGTGACTGGTTTT
GTCAAGATTGTGTGTTGATGGCGTCTGGTAGTGATCAGTGCTACAAATGT
AAATCGAAGACCGGACGACGTCTGAAATGTGCATTCTGTCCACGTCATTA
TCACATGGACTGCCTTGAACCACCATTACACAAaACACCTCGTTCGCCTT
GGAGTTGTCCCGTCTGCAAGAAAACACGCTCCAAGAGTAAACCTCCTCAA
CGTAAAAAACCACGCGCCGAAGAACTTCTCAAGAAAGAGGAACAGAGCAA
ACAAAAATCCATGTCCAACAGCCGTGTGCAGACGTCCAAAGACATGGAAC
CGTGTCGTTTCATATTGAACGAAATGGAAAATCACGAATCGTCATGGCCC
TTTCTCGTCCCTGTCAATATGAAGCAGTTTCCAGAGTATTATAAAGTGAT
CAAGCATCCGATGGATTTCCATACCATGAAAACGAAGCTGCGTGATTACC
AATACAAGTCAAAAGAAGAGTTCGCACGTGACGCGCGGTTGGTGTTTTTC
AATTGTAAAACGTACAACGAAGACGAATCGGAGGTTGGATGTGCAGGTGA
AGCGATGCGAagtttcttcgagaaacgttgGACCGCCCTCAAAAAGGGTG
TCTCTTCCACAAACAGTGATAACAAATTCCACACCAACAAGAAGGGGGAG
GGTGTGGAATCATCAGGCGATGAAGGAGAAGACGCTCAGGAGGAGGGTGA
AGGCGATGAAGAAGTATCCAGTTCGAGTTCTGAAGAAATCTCATCCGAAA
GTGAGAGCAGCGAAGTGGAGGAGGACAGTGAAAACGAGACCGACTCAAAA
ACATGAATGGACAATCGTTCCGGTGGTCAAGGCAACCCATATGATCGACC
TTACTATGGGGACCCAAATGTCTTGAGACAACAAATTCCTGGGTATGCTA
ACTCTCCTGGAATTTATCCATATTCCCAGCAGCAGCAACAAGATGGTTTT
TCAGGGCGACGACCAGGGCAAGACCAGCTTGGTCTCAATAATCATGCTAC
CGCCAGAACCAACAGCTTGACTTCACCTCCACAATCAACCAATCCTTGGA
TGCACTCTTACCACAATCAAACACAACCAAATTCTATGAGCCCTAATTTC
AATATGAACATACCGAATATGTTTCATACAAGGTGGGAACAAGACCAAGC
CTCACTTCTACAACAAAGAGAAATGATGCAAAGAGAAGAACATGCAAGGA
TGATGTATCGAGAGCGCTTGCAAATGCAAGAGAGAGAAAATCAGTTGAAA
ATCCAGATGCAGAAGGAGCAAGAGCGAGAGTTGCAACTTCAGCGTGAAAA
AGAAGCACAACTTCAGCGTGAAAGGGAAGCAAAGGTTCAAAGAGAACGTG
AAGCCCAATTAGAAAGAGAGCGACAAGCTCAACTTCAAAGAGAACGACAA
GCTGCTCTGGAGAAAGAAAGACAGCTACAGTTGCAGAGGGAAAGAGAAGC
TCAATTACAAAGAGAAGCTCAATTACAATATCAGATGCAAAGAGAAATGC
AACTTGAAAGAGAAAGAGAAGCAATGGCAATAAGAGAAAGAGATGCAATC
CTTGAACGAGATAGAAAAGCAATGCTCTACAGAGATGCTTATTTTGCACA
ACAACATCAACCACAGCAATttccaaaccattttggttccaTGCAAAATA
CATTGCCTAATTTGAATTTCACACAATCCAATGAGTCAATGTCTAATCAA
TTTAACTTCTATAACCAGCCCAGTATGCATTCAAATGGTAATCTTCCTAG
CAGTACATCGTCTTCTATACTAAACTTCTCAATGGATCAAATTTTCAACC
CTAATAAGATATCTGAGTCACCTGTCTCCAAAGCAGCAAGTACCAGTTCT
TCCTTTCACTTTCCAATCTCATCACCTTCCACCGTCAGCTCAACAACAAC
TTCATCAACAACGACAACCACAACTGCTTTACGTAAAAGCTCATCTAACT
CATTTGACAATGGAATTATAAATAGTATTGTTTCTGATAAGGGATTTTTA
ACCTCACCCTTGGACAGTAATAGTCAATTCATGAAAACATGGCAAGAACT
ACAGGATATGGATTTGagtgaaattgagaaaaatgtcCTTGGACCTAAAG
ATCAAGATTCCCGAAACACTCCATTAGCAGATACTCCATTTTCAAACCCT
ACTACACCAACAGAAATGAATGGGCTGCCACCAAAACCAATTGATTCTAA
CTTGAATAACATTGTTAATTCTCTACCTGAAAACTCTCTGGATTTAAATA
AGCATTccattgaaacaaaagaatctttACAAATAACAAACACTGAAGAT
ACACCACCACAACAGAATCTATTGAATCATCCAAGAAATTTATTATCAGT
ATCTCAAACAGCTCAAGCTAGCTCCAATTATACAAACACCAGTGTAACGC
AATCAGACATAAACTTGACACATGTATCAGAAAATTTACTTACCCATAAT
AGGTCTTGCGTTTCTTCATTTGTTTCGCCTACGTCATCAGATTTGTATTG
CAATCAAGATTTTGATAAGCAATCAAAACGAGGAGATGATATCAAGCATG
AAGAATATTCTAATGAACTTCAAAGCAATCACTCAAAATCATATGAAAAA
CAATCATCATCTTCACCTAcaacattaaaacaaaaatcaaaacaatcatt
tAGTAGTATTGAAAGTTTCCTTGGTATGAGCAGCGATAGTAAAAAAACTG
AAGATAATGATAATGAAAGGATTAATGACACCACTAAAAAGCGAGAAAGG
ATCCCATCAAGTGATGTACAAGATCGAATTTCAGTCATAAAACCATTACC
AATTTCATCACCACAAATTTCAAACACATCCTCTCCTTTGGATATTGTGA
ATAATGATCATGACACATTGAAAAGTCCACAAGCAATTGAAAAGCTGAAA
TCTcctgaagaaattcaaaaagtaaTAGATCATTCTGAATCTGCACCTGT
CACACTCATCCATCCATCTATGCGCCTCAAAAAGCAAAGAAGTCTATCAA
ACAGTTCAATGACTGCCACCAGTCCACAACCCGTTATGGAAaaggaaaaa
ccaaaaacaagtAATAGACGACCGTTACATCCTTCTATGCGATTACAGAC
caataaaaataatacaaaagTTGATAAAGCTGAACCTAAAAAGAGTAAGG
TTGAAAATCTTGATAACAGTTTTGACAGTGGAAAGAATATCTTACACAGT
CCAAAAACTGGGCGTTATCAATCTGAACTTACAAGTACTTCCACCAAATC
TTCAACTAGGAAGTTATCTCCGTTCACTCCTCCAACTGTTACATCACCTT
TAACCTCACCACCACTAGTATCACCTGGAATTCGAAGTCCCTTCAATGGA
AAACCCCTCACTGGAAAACCATTCTCAACTGGTAAGCCTGTTCATGGAGG
AAAACCAGCATCTTATTCAGCTCAAGGTGGTGGTAAACCAATGCATATGG
GAGGGAAACCGACTAGTTTCTCTTCACATATGACTGTCAAAGAGGAAAAG
TCACCAGAAAAAGAGCACACTGGCAAACCTTTATCTTTTTTGAAGTCCAT
GGTAgaagaatcttccaaaaacaCAAACACACTTCAAGGGAAAAAGATCA
CTGGCAAGAAAAGACCCAGAAAGGAAACTATCGAGAAACCAGCttcaaaa
gaaactttaaaaaaagatgACATATCAAAATCCCCTGACTTGAAAACAAG
TCGTATAACAAAAATGATATCAACCCCACCAAGCTCACAAAAATTGACAG
ATAATATCAAGACTAAGAAACCACCACAAGAAAAACAGGCACCTGTTAAA
AAACTACCTGTCAAAAGGTCTCCAAAAGTATCACCTCCCAAGAGAGAAGC
TGTAAAAGATTCACCACTGAAAGAAAATCCTTTTAGAAAATCTATCGTCC
AAGCAAAGAGTAAACCAGTActgacaaaacagaaaaatttgaGTAAAGAG
AATATTGAAGAATTGAGCACAAGTGAGGAAAAAGATTCCCCAAAGAAGac
attcaaattcaaagggaTCACATTTGATGCCAAGACTGAAGATGATGATA
GCAGTGATTCTGATTCAGACAGCTCATCAAATTCTGATTcagGGTCGTCA
AGTGATAGCAGTGACAACAGTGGAacagaagaagaaattgaagataTTGA
AGACGAAGACGATGACGATACTGCATCTCAAACAAGTTCAGTTACAAGCT
CTCCTGCAAAGAAAACACAAAGAGCTGGTCAAAAACGAAAAGCAGTTCCT
GACAATGCAGAGGtGATTGCCAGTTTGAAGAAACGAAAAGTTGTTGATTT
GGATTTGATAAAAGCGCCATTAAAATTTggATGGAGAAGGCAGACAAGAC
TCAGACCGAACAATGCTGGTGATGGGCTGAGGGGAGATGTTTATTATTAT
TCACCTTGTGGGAAAAAGCTGAGGACGTATCCTGAGTTAAACAGTtACAT
CTTTCGAAATGATGTCGTTGATGTAGACTTGAAGAATTTCAGCTTTTCAA
CCAAACTTCGTGTTGGCGAATTCATGCAGGCTAAGGATGGTTCAAAGTTT
GTGACACTGACTGAAGAAGAGATCGATGAAACATTTGTTATGATGGAAGA
AAGGAGAAGTGCTTCTGCAAAAAGAGCTGaagaaaagaagagagaaaaac
gTGAAAAGGAGGAGAAGCAACGTCAGATACTTGAGGAGAGAAAAAAGAAG
AGAGAAGAAGCCTTGGAAAGAAAGAGATCGAAAGAAGAAGAAAGGAGAAA
GGTTCAAAAAGACAAAGCATTGGAAGCAAAGATGAAGAAGGAGAAAGAAA
AGGAAGCAGCACAAGAAGCCAAACGATTGAAAGAGGAGGCAATAATGTTG
AAGAAACTAGAAAGGCAAGCTCAAATGGAAGCAAGTCGAATTGCCAAGCG
TGAGAAAGTTCAAAATATGTTGGCTGAAAAGCAGAAGATGAAAGAACAAA
GAGAACATGAACGAGTCATGAAGATTGAGAACCAAAAAGTGgagaaagaa
atgaaattacAAGCAATCGAAAATgaGAAGGAACGTAAAAGGCTGCAACA
AGTGAAAAGTAAAGTATCAGAAAAAGAAAAGCGAAAACGAGAGCTGGTCA
TGATGAAAGCTTATGAAGCACAACGGAGAGCTGAGGAGAGAGAACGCCTC
AAAGAACAAAAGAAGCTGGAGAAAACCTTGATCAGGCAACGAAAATTGGA
ACAGAAAAGATATGAGCGCATGATCtctaaagaattgaaaaaacctATCG
ATGATATGGCTCTGAATGATTTGAAGCCGTTGCCAGAGTTACCAAGGGTA
ACCAACATCAACATTCCTGGCAAAGCATATGCAGATATCCTGATGGTTCA
AGAGTTTGTTCACGCCTTTGGTCATGTCATTGATATCGATCCAGAGAAGG
AGTTTCCAAGCATGGGAGAGTTGCAATCATCATTGTTGTGTGAATCTGGT
AGCGATGAAGCAATCTTCACTGCATGCCAAGCACTTCTTTTTTACGCCCT
CTACGATCCCGGTGTATCTGGGCCTTATGCCAAAACTTCACTGGGTTCAG
ACCTTACGAGTATCGAATTGAACGAGAACAACATATCAGAAGTATTACGT
CTTTTCATCTTATCACGTAATGAAGGAAAACAACACACACTCAGTGATCA
GCTCACCAAATATCCTTTAGAAGCTCTCTCACCCAGTAGTAAAGCTGCTG
TTCTAGCTTTCATTGTCAACGAACTGCTTTGTGGAAAATCAGTTAGCAGA
GAGATTGACGGTAGCTTggagaacatttcaaatatgCGAAGGGATAAATG
GAACCTGGAAGGAGATATACGGAAaTTGAAAGCTGATCTATTATCAAAGC
AACCCAAGAAAGCAGCCAGTGATCAACAACAGAAcctaaaaaacaacaaa
ggaGAGTCGAAGAAAAGAGACTCTGACGAGGAGAACAATTCGGACGATGA
AGGAACCACTATCACCACTGCTAAGGAGAGCAATATCGATTTAAACGACA
CTGCGGAAGACACAGAAGCTGAAAACCAGCCAGAGATGGTGAATCCTACT
ACACTCGACCAAATGGAGAAGAAACTACGTTTGATGGAAAAGAAACACGC
TCGCTACCGTAAAAAGTTGTTCGATTCTTCACACACGATACGTGGTATAA
ATTTGGGTCAAGATCGATACCGGCGCCGTTATTTCGTGCTTCCGAACGCC
GGAGGGATTTACGTCGAAGGGCTGGAAAGTGGATTTTTTGACGAAGAAAC
GAACGTGAAAACAAAGGAAGAAAAGGAAGAATGCAAAGAACATTTAGATA
GTTTACTGACCACCTTGAAATCTCCAACTGTGTTGAAATCCCCTGTGACT
GGCCCCAAAACACCGGCCACAAATACACCGTCTGTATCAGCATTATCCTC
AAATTCAAACGAACTTTTAAAACCGAAACAAGAGAGTCCTATAcaaacac
aacaacaacaaaaacagataaaagtTGAGAATCCTTGTTCAAGTGATAGT
AGTTATGTCAAATCTTGGTTTTCCTTACGGACTAAAAAACGTTGCGAGTC
TTACAAAACTTCAGCTATACGTGAAACGCCTAAAGAGCGCAAACATTCGC
TCATCGTTGCACCGAGGATAGAACGACTTGCCGACGACCACCAATTCTTA
GAATCTATATACTCTTGTTATTCCACTACTTCTCCTGGTGGGAAAAACAC
TTTATTACCTGTCAGCAGATTTCCCTTATCCAAGGAAAGTATGCATCGGA
ACTCGTTACTAGGCTTACCGGCTGAATTGGATATGAATTTACTTATACAA
CAAGACCCACAAAAAGCAGCGGAAATTCTTGAAATACAGACTGCCAAGCC
TCAAGAAATTCCGCCTGAAATGCAGGCGGGTTGGTGGCGGATCACCGATC
CAGAACAAATGCAGCGCCTGAACAAGTGCGCCCACGCCAGGGGTATGAGA
GAACGGAACCTTCAAAAGACGGTGGTGCGATTCCAAGACTACACCAACTC
ATCGTGTAAAGTTGACCATCTTGCATtttctcTACTTCTCCCCGACGAAG
AAAGTGAAAGCAAAGACAAAGTAACAGAAGACGACAGCAGCGTTGCCACA
TCAACGGATACAAACAAATCGATACAAGATAAATGGTATCCACAGCTGGC
GTATGCAAGTGACAAAGCCATTTTGATTGAAGTCGAAGAATTAGAGGAAA
AGGTCTTCTCGGCTAGTTTGCAAGTCAAGGGCTGGCGTTTGTCTCAAAAG
ATCTCTCCAGCACTTCTGCTGAGCACGAGTAACGATCAAGCTGAGTATGA
TCCACCCGAAGATAAATATCCCATCAGGATAGCGGCTTCCCGTCTCCTAG
CTCTTGAGCTCGGTATCGAACGACGTTACATGAAGCCTCCATTCCGTACA
CCAGACAGCCTTCCTAAACCGGACGCCCCAGAGGCTAAAGAAGAACCAGT
CAAGAATCCAAAAGCAACAGCCCAACTGGAGAAATGGCGTGAAGCAGTAA
GCGAAGCAAAATCGTCAGCTCAGCTATCGATGTGTATCACAGCACTCTTC
GAATGTGTCGCTTGGGAGAAGTCCATCATGAAAGTGTTCTGCATACTATG
TCGTAAAAGTGACAACGAAGAAAGATTGTTGCTATGCGACGCATGTGATC
GAGGCTGTCATACGTATTGTTGTAAGCCGAAATTCGATAAGATTCCCGAT
GGTGACTGGTTTTGTCAAGATTGTGTGTTGATGGCGTCTGGTAGTGATCA
GTGCTACAAATGTAAATCGAAGACCGGACGACGTCTGAAATGTGCATTCT
GTCCACGTCATTATCACATGGACTGCCTTGAACCACCATTACACAAaACA
CCTCGTTCGCCTTGGAGTTGTCCCGTCTGCAAGAAAACACGCTCCAAGAG
TAAACCTCCTCAACGTAAAAAACCACGCGCCGAAGAACTTCTCAAGAAAG
AGGAACAGAGCAAACAAAAATCCATGTCCAACAGCCGTGTGCAGACGTCC
AAAGACATGGAACCGTGTCGTTTCATATTGAACGAAATGGAAAATCACGA
ATCGTCATGGCCCTTTCTCGTCCCTGTCAATATGAAGCAGTTTCCAGAGT
ATTATAAAGTGATCAAGCATCCGATGGATTTCCATACCATGAAAACGAAG
CTGCGTGATTACCAATACAAGTCAAAAGAAGAGTTCGCACGTGACGCGCG
GTTGGTGTTTTTCAATTGTAAAACGTACAACGAAGACGAATCGGAGGTTG
GATGTGCAGGTGAAGCGATGCGAagtttcttcgagaaacgttgGACCGCC
CTCAAAAAGGGTGTCTCTTCCACAAACAGTGATAACAAATTCCACACCAA
CAAGAAGGGGGAGGGTGTGGAATCATCAGGCGATGAAGGAGAAGACGCTC
AGGAGGAGGGTGAAGGCGATGAAGAAGTATCCAGTTCGAGTTCTGAAGAA
ATCTCATCCGAAAGTGAGAGCAGCGAAGTGGAGGAGGACAGTGAAAACGA
GACCGACTCAAAAACATGAATGGACAATCGTTCCGGTGGTCAAGGCAACC
CATATGATCGACCTTACTATGGGGACCCAAATGTCTTGAGACAACAAATT
CCTGGGTATGCTAACTCTCCTGGAATTTATCCATATTCCCAGCAGCAGCA
ACAAGATGGTTTTTCAGGGCGACGACCAGGGCAAGACCAGCTTGGTCTCA
ATAATCATGCTACCGCCAGAACCAACAGCTTGACTTCACCTCCACAATCA
ACCAATCCTTGGATGCACTCTTACCACAATCAAACACAACCAAATTCTAT
GAGCCCTAATTTCAATATGAACATACCGAATATGTTTCATACAAGGTGGG
AACAAGACCAAGCCTCACTTCTACAACAAAGAGAAATGATGCAAAGAGAA
GAACATGCAAGGATGATGTATCGAGAGCGCTTGCAAATGCAAGAGAGAGA
AAATCAGTTGAAAATCCAGATGCAGAAGGAGCAAGAGCGAGAGTTGCAAC
TTCAGCGTGAAAAAGAAGCACAACTTCAGCGTGAAAGGGAAGCAAAGGTT
CAAAGAGAACGTGAAGCCCAATTAGAAAGAGAGCGACAAGCTCAACTTCA
AAGAGAACGACAAGCTGCTCTGGAGAAAGAAAGACAGCTACAGTTGCAGA
GGGAAAGAGAAGCTCAATTACAAAGAGAAGCTCAATTACAATATCAGATG
CAAAGAGAAATGCAACTTGAAAGAGAAAGAGAAGCAATGGCAATAAGAGA
AAGAGATGCAATCCTTGAACGAGATAGAAAAGCAATGCTCTACAGAGATG
CTTATTTTGCACAACAACATCAACCACAGCAATttccaaaccattttggt
tccaTGCAAAATACATTGCCTAATTTGAATTTCACACAATCCAATGAGTC
AATGTCTAATCAATTTAACTTCTATAACCAGCCCAGTATGCATTCAAATG
GTAATCTTCCTAGCAGTACATCGTCTTCTATACTAAACTTCTCAATGGAT
CAAATTTTCAACCCTAATAAGATATCTGAGTCACCTGTCTCCAAAGCAGC
AAGTACCAGTTCTTCCTTTCACTTTCCAATCTCATCACCTTCCACCGTCA
GCTCAACAACAACTTCATCAACAACGACAACCACAACTGCTTTACGTAAA
AGCTCATCTAACTCATTTGACAATGGAATTATAAATAGTATTGTTTCTGA
TAAGGGATTTTTAACCTCACCCTTGGACAGTAATAGTCAATTCATGAAAA
CATGGCAAGAACTACAGGATATGGATTTGagtgaaattgagaaaaatgtc
CTTGGACCTAAAGATCAAGATTCCCGAAACACTCCATTAGCAGATACTCC
ATTTTCAAACCCTACTACACCAACAGAAATGAATGGGCTGCCACCAAAAC
CAATTGATTCTAACTTGAATAACATTGTTAATTCTCTACCTGAAAACTCT
CTGGATTTAAATAAGCATTccattgaaacaaaagaatctttACAAATAAC
AAACACTGAAGATACACCACCACAACAGAATCTATTGAATCATCCAAGAA
ATTTATTATCAGTATCTCAAACAGCTCAAGCTAGCTCCAATTATACAAAC
ACCAGTGTAACGCAATCAGACATAAACTTGACACATGTATCAGAAAATTT
ACTTACCCATAATAGGTCTTGCGTTTCTTCATTTGTTTCGCCTACGTCAT
CAGATTTGTATTGCAATCAAGATTTTGATAAGCAATCAAAACGAGGAGAT
GATATCAAGCATGAAGAATATTCTAATGAACTTCAAAGCAATCACTCAAA
ATCATATGAAAAACAATCATCATCTTCACCTAcaacattaaaacaaaaat
caaaacaatcatttAGTAGTATTGAAAGTTTCCTTGGTATGAGCAGCGAT
AGTAAAAAAACTGAAGATAATGATAATGAAAGGATTAATGACACCACTAA
AAAGCGAGAAAGGATCCCATCAAGTGATGTACAAGATCGAATTTCAGTCA
TAAAACCATTACCAATTTCATCACCACAAATTTCAAACACATCCTCTCCT
TTGGATATTGTGAATAATGATCATGACACATTGAAAAGTCCACAAGCAAT
TGAAAAGCTGAAATCTcctgaagaaattcaaaaagtaaTAGATCATTCTG
AATCTGCACCTGTCACACTCATCCATCCATCTATGCGCCTCAAAAAGCAA
AGAAGTCTATCAAACAGTTCAATGACTGCCACCAGTCCACAACCCGTTAT
GGAAaaggaaaaaccaaaaacaagtAATAGACGACCGTTACATCCTTCTA
TGCGATTACAGACcaataaaaataatacaaaagTTGATAAAGCTGAACCT
AAAAAGAGTAAGGTTGAAAATCTTGATAACAGTTTTGACAGTGGAAAGAA
TATCTTACACAGTCCAAAAACTGGGCGTTATCAATCTGAACTTACAAGTA
CTTCCACCAAATCTTCAACTAGGAAGTTATCTCCGTTCACTCCTCCAACT
GTTACATCACCTTTAACCTCACCACCACTAGTATCACCTGGAATTCGAAG
TCCCTTCAATGGAAAACCCCTCACTGGAAAACCATTCTCAACTGGTAAGC
CTGTTCATGGAGGAAAACCAGCATCTTATTCAGCTCAAGGTGGTGGTAAA
CCAATGCATATGGGAGGGAAACCGACTAGTTTCTCTTCACATATGACTGT
CAAAGAGGAAAAGTCACCAGAAAAAGAGCACACTGGCAAACCTTTATCTT
TTTTGAAGTCCATGGTAgaagaatcttccaaaaacaCAAACACACTTCAA
GGGAAAAAGATCACTGGCAAGAAAAGACCCAGAAAGGAAACTATCGAGAA
ACCAGCttcaaaagaaactttaaaaaaagatgACATATCAAAATCCCCTG
ACTTGAAAACAAGTCGTATAACAAAAATGATATCAACCCCACCAAGCTCA
CAAAAATTGACAGATAATATCAAGACTAAGAAACCACCACAAGAAAAACA
GGCACCTGTTAAAAAACTACCTGTCAAAAGGTCTCCAAAAGTATCACCTC
CCAAGAGAGAAGCTGTAAAAGATTCACCACTGAAAGAAAATCCTTTTAGA
AAATCTATCGTCCAAGCAAAGAGTAAACCAGTActgacaaaacagaaaaa
tttgaGTAAAGAGAATATTGAAGAATTGAGCACAAGTGAGGAAAAAGATT
CCCCAAAGAAGacattcaaattcaaagggaTCACATTTGATGCCAAGACT
GAAGATGATGATAGCAGTGATTCTGATTCAGACAGCTCATCAAATTCTGA
TTcagGGTCGTCAAGTGATAGCAGTGACAACAGTGGAacagaagaagaaa
ttgaagataTTGAAGACGAAGACGATGACGATACTGCATCTCAAACAAGT
TCAGTTACAAGCTCTCCTGCAAAGAAAACACAAAGAGCTGGTCAAAAACG
AAAAGCAGTTCCTGACAATGCAGAGGtGATTGCCAGTTTGAAGAAACGAA
AAGTTGTTGATTTGGATTTGATAAAAGCGCCATTAAAATTTggATGGAGA
AGGCAGACAAGACTCAGACCGAACAATGCTGGTGATGGGCTGAGGGGAGA
TGTTTATTATTATTCACCTTGTGGGAAAAAGCTGAGGACGTATCCTGAGT
TAAACAGTtACATCTTTCGAAATGATGTCGTTGATGTAGACTTGAAGAAT
TTCAGCTTTTCAACCAAACTTCGTGTTGGCGAATTCATGCAGGCTAAGGA
TGGTTCAAAGTTTGTGACACTGACTGAAGAAGAGATCGATGAAACATTTG
TTATGATGGAAGAAAGGAGAAGTGCTTCTGCAAAAAGAGCTGaagaaaag
aagagagaaaaacgTGAAAAGGAGGAGAAGCAACGTCAGATACTTGAGGA
GAGAAAAAAGAAGAGAGAAGAAGCCTTGGAAAGAAAGAGATCGAAAGAAG
AAGAAAGGAGAAAGGTTCAAAAAGACAAAGCATTGGAAGCAAAGATGAAG
AAGGAGAAAGAAAAGGAAGCAGCACAAGAAGCCAAACGATTGAAAGAGGA
GGCAATAATGTTGAAGAAACTAGAAAGGCAAGCTCAAATGGAAGCAAGTC
GAATTGCCAAGCGTGAGAAAGTTCAAAATATGTTGGCTGAAAAGCAGAAG
ATGAAAGAACAAAGAGAACATGAACGAGTCATGAAGATTGAGAACCAAAA
AGTGgagaaagaaatgaaattacAAGCAATCGAAAATgaGAAGGAACGTA
AAAGGCTGCAACAAGTGAAAAGTAAAGTATCAGAAAAAGAAAAGCGAAAA
CGAGAGCTGGTCATGATGAAAGCTTATGAAGCACAACGGAGAGCTGAGGA
GAGAGAACGCCTCAAAGAACAAAAGAAGCTGGAGAAAACCTTGATCAGGC
AACGAAAATTGGAACAGAAAAGATATGAGCGCATGATCtctaaagaattg
aaaaaacctATCGATGATATGGCTCTGAATGATTTGAAGCCGTTGCCAGA
GTTACCAAGGGTAACCAACATCAACATTCCTGGCAAAGCATATGCAGATA
TCCTGATGGTTCAAGAGTTTGTTCACGCCTTTGGTCATGTCATTGATATC
GATCCAGAGAAGGAGTTTCCAAGCATGGGAGAGTTGCAATCATCATTGTT
GTGTGAATCTGGTAGCGATGAAGCAATCTTCACTGCATGCCAAGCACTTC
TTTTTTACGCCCTCTACGATCCCGGTGTATCTGGGCCTTATGCCAAAACT
TCACTGGGTTCAGACCTTACGAGTATCGAATTGAACGAGAACAACATATC
AGAAGTATTACGTCTTTTCATCTTATCACGTAATGAAGGAAAACAACACA
CACTCAGTGATCAGCTCACCAAATATCCTTTAGAAGCTCTCTCACCCAGT
AGTAAAGCTGCTGTTCTAGCTTTCATTGTCAACGAACTGCTTTGTGGAAA
ATCAGTTAGCAGAGAGATTGACGGTAGCTTggagaacatttcaaatatgC
GAAGGGATAAATGGAACCTGGAAGGAGATATACGGAAaTTGAAAGCTGAT
CTATTATCAAAGCAACCCAAGAAAGCAGCCAGTGATCAACAACAGAAcct
aaaaaacaacaaaggaGAGTCGAAGAAAAGAGACTCTGACGAGGAGAACA
ATTCGGACGATGAAGGAACCACTATCACCACTGCTAAGGAGAGCAATATC
GATTTAAACGACACTGCGGAAGACACAGAAGCTGAAAACCAGCCAGAGAT
GGTGAATCCTACTACACTCGACCAAATGGAGAAGAAACTACGTTTGATGG
AAAAGAAACACGCTCGCTACCGTAAAAAGTTGTTCGATTCTTCACACACG
ATACGTGGTATAAATTTGGGTCAAGATCGATACCGGCGCCGTTATTTCGT
GCTTCCGAACGCCGGAGGGATTTACGTCGAAGGGCTGGAAAGTGGATTTT
TTGACGAAGAAACGAACGTGAAAACAAAGGAAGAAAAGGAAGAATGCAAA
GAACATTTAGATAGTTTACTGACCACCTTGAAATCTCCAACTGTGTTGAA
ATCCCCTGTGACTGGCCCCAAAACACCGGCCACAAATACACCGTCTGTAT
CAGCATTATCCTCAAATTCAAACGAACTTTTAAAACCGAAACAAGAGAGT
CCTATAcaaacacaacaacaacaaaaacagataaaagtTGAGAATCCTTG
TTCAAGTGATAGTAGTTATGTCAAATCTTGGTTTTCCTTACGGACTAAAA
AACGTTGCGAGTCTTACAAAACTTCAGCTATACGTGAAACGCCTAAAGAG
CGCAAACATTCGCTCATCGTTGCACCGAGGATAGAACGACTTGCCGACGA
CCACCAATTCTTAGAATCTATATACTCTTGTTATTCCACTACTTCTCCTG
GTGGGAAAAACACTTTATTACCTGTCAGCAGATTTCCCTTATCCAAGGAA
AGTATGCATCGGAACTCGTTACTAGGCTTACCGGCTGAATTGGATATGAA
TTTACTTATACAACAAGACCCACAAAAAGCAGCGGAAATTCTTGAAATAC
AGACTGCCAAGCCTCAAGAAATTCCGCCTGAAATGCAGGCGGGTTGGTGG
CGGATCACCGATCCAGAACAAATGCAGCGCCTGAACAAGTGCGCCCACGC
CAGGGGTATGAGAGAACGGAACCTTCAAAAGACGGTGGTGCGATTCCAAG
ACTACACCAACTCATCGTGTAAAGTTGACCATCTTGCATtttctcTACTT
CTCCCCGACGAAGAAAGTGAAAGCAAAGACAAAGTAACAGAAGACGACAG
CAGCGTTGCCACATCAACGGATACAAACAAATCGATACAAGATAAATGGT
ATCCACAGCTGGCGTATGCAAGTGACAAAGCCATTTTGATTGAAGTCGAA
GAATTAGAGGAAAAGGTCTTCTCGGCTAGTTTGCAAGTCAAGGGCTGGCG
TTTGTCTCAAAAGATCTCTCCAGCACTTCTGCTGAGCACGAGTAACGATC
AAGCTGAGTATGATCCACCCGAAGATAAATATCCCATCAGGATAGCGGCT
TCCCGTCTCCTAGCTCTTGAGCTCGGTATCGAACGACGTTACATGAAGCC
TCCATTCCGTACACCAGACAGCCTTCCTAAACCGGACGCCCCAGAGGCTA
AAGAAGAACCAGTCAAGAATCCAAAAGCAACAGCCCAACTGGAGAAATGG
CGTGAAGCAGTAAGCGAAGCAAAATCGTCAGCTCAGCTATCGATGTGTAT
CACAGCACTCTTCGAATGTGTCGCTTGGGAGAAGTCCATCATGAAAGTGT
TCTGCATACTATGTCGTAAAAGTGACAACGAAGAAAGATTGTTGCTATGC
GACGCATGTGATCGAGGCTGTCATACGTATTGTTGTAAGCCGAAATTCGA
TAAGATTCCCGATGGTGACTGGTTTTGTCAAGATTGTGTGTTGATGGCGT
CTGGTAGTGATCAGTGCTACAAATGTAAATCGAAGACCGGACGACGTCTG
AAATGTGCATTCTGTCCACGTCATTATCACATGGACTGCCTTGAACCACC
ATTACACAAaACACCTCGTTCGCCTTGGAGTTGTCCCGTCTGCAAGAAAA
CACGCTCCAAGAGTAAACCTCCTCAACGTAAAAAACCACGCGCCGAAGAA
CTTCTCAAGAAAGAGGAACAGAGCAAACAAAAATCCATGTCCAACAGCCG
TGTGCAGACGTCCAAAGACATGGAACCGTGTCGTTTCATATTGAACGAAA
TGGAAAATCACGAATCGTCATGGCCCTTTCTCGTCCCTGTCAATATGAAG
CAGTTTCCAGAGTATTATAAAGTGATCAAGCATCCGATGGATTTCCATAC
CATGAAAACGAAGCTGCGTGATTACCAATACAAGTCAAAAGAAGAGTTCG
CACGTGACGCGCGGTTGGTGTTTTTCAATTGTAAAACGTACAACGAAGAC
GAATCGGAGGTTGGATGTGCAGGTGAAGCGATGCGAagtttcttcgagaa
acgttgGACCGCCCTCAAAAAGGGTGTCTCTTCCACAAACAGTGATAACA
AATTCCACACCAACAAGAAGGGGGAGGGTGTGGAATCATCAGGCGATGAA
GGAGAAGACGCTCAGGAGGAGGGTGAAGGCGATGAAGAAGTATCCAGTTC
GAGTTCTGAAGAAATCTCATCCGAAAGTGAGAGCAGCGAAGTGGAGGAGG
ACAGTGAAAACGAGACCGACTCAAAAACATGAATGGACAATCGTTCCGGT
GGTCAAGGCAACCCATATGATCGACCTTACTATGGGGACCCAAATGTCTT
GAGACAACAAATTCCTGGGTATGCTAACTCTCCTGGAATTTATCCATATT
CCCAGCAGCAGCAACAAGATGGTTTTTCAGGGCGACGACCAGGGCAAGAC
CAGCTTGGTCTCAATAATCATGCTACCGCCAGAACCAACAGCTTGACTTC
ACCTCCACAATCAACCAATCCTTGGATGCACTCTTACCACAATCAAACAC
AACCAAATTCTATGAGCCCTAATTTCAATATGAACATACCGAATATGTTT
CATACAAGGTGGGAACAAGACCAAGCCTCACTTCTACAACAAAGAGAAAT
GATGCAAAGAGAAGAACATGCAAGGATGATGTATCGAGAGCGCTTGCAAA
TGCAAGAGAGAGAAAATCAGTTGAAAATCCAGATGCAGAAGGAGCAAGAG
CGAGAGTTGCAACTTCAGCGTGAAAAAGAAGCACAACTTCAGCGTGAAAG
GGAAGCAAAGGTTCAAAGAGAACGTGAAGCCCAATTAGAAAGAGAGCGAC
AAGCTCAACTTCAAAGAGAACGACAAGCTGCTCTGGAGAAAGAAAGACAG
CTACAGTTGCAGAGGGAAAGAGAAGCTCAATTACAAAGAGAAGCTCAATT
ACAATATCAGATGCAAAGAGAAATGCAACTTGAAAGAGAAAGAGAAGCAA
TGGCAATAAGAGAAAGAGATGCAATCCTTGAACGAGATAGAAAAGCAATG
CTCTACAGAGATGCTTATTTTGCACAACAACATCAACCACAGCAATttcc
aaaccattttggttccaTGCAAAATACATTGCCTAATTTGAATTTCACAC
AATCCAATGAGTCAATGTCTAATCAATTTAACTTCTATAACCAGCCCAGT
ATGCATTCAAATGGTAATCTTCCTAGCAGTACATCGTCTTCTATACTAAA
CTTCTCAATGGATCAAATTTTCAACCCTAATAAGATATCTGAGTCACCTG
TCTCCAAAGCAGCAAGTACCAGTTCTTCCTTTCACTTTCCAATCTCATCA
CCTTCCACCGTCAGCTCAACAACAACTTCATCAACAACGACAACCACAAC
TGCTTTACGTAAAAGCTCATCTAACTCATTTGACAATGGAATTATAAATA
GTATTGTTTCTGATAAGGGATTTTTAACCTCACCCTTGGACAGTAATAGT
CAATTCATGAAAACATGGCAAGAACTACAGGATATGGATTTGagtgaaat
tgagaaaaatgtcCTTGGACCTAAAGATCAAGATTCCCGAAACACTCCAT
TAGCAGATACTCCATTTTCAAACCCTACTACACCAACAGAAATGAATGGG
CTGCCACCAAAACCAATTGATTCTAACTTGAATAACATTGTTAATTCTCT
ACCTGAAAACTCTCTGGATTTAAATAAGCATTccattgaaacaaaagaat
ctttACAAATAACAAACACTGAAGATACACCACCACAACAGAATCTATTG
AATCATCCAAGAAATTTATTATCAGTATCTCAAACAGCTCAAGCTAGCTC
CAATTATACAAACACCAGTGTAACGCAATCAGACATAAACTTGACACATG
TATCAGAAAATTTACTTACCCATAATAGGTCTTGCGTTTCTTCATTTGTT
TCGCCTACGTCATCAGATTTGTATTGCAATCAAGATTTTGATAAGCAATC
AAAACGAGGAGATGATATCAAGCATGAAGAATATTCTAATGAACTTCAAA
GCAATCACTCAAAATCATATGAAAAACAATCATCATCTTCACCTAcaaca
ttaaaacaaaaatcaaaacaatcatttAGTAGTATTGAAAGTTTCCTTGG
TATGAGCAGCGATAGTAAAAAAACTGAAGATAATGATAATGAAAGGATTA
ATGACACCACTAAAAAGCGAGAAAGGATCCCATCAAGTGATGTACAAGAT
CGAATTTCAGTCATAAAACCATTACCAATTTCATCACCACAAATTTCAAA
CACATCCTCTCCTTTGGATATTGTGAATAATGATCATGACACATTGAAAA
GTCCACAAGCAATTGAAAAGCTGAAATCTcctgaagaaattcaaaaagta
aTAGATCATTCTGAATCTGCACCTGTCACACTCATCCATCCATCTATGCG
CCTCAAAAAGCAAAGAAGTCTATCAAACAGTTCAATGACTGCCACCAGTC
CACAACCCGTTATGGAAaaggaaaaaccaaaaacaagtAATAGACGACCG
TTACATCCTTCTATGCGATTACAGACcaataaaaataatacaaaagTTGA
TAAAGCTGAACCTAAAAAGAGTAAGGTTGAAAATCTTGATAACAGTTTTG
ACAGTGGAAAGAATATCTTACACAGTCCAAAAACTGGGCGTTATCAATCT
GAACTTACAAGTACTTCCACCAAATCTTCAACTAGGAAGTTATCTCCGTT
CACTCCTCCAACTGTTACATCACCTTTAACCTCACCACCACTAGTATCAC
CTGGAATTCGAAGTCCCTTCAATGGAAAACCCCTCACTGGAAAACCATTC
TCAACTGGTAAGCCTGTTCATGGAGGAAAACCAGCATCTTATTCAGCTCA
AGGTGGTGGTAAACCAATGCATATGGGAGGGAAACCGACTAGTTTCTCTT
CACATATGACTGTCAAAGAGGAAAAGTCACCAGAAAAAGAGCACACTGGC
AAACCTTTATCTTTTTTGAAGTCCATGGTAgaagaatcttccaaaaacaC
AAACACACTTCAAGGGAAAAAGATCACTGGCAAGAAAAGACCCAGAAAGG
AAACTATCGAGAAACCAGCttcaaaagaaactttaaaaaaagatgACATA
TCAAAATCCCCTGACTTGAAAACAAGTCGTATAACAAAAATGATATCAAC
CCCACCAAGCTCACAAAAATTGACAGATAATATCAAGACTAAGAAACCAC
CACAAGAAAAACAGGCACCTGTTAAAAAACTACCTGTCAAAAGGTCTCCA
AAAGTATCACCTCCCAAGAGAGAAGCTGTAAAAGATTCACCACTGAAAGA
AAATCCTTTTAGAAAATCTATCGTCCAAGCAAAGAGTAAACCAGTActga
caaaacagaaaaatttgaGTAAAGAGAATATTGAAGAATTGAGCACAAGT
GAGGAAAAAGATTCCCCAAAGAAGacattcaaattcaaagggaTCACATT
TGATGCCAAGACTGAAGATGATGATAGCAGTGATTCTGATTCAGACAGCT
CATCAAATTCTGATTcagGGTCGTCAAGTGATAGCAGTGACAACAGTGGA
acagaagaagaaattgaagataTTGAAGACGAAGACGATGACGATACTGC
ATCTCAAACAAGTTCAGTTACAAGCTCTCCTGCAAAGAAAACACAAAGAG
CTGGTCAAAAACGAAAAGCAGTTCCTGACAATGCAGAGGtGATTGCCAGT
TTGAAGAAACGAAAAGTTGTTGATTTGGATTTGATAAAAGCGCCATTAAA
ATTTggATGGAGAAGGCAGACAAGACTCAGACCGAACAATGCTGGTGATG
GGCTGAGGGGAGATGTTTATTATTATTCACCTTGTGGGAAAAAGCTGAGG
ACGTATCCTGAGTTAAACAGTtACATCTTTCGAAATGATGTCGTTGATGT
AGACTTGAAGAATTTCAGCTTTTCAACCAAACTTCGTGTTGGCGAATTCA
TGCAGGCTAAGGATGGTTCAAAGTTTGTGACACTGACTGAAGAAGAGATC
GATGAAACATTTGTTATGATGGAAGAAAGGAGAAGTGCTTCTGCAAAAAG
AGCTGaagaaaagaagagagaaaaacgTGAAAAGGAGGAGAAGCAACGTC
AGATACTTGAGGAGAGAAAAAAGAAGAGAGAAGAAGCCTTGGAAAGAAAG
AGATCGAAAGAAGAAGAAAGGAGAAAGGTTCAAAAAGACAAAGCATTGGA
AGCAAAGATGAAGAAGGAGAAAGAAAAGGAAGCAGCACAAGAAGCCAAAC
GATTGAAAGAGGAGGCAATAATGTTGAAGAAACTAGAAAGGCAAGCTCAA
ATGGAAGCAAGTCGAATTGCCAAGCGTGAGAAAGTTCAAAATATGTTGGC
TGAAAAGCAGAAGATGAAAGAACAAAGAGAACATGAACGAGTCATGAAGA
TTGAGAACCAAAAAGTGgagaaagaaatgaaattacAAGCAATCGAAAAT
gaGAAGGAACGTAAAAGGCTGCAACAAGTGAAAAGTAAAGTATCAGAAAA
AGAAAAGCGAAAACGAGAGCTGGTCATGATGAAAGCTTATGAAGCACAAC
GGAGAGCTGAGGAGAGAGAACGCCTCAAAGAACAAAAGAAGCTGGAGAAA
ACCTTGATCAGGCAACGAAAATTGGAACAGAAAAGATATGAGCGCATGAT
CtctaaagaattgaaaaaacctATCGATGATATGGCTCTGAATGATTTGA
AGCCGTTGCCAGAGTTACCAAGGGTAACCAACATCAACATTCCTGGCAAA
GCATATGCAGATATCCTGATGGTTCAAGAGTTTGTTCACGCCTTTGGTCA
TGTCATTGATATCGATCCAGAGAAGGAGTTTCCAAGCATGGGAGAGTTGC
AATCATCATTGTTGTGTGAATCTGGTAGCGATGAAGCAATCTTCACTGCA
TGCCAAGCACTTCTTTTTTACGCCCTCTACGATCCCGGTGTATCTGGGCC
TTATGCCAAAACTTCACTGGGTTCAGACCTTACGAGTATCGAATTGAACG
AGAACAACATATCAGAAGTATTACGTCTTTTCATCTTATCACGTAATGAA
GGAAAACAACACACACTCAGTGATCAGCTCACCAAATATCCTTTAGAAGC
TCTCTCACCCAGTAGTAAAGCTGCTGTTCTAGCTTTCATTGTCAACGAAC
TGCTTTGTGGAAAATCAGTTAGCAGAGAGATTGACGGTAGCTTggagaac
atttcaaatatgCGAAGGGATAAATGGAACCTGGAAGGAGATATACGGAA
aTTGAAAGCTGATCTATTATCAAAGCAACCCAAGAAAGCAGCCAGTGATC
AACAACAGAAcctaaaaaacaacaaaggaGAGTCGAAGAAAAGAGACTCT
GACGAGGAGAACAATTCGGACGATGAAGGAACCACTATCACCACTGCTAA
GGAGAGCAATATCGATTTAAACGACACTGCGGAAGACACAGAAGCTGAAA
ACCAGCCAGAGATGGTGAATCCTACTACACTCGACCAAATGGAGAAGAAA
CTACGTTTGATGGAAAAGAAACACGCTCGCTACCGTAAAAAGTTGTTCGA
TTCTTCACACACGATACGTGGTATAAATTTGGGTCAAGATCGATACCGGC
GCCGTTATTTCGTGCTTCCGAACGCCGGAGGGATTTACGTCGAAGGGCTG
GAAAGTGGATTTTTTGACGAAGAAACGAACGTGAAAACAAAGGAAGAAAA
GGAAGAATGCAAAGAACATTTAGATAGTTTACTGACCACCTTGAAATCTC
CAACTGTGTTGAAATCCCCTGTGACTGGCCCCAAAACACCGGCCACAAAT
ACACCGTCTGTATCAGCATTATCCTCAAATTCAAACGAACTTTTAAAACC
GAAACAAGAGAGTCCTATAcaaacacaacaacaacaaaaacagataaaag
tTGAGAATCCTTGTTCAAGTGATAGTAGTTATGTCAAATCTTGGTTTTCC
TTACGGACTAAAAAACGTTGCGAGTCTTACAAAACTTCAGCTATACGTGA
AACGCCTAAAGAGCGCAAACATTCGCTCATCGTTGCACCGAGGATAGAAC
GACTTGCCGACGACCACCAATTCTTAGAATCTATATACTCTTGTTATTCC
ACTACTTCTCCTGGTGGGAAAAACACTTTATTACCTGTCAGCAGATTTCC
CTTATCCAAGGAAAGTATGCATCGGAACTCGTTACTAGGCTTACCGGCTG
AATTGGATATGAATTTACTTATACAACAAGACCCACAAAAAGCAGCGGAA
ATTCTTGAAATACAGACTGCCAAGCCTCAAGAAATTCCGCCTGAAATGCA
GGCGGGTTGGTGGCGGATCACCGATCCAGAACAAATGCAGCGCCTGAACA
AGTGCGCCCACGCCAGGGGTATGAGAGAACGGAACCTTCAAAAGACGGTG
GTGCGATTCCAAGACTACACCAACTCATCGTGTAAAGTTGACCATCTTGC
ATtttctcTACTTCTCCCCGACGAAGAAAGTGAAAGCAAAGACAAAGTAA
CAGAAGACGACAGCAGCGTTGCCACATCAACGGATACAAACAAATCGATA
CAAGATAAATGGTATCCACAGCTGGCGTATGCAAGTGACAAAGCCATTTT
GATTGAAGTCGAAGAATTAGAGGAAAAGGTCTTCTCGGCTAGTTTGCAAG
TCAAGGGCTGGCGTTTGTCTCAAAAGATCTCTCCAGCACTTCTGCTGAGC
ACGAGTAACGATCAAGCTGAGTATGATCCACCCGAAGATAAATATCCCAT
CAGGATAGCGGCTTCCCGTCTCCTAGCTCTTGAGCTCGGTATCGAACGAC
GTTACATGAAGCCTCCATTCCGTACACCAGACAGCCTTCCTAAACCGGAC
GCCCCAGAGGCTAAAGAAGAACCAGTCAAGAATCCAAAAGCAACAGCCCA
ACTGGAGAAATGGCGTGAAGCAGTAAGCGAAGCAAAATCGTCAGCTCAGC
TATCGATGTGTATCACAGCACTCTTCGAATGTGTCGCTTGGGAGAAGTCC
ATCATGAAAGTGTTCTGCATACTATGTCGTAAAAGTGACAACGAAGAAAG
ATTGTTGCTATGCGACGCATGTGATCGAGGCTGTCATACGTATTGTTGTA
AGCCGAAATTCGATAAGATTCCCGATGGTGACTGGTTTTGTCAAGATTGT
GTGTTGATGGCGTCTGGTAGTGATCAGTGCTACAAATGTAAATCGAAGAC
CGGACGACGTCTGAAATGTGCATTCTGTCCACGTCATTATCACATGGACT
GCCTTGAACCACCATTACACAAaACACCTCGTTCGCCTTGGAGTTGTCCC
GTCTGCAAGAAAACACGCTCCAAGAGTAAACCTCCTCAACGTAAAAAACC
ACGCGCCGAAGAACTTCTCAAGAAAGAGGAACAGAGCAAACAAAAATCCA
TGTCCAACAGCCGTGTGCAGACGTCCAAAGACATGGAACCGTGTCGTTTC
ATATTGAACGAAATGGAAAATCACGAATCGTCATGGCCCTTTCTCGTCCC
TGTCAATATGAAGCAGTTTCCAGAGTATTATAAAGTGATCAAGCATCCGA
TGGATTTCCATACCATGAAAACGAAGCTGCGTGATTACCAATACAAGTCA
AAAGAAGAGTTCGCACGTGACGCGCGGTTGGTGTTTTTCAATTGTAAAAC
GTACAACGAAGACGAATCGGAGGTTGGATGTGCAGGTGAAGCGATGCGAa
gtttcttcgagaaacgttgGACCGCCCTCAAAAAGGGTGTCTCTTCCACA
AACAGTGATAACAAATTCCACACCAACAAGAAGGGGGAGGGTGTGGAATC
ATCAGGCGATGAAGGAGAAGACGCTCAGGAGGAGGGTGAAGGCGATGAAG
AAGTATCCAGTTCGAGTTCTGAAGAAATCTCATCCGAAAGTGAGAGCAGC
GAAGTGGAGGAGGACAGTGAAAACGAGACCGACTCAAAAACATGAATGGA
CAATCGTTCCGGTGGTCAAGGCAACCCATATGATCGACCTTACTATGGGG
ACCCAAATGTCTTGAGACAACAAATTCCTGGGTATGCTAACTCTCCTGGA
ATTTATCCATATTCCCAGCAGCAGCAACAAGATGGTTTTTCAGGGCGACG
ACCAGGGCAAGACCAGCTTGGTCTCAATAATCATGCTACCGCCAGAACCA
ACAGCTTGACTTCACCTCCACAATCAACCAATCCTTGGATGCACTCTTAC
CACAATCAAACACAACCAAATTCTATGAGCCCTAATTTCAATATGAACAT
ACCGAATATGTTTCATACAAGGTGGGAACAAGACCAAGCCTCACTTCTAC
AACAAAGAGAAATGATGCAAAGAGAAGAACATGCAAGGATGATGTATCGA
GAGCGCTTGCAAATGCAAGAGAGAGAAAATCAGTTGAAAATCCAGATGCA
GAAGGAGCAAGAGCGAGAGTTGCAACTTCAGCGTGAAAAAGAAGCACAAC
TTCAGCGTGAAAGGGAAGCAAAGGTTCAAAGAGAACGTGAAGCCCAATTA
GAAAGAGAGCGACAAGCTCAACTTCAAAGAGAACGACAAGCTGCTCTGGA
GAAAGAAAGACAGCTACAGTTGCAGAGGGAAAGAGAAGCTCAATTACAAA
GAGAAGCTCAATTACAATATCAGATGCAAAGAGAAATGCAACTTGAAAGA
GAAAGAGAAGCAATGGCAATAAGAGAAAGAGATGCAATCCTTGAACGAGA
TAGAAAAGCAATGCTCTACAGAGATGCTTATTTTGCACAACAACATCAAC
CACAGCAATttccaaaccattttggttccaTGCAAAATACATTGCCTAAT
TTGAATTTCACACAATCCAATGAGTCAATGTCTAATCAATTTAACTTCTA
TAACCAGCCCAGTATGCATTCAAATGGTAATCTTCCTAGCAGTACATCGT
CTTCTATACTAAACTTCTCAATGGATCAAATTTTCAACCCTAATAAGATA
TCTGAGTCACCTGTCTCCAAAGCAGCAAGTACCAGTTCTTCCTTTCACTT
TCCAATCTCATCACCTTCCACCGTCAGCTCAACAACAACTTCATCAACAA
CGACAACCACAACTGCTTTACGTAAAAGCTCATCTAACTCATTTGACAAT
GGAATTATAAATAGTATTGTTTCTGATAAGGGATTTTTAACCTCACCCTT
GGACAGTAATAGTCAATTCATGAAAACATGGCAAGAACTACAGGATATGG
ATTTGagtgaaattgagaaaaatgtcCTTGGACCTAAAGATCAAGATTCC
CGAAACACTCCATTAGCAGATACTCCATTTTCAAACCCTACTACACCAAC
AGAAATGAATGGGCTGCCACCAAAACCAATTGATTCTAACTTGAATAACA
TTGTTAATTCTCTACCTGAAAACTCTCTGGATTTAAATAAGCATTccatt
gaaacaaaagaatctttACAAATAACAAACACTGAAGATACACCACCACA
ACAGAATCTATTGAATCATCCAAGAAATTTATTATCAGTATCTCAAACAG
CTCAAGCTAGCTCCAATTATACAAACACCAGTGTAACGCAATCAGACATA
AACTTGACACATGTATCAGAAAATTTACTTACCCATAATAGGTCTTGCGT
TTCTTCATTTGTTTCGCCTACGTCATCAGATTTGTATTGCAATCAAGATT
TTGATAAGCAATCAAAACGAGGAGATGATATCAAGCATGAAGAATATTCT
AATGAACTTCAAAGCAATCACTCAAAATCATATGAAAAACAATCATCATC
TTCACCTAcaacattaaaacaaaaatcaaaacaatcatttAGTAGTATTG
AAAGTTTCCTTGGTATGAGCAGCGATAGTAAAAAAACTGAAGATAATGAT
AATGAAAGGATTAATGACACCACTAAAAAGCGAGAAAGGATCCCATCAAG
TGATGTACAAGATCGAATTTCAGTCATAAAACCATTACCAATTTCATCAC
CACAAATTTCAAACACATCCTCTCCTTTGGATATTGTGAATAATGATCAT
GACACATTGAAAAGTCCACAAGCAATTGAAAAGCTGAAATCTcctgaaga
aattcaaaaagtaaTAGATCATTCTGAATCTGCACCTGTCACACTCATCC
ATCCATCTATGCGCCTCAAAAAGCAAAGAAGTCTATCAAACAGTTCAATG
ACTGCCACCAGTCCACAACCCGTTATGGAAaaggaaaaaccaaaaacaag
tAATAGACGACCGTTACATCCTTCTATGCGATTACAGACcaataaaaata
atacaaaagTTGATAAAGCTGAACCTAAAAAGAGTAAGGTTGAAAATCTT
GATAACAGTTTTGACAGTGGAAAGAATATCTTACACAGTCCAAAAACTGG
GCGTTATCAATCTGAACTTACAAGTACTTCCACCAAATCTTCAACTAGGA
AGTTATCTCCGTTCACTCCTCCAACTGTTACATCACCTTTAACCTCACCA
CCACTAGTATCACCTGGAATTCGAAGTCCCTTCAATGGAAAACCCCTCAC
TGGAAAACCATTCTCAACTGGTAAGCCTGTTCATGGAGGAAAACCAGCAT
CTTATTCAGCTCAAGGTGGTGGTAAACCAATGCATATGGGAGGGAAACCG
ACTAGTTTCTCTTCACATATGACTGTCAAAGAGGAAAAGTCACCAGAAAA
AGAGCACACTGGCAAACCTTTATCTTTTTTGAAGTCCATGGTAgaagaat
cttccaaaaacaCAAACACACTTCAAGGGAAAAAGATCACTGGCAAGAAA
AGACCCAGAAAGGAAACTATCGAGAAACCAGCttcaaaagaaactttaaa
aaaagatgACATATCAAAATCCCCTGACTTGAAAACAAGTCGTATAACAA
AAATGATATCAACCCCACCAAGCTCACAAAAATTGACAGATAATATCAAG
ACTAAGAAACCACCACAAGAAAAACAGGCACCTGTTAAAAAACTACCTGT
CAAAAGGTCTCCAAAAGTATCACCTCCCAAGAGAGAAGCTGTAAAAGATT
CACCACTGAAAGAAAATCCTTTTAGAAAATCTATCGTCCAAGCAAAGAGT
AAACCAGTActgacaaaacagaaaaatttgaGTAAAGAGAATATTGAAGA
ATTGAGCACAAGTGAGGAAAAAGATTCCCCAAAGAAGacattcaaattca
aagggaTCACATTTGATGCCAAGACTGAAGATGATGATAGCAGTGATTCT
GATTCAGACAGCTCATCAAATTCTGATTcagGGTCGTCAAGTGATAGCAG
TGACAACAGTGGAacagaagaagaaattgaagataTTGAAGACGAAGACG
ATGACGATACTGCATCTCAAACAAGTTCAGTTACAAGCTCTCCTGCAAAG
AAAACACAAAGAGCTGGTCAAAAACGAAAAGCAGTTCCTGACAATGCAGA
GGtGATTGCCAGTTTGAAGAAACGAAAAGTTGTTGATTTGGATTTGATAA
AAGCGCCATTAAAATTTggATGGAGAAGGCAGACAAGACTCAGACCGAAC
AATGCTGGTGATGGGCTGAGGGGAGATGTTTATTATTATTCACCTTGTGG
GAAAAAGCTGAGGACGTATCCTGAGTTAAACAGTtACATCTTTCGAAATG
ATGTCGTTGATGTAGACTTGAAGAATTTCAGCTTTTCAACCAAACTTCGT
GTTGGCGAATTCATGCAGGCTAAGGATGGTTCAAAGTTTGTGACACTGAC
TGAAGAAGAGATCGATGAAACATTTGTTATGATGGAAGAAAGGAGAAGTG
CTTCTGCAAAAAGAGCTGaagaaaagaagagagaaaaacgTGAAAAGGAG
GAGAAGCAACGTCAGATACTTGAGGAGAGAAAAAAGAAGAGAGAAGAAGC
CTTGGAAAGAAAGAGATCGAAAGAAGAAGAAAGGAGAAAGGTTCAAAAAG
ACAAAGCATTGGAAGCAAAGATGAAGAAGGAGAAAGAAAAGGAAGCAGCA
CAAGAAGCCAAACGATTGAAAGAGGAGGCAATAATGTTGAAGAAACTAGA
AAGGCAAGCTCAAATGGAAGCAAGTCGAATTGCCAAGCGTGAGAAAGTTC
AAAATATGTTGGCTGAAAAGCAGAAGATGAAAGAACAAAGAGAACATGAA
CGAGTCATGAAGATTGAGAACCAAAAAGTGgagaaagaaatgaaattacA
AGCAATCGAAAATgaGAAGGAACGTAAAAGGCTGCAACAAGTGAAAAGTA
AAGTATCAGAAAAAGAAAAGCGAAAACGAGAGCTGGTCATGATGAAAGCT
TATGAAGCACAACGGAGAGCTGAGGAGAGAGAACGCCTCAAAGAACAAAA
GAAGCTGGAGAAAACCTTGATCAGGCAACGAAAATTGGAACAGAAAAGAT
ATGAGCGCATGATCtctaaagaattgaaaaaacctATCGATGATATGGCT
CTGAATGATTTGAAGCCGTTGCCAGAGTTACCAAGGGTAACCAACATCAA
CATTCCTGGCAAAGCATATGCAGATATCCTGATGGTTCAAGAGTTTGTTC
ACGCCTTTGGTCATGTCATTGATATCGATCCAGAGAAGGAGTTTCCAAGC
ATGGGAGAGTTGCAATCATCATTGTTGTGTGAATCTGGTAGCGATGAAGC
AATCTTCACTGCATGCCAAGCACTTCTTTTTTACGCCCTCTACGATCCCG
GTGTATCTGGGCCTTATGCCAAAACTTCACTGGGTTCAGACCTTACGAGT
ATCGAATTGAACGAGAACAACATATCAGAAGTATTACGTCTTTTCATCTT
ATCACGTAATGAAGGAAAACAACACACACTCAGTGATCAGCTCACCAAAT
ATCCTTTAGAAGCTCTCTCACCCAGTAGTAAAGCTGCTGTTCTAGCTTTC
ATTGTCAACGAACTGCTTTGTGGAAAATCAGTTAGCAGAGAGATTGACGG
TAGCTTggagaacatttcaaatatgCGAAGGGATAAATGGAACCTGGAAG
GAGATATACGGAAaTTGAAAGCTGATCTATTATCAAAGCAACCCAAGAAA
GCAGCCAGTGATCAACAACAGAAcctaaaaaacaacaaaggaGAGTCGAA
GAAAAGAGACTCTGACGAGGAGAACAATTCGGACGATGAAGGAACCACTA
TCACCACTGCTAAGGAGAGCAATATCGATTTAAACGACACTGCGGAAGAC
ACAGAAGCTGAAAACCAGCCAGAGATGGTGAATCCTACTACACTCGACCA
AATGGAGAAGAAACTACGTTTGATGGAAAAGAAACACGCTCGCTACCGTA
AAAAGTTGTTCGATTCTTCACACACGATACGTGGTATAAATTTGGGTCAA
GATCGATACCGGCGCCGTTATTTCGTGCTTCCGAACGCCGGAGGGATTTA
CGTCGAAGGGCTGGAAAGTGGATTTTTTGACGAAGAAACGAACGTGAAAA
CAAAGGAAGAAAAGGAAGAATGCAAAGAACATTTAGATAGTTTACTGACC
ACCTTGAAATCTCCAACTGTGTTGAAATCCCCTGTGACTGGCCCCAAAAC
ACCGGCCACAAATACACCGTCTGTATCAGCATTATCCTCAAATTCAAACG
AACTTTTAAAACCGAAACAAGAGAGTCCTATAcaaacacaacaacaacaa
aaacagataaaagtTGAGAATCCTTGTTCAAGTGATAGTAGTTATGTCAA
ATCTTGGTTTTCCTTACGGACTAAAAAACGTTGCGAGTCTTACAAAACTT
CAGCTATACGTGAAACGCCTAAAGAGCGCAAACATTCGCTCATCGTTGCA
CCGAGGATAGAACGACTTGCCGACGACCACCAATTCTTAGAATCTATATA
CTCTTGTTATTCCACTACTTCTCCTGGTGGGAAAAACACTTTATTACCTG
TCAGCAGATTTCCCTTATCCAAGGAAAGTATGCATCGGAACTCGTTACTA
GGCTTACCGGCTGAATTGGATATGAATTTACTTATACAACAAGACCCACA
AAAAGCAGCGGAAATTCTTGAAATACAGACTGCCAAGCCTCAAGAAATTC
CGCCTGAAATGCAGGCGGGTTGGTGGCGGATCACCGATCCAGAACAAATG
CAGCGCCTGAACAAGTGCGCCCACGCCAGGGGTATGAGAGAACGGAACCT
TCAAAAGACGGTGGTGCGATTCCAAGACTACACCAACTCATCGTGTAAAG
TTGACCATCTTGCATtttctcTACTTCTCCCCGACGAAGAAAGTGAAAGC
AAAGACAAAGTAACAGAAGACGACAGCAGCGTTGCCACATCAACGGATAC
AAACAAATCGATACAAGATAAATGGTATCCACAGCTGGCGTATGCAAGTG
ACAAAGCCATTTTGATTGAAGTCGAAGAATTAGAGGAAAAGGTCTTCTCG
GCTAGTTTGCAAGTCAAGGGCTGGCGTTTGTCTCAAAAGATCTCTCCAGC
ACTTCTGCTGAGCACGAGTAACGATCAAGCTGAGTATGATCCACCCGAAG
ATAAATATCCCATCAGGATAGCGGCTTCCCGTCTCCTAGCTCTTGAGCTC
GGTATCGAACGACGTTACATGAAGCCTCCATTCCGTACACCAGACAGCCT
TCCTAAACCGGACGCCCCAGAGGCTAAAGAAGAACCAGTCAAGAATCCAA
AAGCAACAGCCCAACTGGAGAAATGGCGTGAAGCAGTAAGCGAAGCAAAA
TCGTCAGCTCAGCTATCGATGTGTATCACAGCACTCTTCGAATGTGTCGC
TTGGGAGAAGTCCATCATGAAAGTGTTCTGCATACTATGTCGTAAAAGTG
ACAACGAAGAAAGATTGTTGCTATGCGACGCATGTGATCGAGGCTGTCAT
ACGTATTGTTGTAAGCCGAAATTCGATAAGATTCCCGATGGTGACTGGTT
TTGTCAAGATTGTGTGTTGATGGCGTCTGGTAGTGATCAGTGCTACAAAT
GTAAATCGAAGACCGGACGACGTCTGAAATGTGCATTCTGTCCACGTCAT
TATCACATGGACTGCCTTGAACCACCATTACACAAaACACCTCGTTCGCC
TTGGAGTTGTCCCGTCTGCAAGAAAACACGCTCCAAGAGTAAACCTCCTC
AACGTAAAAAACCACGCGCCGAAGAACTTCTCAAGAAAGAGGAACAGAGC
AAACAAAAATCCATGTCCAACAGCCGTGTGCAGACGTCCAAAGACATGGA
ACCGTGTCGTTTCATATTGAACGAAATGGAAAATCACGAATCGTCATGGC
CCTTTCTCGTCCCTGTCAATATGAAGCAGTTTCCAGAGTATTATAAAGTG
ATCAAGCATCCGATGGATTTCCATACCATGAAAACGAAGCTGCGTGATTA
CCAATACAAGTCAAAAGAAGAGTTCGCACGTGACGCGCGGTTGGTGTTTT
TCAATTGTAAAACGTACAACGAAGACGAATCGGAGGTTGGATGTGCAGGT
GAAGCGATGCGAagtttcttcgagaaacgttgGACCGCCCTCAAAAAGGG
TGTCTCTTCCACAAACAGTGATAACAAATTCCACACCAACAAGAAGGGGG
AGGGTGTGGAATCATCAGGCGATGAAGGAGAAGACGCTCAGGAGGAGGGT
GAAGGCGATGAAGAAGTATCCAGTTCGAGTTCTGAAGAAATCTCATCCGA
AAGTGAGAGCAGCGAAGTGGAGGAGGACAGTGAAAACGAGACCGACTCAA
AAACATGAATGGACAATCGTTCCGGTGGTCAAGGCAACCCATATGATCGA
CCTTACTATGGGGACCCAAATGTCTTGAGACAACAAATTCCTGGGTATGC
TAACTCTCCTGGAATTTATCCATATTCCCAGCAGCAGCAACAAGATGGTT
TTTCAGGGCGACGACCAGGGCAAGACCAGCTTGGTCTCAATAATCATGCT
ACCGCCAGAACCAACAGCTTGACTTCACCTCCACAATCAACCAATCCTTG
GATGCACTCTTACCACAATCAAACACAACCAAATTCTATGAGCCCTAATT
TCAATATGAACATACCGAATATGTTTCATACAAGGTGGGAACAAGACCAA
GCCTCACTTCTACAACAAAGAGAAATGATGCAAAGAGAAGAACATGCAAG
GATGATGTATCGAGAGCGCTTGCAAATGCAAGAGAGAGAAAATCAGTTGA
AAATCCAGATGCAGAAGGAGCAAGAGCGAGAGTTGCAACTTCAGCGTGAA
AAAGAAGCACAACTTCAGCGTGAAAGGGAAGCAAAGGTTCAAAGAGAACG
TGAAGCCCAATTAGAAAGAGAGCGACAAGCTCAACTTCAAAGAGAACGAC
AAGCTGCTCTGGAGAAAGAAAGACAGCTACAGTTGCAGAGGGAAAGAGAA
GCTCAATTACAAAGAGAAGCTCAATTACAATATCAGATGCAAAGAGAAAT
GCAACTTGAAAGAGAAAGAGAAGCAATGGCAATAAGAGAAAGAGATGCAA
TCCTTGAACGAGATAGAAAAGCAATGCTCTACAGAGATGCTTATTTTGCA
CAACAACATCAACCACAGCAATttccaaaccattttggttccaTGCAAAA
TACATTGCCTAATTTGAATTTCACACAATCCAATGAGTCAATGTCTAATC
AATTTAACTTCTATAACCAGCCCAGTATGCATTCAAATGGTAATCTTCCT
AGCAGTACATCGTCTTCTATACTAAACTTCTCAATGGATCAAATTTTCAA
CCCTAATAAGATATCTGAGTCACCTGTCTCCAAAGCAGCAAGTACCAGTT
CTTCCTTTCACTTTCCAATCTCATCACCTTCCACCGTCAGCTCAACAACA
ACTTCATCAACAACGACAACCACAACTGCTTTACGTAAAAGCTCATCTAA
CTCATTTGACAATGGAATTATAAATAGTATTGTTTCTGATAAGGGATTTT
TAACCTCACCCTTGGACAGTAATAGTCAATTCATGAAAACATGGCAAGAA
CTACAGGATATGGATTTGagtgaaattgagaaaaatgtcCTTGGACCTAA
AGATCAAGATTCCCGAAACACTCCATTAGCAGATACTCCATTTTCAAACC
CTACTACACCAACAGAAATGAATGGGCTGCCACCAAAACCAATTGATTCT
AACTTGAATAACATTGTTAATTCTCTACCTGAAAACTCTCTGGATTTAAA
TAAGCATTccattgaaacaaaagaatctttACAAATAACAAACACTGAAG
ATACACCACCACAACAGAATCTATTGAATCATCCAAGAAATTTATTATCA
GTATCTCAAACAGCTCAAGCTAGCTCCAATTATACAAACACCAGTGTAAC
GCAATCAGACATAAACTTGACACATGTATCAGAAAATTTACTTACCCATA
ATAGGTCTTGCGTTTCTTCATTTGTTTCGCCTACGTCATCAGATTTGTAT
TGCAATCAAGATTTTGATAAGCAATCAAAACGAGGAGATGATATCAAGCA
TGAAGAATATTCTAATGAACTTCAAAGCAATCACTCAAAATCATATGAAA
AACAATCATCATCTTCACCTAcaacattaaaacaaaaatcaaaacaatca
tttAGTAGTATTGAAAGTTTCCTTGGTATGAGCAGCGATAGTAAAAAAAC
TGAAGATAATGATAATGAAAGGATTAATGACACCACTAAAAAGCGAGAAA
GGATCCCATCAAGTGATGTACAAGATCGAATTTCAGTCATAAAACCATTA
CCAATTTCATCACCACAAATTTCAAACACATCCTCTCCTTTGGATATTGT
GAATAATGATCATGACACATTGAAAAGTCCACAAGCAATTGAAAAGCTGA
AATCTcctgaagaaattcaaaaagtaaTAGATCATTCTGAATCTGCACCT
GTCACACTCATCCATCCATCTATGCGCCTCAAAAAGCAAAGAAGTCTATC
AAACAGTTCAATGACTGCCACCAGTCCACAACCCGTTATGGAAaaggaaa
aaccaaaaacaagtAATAGACGACCGTTACATCCTTCTATGCGATTACAG
ACcaataaaaataatacaaaagTTGATAAAGCTGAACCTAAAAAGAGTAA
GGTTGAAAATCTTGATAACAGTTTTGACAGTGGAAAGAATATCTTACACA
GTCCAAAAACTGGGCGTTATCAATCTGAACTTACAAGTACTTCCACCAAA
TCTTCAACTAGGAAGTTATCTCCGTTCACTCCTCCAACTGTTACATCACC
TTTAACCTCACCACCACTAGTATCACCTGGAATTCGAAGTCCCTTCAATG
GAAAACCCCTCACTGGAAAACCATTCTCAACTGGTAAGCCTGTTCATGGA
GGAAAACCAGCATCTTATTCAGCTCAAGGTGGTGGTAAACCAATGCATAT
GGGAGGGAAACCGACTAGTTTCTCTTCACATATGACTGTCAAAGAGGAAA
AGTCACCAGAAAAAGAGCACACTGGCAAACCTTTATCTTTTTTGAAGTCC
ATGGTAgaagaatcttccaaaaacaCAAACACACTTCAAGGGAAAAAGAT
CACTGGCAAGAAAAGACCCAGAAAGGAAACTATCGAGAAACCAGCttcaa
aagaaactttaaaaaaagatgACATATCAAAATCCCCTGACTTGAAAACA
AGTCGTATAACAAAAATGATATCAACCCCACCAAGCTCACAAAAATTGAC
AGATAATATCAAGACTAAGAAACCACCACAAGAAAAACAGGCACCTGTTA
AAAAACTACCTGTCAAAAGGTCTCCAAAAGTATCACCTCCCAAGAGAGAA
GCTGTAAAAGATTCACCACTGAAAGAAAATCCTTTTAGAAAATCTATCGT
CCAAGCAAAGAGTAAACCAGTActgacaaaacagaaaaatttgaGTAAAG
AGAATATTGAAGAATTGAGCACAAGTGAGGAAAAAGATTCCCCAAAGAAG
acattcaaattcaaagggaTCACATTTGATGCCAAGACTGAAGATGATGA
TAGCAGTGATTCTGATTCAGACAGCTCATCAAATTCTGATTcagGGTCGT
CAAGTGATAGCAGTGACAACAGTGGAacagaagaagaaattgaagataTT
GAAGACGAAGACGATGACGATACTGCATCTCAAACAAGTTCAGTTACAAG
CTCTCCTGCAAAGAAAACACAAAGAGCTGGTCAAAAACGAAAAGCAGTTC
CTGACAATGCAGAGGtGATTGCCAGTTTGAAGAAACGAAAAGTTGTTGAT
TTGGATTTGATAAAAGCGCCATTAAAATTTggATGGAGAAGGCAGACAAG
ACTCAGACCGAACAATGCTGGTGATGGGCTGAGGGGAGATGTTTATTATT
ATTCACCTTGTGGGAAAAAGCTGAGGACGTATCCTGAGTTAAACAGTtAC
ATCTTTCGAAATGATGTCGTTGATGTAGACTTGAAGAATTTCAGCTTTTC
AACCAAACTTCGTGTTGGCGAATTCATGCAGGCTAAGGATGGTTCAAAGT
TTGTGACACTGACTGAAGAAGAGATCGATGAAACATTTGTTATGATGGAA
GAAAGGAGAAGTGCTTCTGCAAAAAGAGCTGaagaaaagaagagagaaaa
acgTGAAAAGGAGGAGAAGCAACGTCAGATACTTGAGGAGAGAAAAAAGA
AGAGAGAAGAAGCCTTGGAAAGAAAGAGATCGAAAGAAGAAGAAAGGAGA
AAGGTTCAAAAAGACAAAGCATTGGAAGCAAAGATGAAGAAGGAGAAAGA
AAAGGAAGCAGCACAAGAAGCCAAACGATTGAAAGAGGAGGCAATAATGT
TGAAGAAACTAGAAAGGCAAGCTCAAATGGAAGCAAGTCGAATTGCCAAG
CGTGAGAAAGTTCAAAATATGTTGGCTGAAAAGCAGAAGATGAAAGAACA
AAGAGAACATGAACGAGTCATGAAGATTGAGAACCAAAAAGTGgagaaag
aaatgaaattacAAGCAATCGAAAATgaGAAGGAACGTAAAAGGCTGCAA
CAAGTGAAAAGTAAAGTATCAGAAAAAGAAAAGCGAAAACGAGAGCTGGT
CATGATGAAAGCTTATGAAGCACAACGGAGAGCTGAGGAGAGAGAACGCC
TCAAAGAACAAAAGAAGCTGGAGAAAACCTTGATCAGGCAACGAAAATTG
GAACAGAAAAGATATGAGCGCATGATCtctaaagaattgaaaaaacctAT
CGATGATATGGCTCTGAATGATTTGAAGCCGTTGCCAGAGTTACCAAGGG
TAACCAACATCAACATTCCTGGCAAAGCATATGCAGATATCCTGATGGTT
CAAGAGTTTGTTCACGCCTTTGGTCATGTCATTGATATCGATCCAGAGAA
GGAGTTTCCAAGCATGGGAGAGTTGCAATCATCATTGTTGTGTGAATCTG
GTAGCGATGAAGCAATCTTCACTGCATGCCAAGCACTTCTTTTTTACGCC
CTCTACGATCCCGGTGTATCTGGGCCTTATGCCAAAACTTCACTGGGTTC
AGACCTTACGAGTATCGAATTGAACGAGAACAACATATCAGAAGTATTAC
GTCTTTTCATCTTATCACGTAATGAAGGAAAACAACACACACTCAGTGAT
CAGCTCACCAAATATCCTTTAGAAGCTCTCTCACCCAGTAGTAAAGCTGC
TGTTCTAGCTTTCATTGTCAACGAACTGCTTTGTGGAAAATCAGTTAGCA
GAGAGATTGACGGTAGCTTggagaacatttcaaatatgCGAAGGGATAAA
TGGAACCTGGAAGGAGATATACGGAAaTTGAAAGCTGATCTATTATCAAA
GCAACCCAAGAAAGCAGCCAGTGATCAACAACAGAAcctaaaaaacaaca
aaggaGAGTCGAAGAAAAGAGACTCTGACGAGGAGAACAATTCGGACGAT
GAAGGAACCACTATCACCACTGCTAAGGAGAGCAATATCGATTTAAACGA
CACTGCGGAAGACACAGAAGCTGAAAACCAGCCAGAGATGGTGAATCCTA
CTACACTCGACCAAATGGAGAAGAAACTACGTTTGATGGAAAAGAAACAC
GCTCGCTACCGTAAAAAGTTGTTCGATTCTTCACACACGATACGTGGTAT
AAATTTGGGTCAAGATCGATACCGGCGCCGTTATTTCGTGCTTCCGAACG
CCGGAGGGATTTACGTCGAAGGGCTGGAAAGTGGATTTTTTGACGAAGAA
ACGAACGTGAAAACAAAGGAAGAAAAGGAAGAATGCAAAGAACATTTAGA
TAGTTTACTGACCACCTTGAAATCTCCAACTGTGTTGAAATCCCCTGTGA
CTGGCCCCAAAACACCGGCCACAAATACACCGTCTGTATCAGCATTATCC
TCAAATTCAAACGAACTTTTAAAACCGAAACAAGAGAGTCCTATAcaaac
acaacaacaacaaaaacagataaaagtTGAGAATCCTTGTTCAAGTGATA
GTAGTTATGTCAAATCTTGGTTTTCCTTACGGACTAAAAAACGTTGCGAG
TCTTACAAAACTTCAGCTATACGTGAAACGCCTAAAGAGCGCAAACATTC
GCTCATCGTTGCACCGAGGATAGAACGACTTGCCGACGACCACCAATTCT
TAGAATCTATATACTCTTGTTATTCCACTACTTCTCCTGGTGGGAAAAAC
ACTTTATTACCTGTCAGCAGATTTCCCTTATCCAAGGAAAGTATGCATCG
GAACTCGTTACTAGGCTTACCGGCTGAATTGGATATGAATTTACTTATAC
AACAAGACCCACAAAAAGCAGCGGAAATTCTTGAAATACAGACTGCCAAG
CCTCAAGAAATTCCGCCTGAAATGCAGGCGGGTTGGTGGCGGATCACCGA
TCCAGAACAAATGCAGCGCCTGAACAAGTGCGCCCACGCCAGGGGTATGA
GAGAACGGAACCTTCAAAAGACGGTGGTGCGATTCCAAGACTACACCAAC
TCATCGTGTAAAGTTGACCATCTTGCATtttctcTACTTCTCCCCGACGA
AGAAAGTGAAAGCAAAGACAAAGTAACAGAAGACGACAGCAGCGTTGCCA
CATCAACGGATACAAACAAATCGATACAAGATAAATGGTATCCACAGCTG
GCGTATGCAAGTGACAAAGCCATTTTGATTGAAGTCGAAGAATTAGAGGA
AAAGGTCTTCTCGGCTAGTTTGCAAGTCAAGGGCTGGCGTTTGTCTCAAA
AGATCTCTCCAGCACTTCTGCTGAGCACGAGTAACGATCAAGCTGAGTAT
GATCCACCCGAAGATAAATATCCCATCAGGATAGCGGCTTCCCGTCTCCT
AGCTCTTGAGCTCGGTATCGAACGACGTTACATGAAGCCTCCATTCCGTA
CACCAGACAGCCTTCCTAAACCGGACGCCCCAGAGGCTAAAGAAGAACCA
GTCAAGAATCCAAAAGCAACAGCCCAACTGGAGAAATGGCGTGAAGCAGT
AAGCGAAGCAAAATCGTCAGCTCAGCTATCGATGTGTATCACAGCACTCT
TCGAATGTGTCGCTTGGGAGAAGTCCATCATGAAAGTGTTCTGCATACTA
TGTCGTAAAAGTGACAACGAAGAAAGATTGTTGCTATGCGACGCATGTGA
TCGAGGCTGTCATACGTATTGTTGTAAGCCGAAATTCGATAAGATTCCCG
ATGGTGACTGGTTTTGTCAAGATTGTGTGTTGATGGCGTCTGGTAGTGAT
CAGTGCTACAAATGTAAATCGAAGACCGGACGACGTCTGAAATGTGCATT
CTGTCCACGTCATTATCACATGGACTGCCTTGAACCACCATTACACAAaA
CACCTCGTTCGCCTTGGAGTTGTCCCGTCTGCAAGAAAACACGCTCCAAG
AGTAAACCTCCTCAACGTAAAAAACCACGCGCCGAAGAACTTCTCAAGAA
AGAGGAACAGAGCAAACAAAAATCCATGTCCAACAGCCGTGTGCAGACGT
CCAAAGACATGGAACCGTGTCGTTTCATATTGAACGAAATGGAAAATCAC
GAATCGTCATGGCCCTTTCTCGTCCCTGTCAATATGAAGCAGTTTCCAGA
GTATTATAAAGTGATCAAGCATCCGATGGATTTCCATACCATGAAAACGA
AGCTGCGTGATTACCAATACAAGTCAAAAGAAGAGTTCGCACGTGACGCG
CGGTTGGTGTTTTTCAATTGTAAAACGTACAACGAAGACGAATCGGAGGT
TGGATGTGCAGGTGAAGCGATGCGAagtttcttcgagaaacgttgGACCG
CCCTCAAAAAGGGTGTCTCTTCCACAAACAGTGATAACAAATTCCACACC
AACAAGAAGGGGGAGGGTGTGGAATCATCAGGCGATGAAGGAGAAGACGC
TCAGGAGGAGGGTGAAGGCGATGAAGAAGTATCCAGTTCGAGTTCTGAAG
AAATCTCATCCGAAAGTGAGAGCAGCGAAGTGGAGGAGGACAGTGAAAAC
GAGACCGACTCAAAAACATGAATGGACAATCGTTCCGGTGGTCAAGGCAA
CCCATATGATCGACCTTACTATGGGGACCCAAATGTCTTGAGACAACAAA
TTCCTGGGTATGCTAACTCTCCTGGAATTTATCCATATTCCCAGCAGCAG
CAACAAGATGGTTTTTCAGGGCGACGACCAGGGCAAGACCAGCTTGGTCT
CAATAATCATGCTACCGCCAGAACCAACAGCTTGACTTCACCTCCACAAT
CAACCAATCCTTGGATGCACTCTTACCACAATCAAACACAACCAAATTCT
ATGAGCCCTAATTTCAATATGAACATACCGAATATGTTTCATACAAGGTG
GGAACAAGACCAAGCCTCACTTCTACAACAAAGAGAAATGATGCAAAGAG
AAGAACATGCAAGGATGATGTATCGAGAGCGCTTGCAAATGCAAGAGAGA
GAAAATCAGTTGAAAATCCAGATGCAGAAGGAGCAAGAGCGAGAGTTGCA
ACTTCAGCGTGAAAAAGAAGCACAACTTCAGCGTGAAAGGGAAGCAAAGG
TTCAAAGAGAACGTGAAGCCCAATTAGAAAGAGAGCGACAAGCTCAACTT
CAAAGAGAACGACAAGCTGCTCTGGAGAAAGAAAGACAGCTACAGTTGCA
GAGGGAAAGAGAAGCTCAATTACAAAGAGAAGCTCAATTACAATATCAGA
TGCAAAGAGAAATGCAACTTGAAAGAGAAAGAGAAGCAATGGCAATAAGA
GAAAGAGATGCAATCCTTGAACGAGATAGAAAAGCAATGCTCTACAGAGA
TGCTTATTTTGCACAACAACATCAACCACAGCAATttccaaaccattttg
gttccaTGCAAAATACATTGCCTAATTTGAATTTCACACAATCCAATGAG
TCAATGTCTAATCAATTTAACTTCTATAACCAGCCCAGTATGCATTCAAA
TGGTAATCTTCCTAGCAGTACATCGTCTTCTATACTAAACTTCTCAATGG
ATCAAATTTTCAACCCTAATAAGATATCTGAGTCACCTGTCTCCAAAGCA
GCAAGTACCAGTTCTTCCTTTCACTTTCCAATCTCATCACCTTCCACCGT
CAGCTCAACAACAACTTCATCAACAACGACAACCACAACTGCTTTACGTA
AAAGCTCATCTAACTCATTTGACAATGGAATTATAAATAGTATTGTTTCT
GATAAGGGATTTTTAACCTCACCCTTGGACAGTAATAGTCAATTCATGAA
AACATGGCAAGAACTACAGGATATGGATTTGagtgaaattgagaaaaatg
tcCTTGGACCTAAAGATCAAGATTCCCGAAACACTCCATTAGCAGATACT
CCATTTTCAAACCCTACTACACCAACAGAAATGAATGGGCTGCCACCAAA
ACCAATTGATTCTAACTTGAATAACATTGTTAATTCTCTACCTGAAAACT
CTCTGGATTTAAATAAGCATTccattgaaacaaaagaatctttACAAATA
ACAAACACTGAAGATACACCACCACAACAGAATCTATTGAATCATCCAAG
AAATTTATTATCAGTATCTCAAACAGCTCAAGCTAGCTCCAATTATACAA
ACACCAGTGTAACGCAATCAGACATAAACTTGACACATGTATCAGAAAAT
TTACTTACCCATAATAGGTCTTGCGTTTCTTCATTTGTTTCGCCTACGTC
ATCAGATTTGTATTGCAATCAAGATTTTGATAAGCAATCAAAACGAGGAG
ATGATATCAAGCATGAAGAATATTCTAATGAACTTCAAAGCAATCACTCA
AAATCATATGAAAAACAATCATCATCTTCACCTAcaacattaaaacaaaa
atcaaaacaatcatttAGTAGTATTGAAAGTTTCCTTGGTATGAGCAGCG
ATAGTAAAAAAACTGAAGATAATGATAATGAAAGGATTAATGACACCACT
AAAAAGCGAGAAAGGATCCCATCAAGTGATGTACAAGATCGAATTTCAGT
CATAAAACCATTACCAATTTCATCACCACAAATTTCAAACACATCCTCTC
CTTTGGATATTGTGAATAATGATCATGACACATTGAAAAGTCCACAAGCA
ATTGAAAAGCTGAAATCTcctgaagaaattcaaaaagtaaTAGATCATTC
TGAATCTGCACCTGTCACACTCATCCATCCATCTATGCGCCTCAAAAAGC
AAAGAAGTCTATCAAACAGTTCAATGACTGCCACCAGTCCACAACCCGTT
ATGGAAaaggaaaaaccaaaaacaagtAATAGACGACCGTTACATCCTTC
TATGCGATTACAGACcaataaaaataatacaaaagTTGATAAAGCTGAAC
CTAAAAAGAGTAAGGTTGAAAATCTTGATAACAGTTTTGACAGTGGAAAG
AATATCTTACACAGTCCAAAAACTGGGCGTTATCAATCTGAACTTACAAG
TACTTCCACCAAATCTTCAACTAGGAAGTTATCTCCGTTCACTCCTCCAA
CTGTTACATCACCTTTAACCTCACCACCACTAGTATCACCTGGAATTCGA
AGTCCCTTCAATGGAAAACCCCTCACTGGAAAACCATTCTCAACTGGTAA
GCCTGTTCATGGAGGAAAACCAGCATCTTATTCAGCTCAAGGTGGTGGTA
AACCAATGCATATGGGAGGGAAACCGACTAGTTTCTCTTCACATATGACT
GTCAAAGAGGAAAAGTCACCAGAAAAAGAGCACACTGGCAAACCTTTATC
TTTTTTGAAGTCCATGGTAgaagaatcttccaaaaacaCAAACACACTTC
AAGGGAAAAAGATCACTGGCAAGAAAAGACCCAGAAAGGAAACTATCGAG
AAACCAGCttcaaaagaaactttaaaaaaagatgACATATCAAAATCCCC
TGACTTGAAAACAAGTCGTATAACAAAAATGATATCAACCCCACCAAGCT
CACAAAAATTGACAGATAATATCAAGACTAAGAAACCACCACAAGAAAAA
CAGGCACCTGTTAAAAAACTACCTGTCAAAAGGTCTCCAAAAGTATCACC
TCCCAAGAGAGAAGCTGTAAAAGATTCACCACTGAAAGAAAATCCTTTTA
GAAAATCTATCGTCCAAGCAAAGAGTAAACCAGTActgacaaaacagaaa
aatttgaGTAAAGAGAATATTGAAGAATTGAGCACAAGTGAGGAAAAAGA
TTCCCCAAAGAAGacattcaaattcaaagggaTCACATTTGATGCCAAGA
CTGAAGATGATGATAGCAGTGATTCTGATTCAGACAGCTCATCAAATTCT
GATTcagGGTCGTCAAGTGATAGCAGTGACAACAGTGGAacagaagaaga
aattgaagataTTGAAGACGAAGACGATGACGATACTGCATCTCAAACAA
GTTCAGTTACAAGCTCTCCTGCAAAGAAAACACAAAGAGCTGGTCAAAAA
CGAAAAGCAGTTCCTGACAATGCAGAGGtGATTGCCAGTTTGAAGAAACG
AAAAGTTGTTGATTTGGATTTGATAAAAGCGCCATTAAAATTTggATGGA
GAAGGCAGACAAGACTCAGACCGAACAATGCTGGTGATGGGCTGAGGGGA
GATGTTTATTATTATTCACCTTGTGGGAAAAAGCTGAGGACGTATCCTGA
GTTAAACAGTtACATCTTTCGAAATGATGTCGTTGATGTAGACTTGAAGA
ATTTCAGCTTTTCAACCAAACTTCGTGTTGGCGAATTCATGCAGGCTAAG
GATGGTTCAAAGTTTGTGACACTGACTGAAGAAGAGATCGATGAAACATT
TGTTATGATGGAAGAAAGGAGAAGTGCTTCTGCAAAAAGAGCTGaagaaa
agaagagagaaaaacgTGAAAAGGAGGAGAAGCAACGTCAGATACTTGAG
GAGAGAAAAAAGAAGAGAGAAGAAGCCTTGGAAAGAAAGAGATCGAAAGA
AGAAGAAAGGAGAAAGGTTCAAAAAGACAAAGCATTGGAAGCAAAGATGA
AGAAGGAGAAAGAAAAGGAAGCAGCACAAGAAGCCAAACGATTGAAAGAG
GAGGCAATAATGTTGAAGAAACTAGAAAGGCAAGCTCAAATGGAAGCAAG
TCGAATTGCCAAGCGTGAGAAAGTTCAAAATATGTTGGCTGAAAAGCAGA
AGATGAAAGAACAAAGAGAACATGAACGAGTCATGAAGATTGAGAACCAA
AAAGTGgagaaagaaatgaaattacAAGCAATCGAAAATgaGAAGGAACG
TAAAAGGCTGCAACAAGTGAAAAGTAAAGTATCAGAAAAAGAAAAGCGAA
AACGAGAGCTGGTCATGATGAAAGCTTATGAAGCACAACGGAGAGCTGAG
GAGAGAGAACGCCTCAAAGAACAAAAGAAGCTGGAGAAAACCTTGATCAG
GCAACGAAAATTGGAACAGAAAAGATATGAGCGCATGATCtctaaagaat
tgaaaaaacctATCGATGATATGGCTCTGAATGATTTGAAGCCGTTGCCA
GAGTTACCAAGGGTAACCAACATCAACATTCCTGGCAAAGCATATGCAGA
TATCCTGATGGTTCAAGAGTTTGTTCACGCCTTTGGTCATGTCATTGATA
TCGATCCAGAGAAGGAGTTTCCAAGCATGGGAGAGTTGCAATCATCATTG
TTGTGTGAATCTGGTAGCGATGAAGCAATCTTCACTGCATGCCAAGCACT
TCTTTTTTACGCCCTCTACGATCCCGGTGTATCTGGGCCTTATGCCAAAA
CTTCACTGGGTTCAGACCTTACGAGTATCGAATTGAACGAGAACAACATA
TCAGAAGTATTACGTCTTTTCATCTTATCACGTAATGAAGGAAAACAACA
CACACTCAGTGATCAGCTCACCAAATATCCTTTAGAAGCTCTCTCACCCA
GTAGTAAAGCTGCTGTTCTAGCTTTCATTGTCAACGAACTGCTTTGTGGA
AAATCAGTTAGCAGAGAGATTGACGGTAGCTTggagaacatttcaaatat
gCGAAGGGATAAATGGAACCTGGAAGGAGATATACGGAAaTTGAAAGCTG
ATCTATTATCAAAGCAACCCAAGAAAGCAGCCAGTGATCAACAACAGAAc
ctaaaaaacaacaaaggaGAGTCGAAGAAAAGAGACTCTGACGAGGAGAA
CAATTCGGACGATGAAGGAACCACTATCACCACTGCTAAGGAGAGCAATA
TCGATTTAAACGACACTGCGGAAGACACAGAAGCTGAAAACCAGCCAGAG
ATGGTGAATCCTACTACACTCGACCAAATGGAGAAGAAACTACGTTTGAT
GGAAAAGAAACACGCTCGCTACCGTAAAAAGTTGTTCGATTCTTCACACA
CGATACGTGGTATAAATTTGGGTCAAGATCGATACCGGCGCCGTTATTTC
GTGCTTCCGAACGCCGGAGGGATTTACGTCGAAGGGCTGGAAAGTGGATT
TTTTGACGAAGAAACGAACGTGAAAACAAAGGAAGAAAAGGAAGAATGCA
AAGAACATTTAGATAGTTTACTGACCACCTTGAAATCTCCAACTGTGTTG
AAATCCCCTGTGACTGGCCCCAAAACACCGGCCACAAATACACCGTCTGT
ATCAGCATTATCCTCAAATTCAAACGAACTTTTAAAACCGAAACAAGAGA
GTCCTATAcaaacacaacaacaacaaaaacagataaaagtTGAGAATCCT
TGTTCAAGTGATAGTAGTTATGTCAAATCTTGGTTTTCCTTACGGACTAA
AAAACGTTGCGAGTCTTACAAAACTTCAGCTATACGTGAAACGCCTAAAG
AGCGCAAACATTCGCTCATCGTTGCACCGAGGATAGAACGACTTGCCGAC
GACCACCAATTCTTAGAATCTATATACTCTTGTTATTCCACTACTTCTCC
TGGTGGGAAAAACACTTTATTACCTGTCAGCAGATTTCCCTTATCCAAGG
AAAGTATGCATCGGAACTCGTTACTAGGCTTACCGGCTGAATTGGATATG
AATTTACTTATACAACAAGACCCACAAAAAGCAGCGGAAATTCTTGAAAT
ACAGACTGCCAAGCCTCAAGAAATTCCGCCTGAAATGCAGGCGGGTTGGT
GGCGGATCACCGATCCAGAACAAATGCAGCGCCTGAACAAGTGCGCCCAC
GCCAGGGGTATGAGAGAACGGAACCTTCAAAAGACGGTGGTGCGATTCCA
AGACTACACCAACTCATCGTGTAAAGTTGACCATCTTGCATtttctcTAC
TTCTCCCCGACGAAGAAAGTGAAAGCAAAGACAAAGTAACAGAAGACGAC
AGCAGCGTTGCCACATCAACGGATACAAACAAATCGATACAAGATAAATG
GTATCCACAGCTGGCGTATGCAAGTGACAAAGCCATTTTGATTGAAGTCG
AAGAATTAGAGGAAAAGGTCTTCTCGGCTAGTTTGCAAGTCAAGGGCTGG
CGTTTGTCTCAAAAGATCTCTCCAGCACTTCTGCTGAGCACGAGTAACGA
TCAAGCTGAGTATGATCCACCCGAAGATAAATATCCCATCAGGATAGCGG
CTTCCCGTCTCCTAGCTCTTGAGCTCGGTATCGAACGACGTTACATGAAG
CCTCCATTCCGTACACCAGACAGCCTTCCTAAACCGGACGCCCCAGAGGC
TAAAGAAGAACCAGTCAAGAATCCAAAAGCAACAGCCCAACTGGAGAAAT
GGCGTGAAGCAGTAAGCGAAGCAAAATCGTCAGCTCAGCTATCGATGTGT
ATCACAGCACTCTTCGAATGTGTCGCTTGGGAGAAGTCCATCATGAAAGT
GTTCTGCATACTATGTCGTAAAAGTGACAACGAAGAAAGATTGTTGCTAT
GCGACGCATGTGATCGAGGCTGTCATACGTATTGTTGTAAGCCGAAATTC
GATAAGATTCCCGATGGTGACTGGTTTTGTCAAGATTGTGTGTTGATGGC
GTCTGGTAGTGATCAGTGCTACAAATGTAAATCGAAGACCGGACGACGTC
TGAAATGTGCATTCTGTCCACGTCATTATCACATGGACTGCCTTGAACCA
CCATTACACAAaACACCTCGTTCGCCTTGGAGTTGTCCCGTCTGCAAGAA
AACACGCTCCAAGAGTAAACCTCCTCAACGTAAAAAACCACGCGCCGAAG
AACTTCTCAAGAAAGAGGAACAGAGCAAACAAAAATCCATGTCCAACAGC
CGTGTGCAGACGTCCAAAGACATGGAACCGTGTCGTTTCATATTGAACGA
AATGGAAAATCACGAATCGTCATGGCCCTTTCTCGTCCCTGTCAATATGA
AGCAGTTTCCAGAGTATTATAAAGTGATCAAGCATCCGATGGATTTCCAT
ACCATGAAAACGAAGCTGCGTGATTACCAATACAAGTCAAAAGAAGAGTT
CGCACGTGACGCGCGGTTGGTGTTTTTCAATTGTAAAACGTACAACGAAG
ACGAATCGGAGGTTGGATGTGCAGGTGAAGCGATGCGAagtttcttcgag
aaacgttgGACCGCCCTCAAAAAGGGTGTCTCTTCCACAAACAGTGATAA
CAAATTCCACACCAACAAGAAGGGGGAGGGTGTGGAATCATCAGGCGATG
AAGGAGAAGACGCTCAGGAGGAGGGTGAAGGCGATGAAGAAGTATCCAGT
TCGAGTTCTGAAGAAATCTCATCCGAAAGTGAGAGCAGCGAAGTGGAGGA
GGACAGTGAAAACGAGACCGACTCAAAAACATGAATGGACAATCGTTCCG
GTGGTCAAGGCAACCCATATGATCGACCTTACTATGGGGACCCAAATGTC
TTGAGACAACAAATTCCTGGGTATGCTAACTCTCCTGGAATTTATCCATA
TTCCCAGCAGCAGCAACAAGATGGTTTTTCAGGGCGACGACCAGGGCAAG
ACCAGCTTGGTCTCAATAATCATGCTACCGCCAGAACCAACAGCTTGACT
TCACCTCCACAATCAACCAATCCTTGGATGCACTCTTACCACAATCAAAC
ACAACCAAATTCTATGAGCCCTAATTTCAATATGAACATACCGAATATGT
TTCATACAAGGTGGGAACAAGACCAAGCCTCACTTCTACAACAAAGAGAA
ATGATGCAAAGAGAAGAACATGCAAGGATGATGTATCGAGAGCGCTTGCA
AATGCAAGAGAGAGAAAATCAGTTGAAAATCCAGATGCAGAAGGAGCAAG
AGCGAGAGTTGCAACTTCAGCGTGAAAAAGAAGCACAACTTCAGCGTGAA
AGGGAAGCAAAGGTTCAAAGAGAACGTGAAGCCCAATTAGAAAGAGAGCG
ACAAGCTCAACTTCAAAGAGAACGACAAGCTGCTCTGGAGAAAGAAAGAC
AGCTACAGTTGCAGAGGGAAAGAGAAGCTCAATTACAAAGAGAAGCTCAA
TTACAATATCAGATGCAAAGAGAAATGCAACTTGAAAGAGAAAGAGAAGC
AATGGCAATAAGAGAAAGAGATGCAATCCTTGAACGAGATAGAAAAGCAA
TGCTCTACAGAGATGCTTATTTTGCACAACAACATCAACCACAGCAATtt
ccaaaccattttggttccaTGCAAAATACATTGCCTAATTTGAATTTCAC
ACAATCCAATGAGTCAATGTCTAATCAATTTAACTTCTATAACCAGCCCA
GTATGCATTCAAATGGTAATCTTCCTAGCAGTACATCGTCTTCTATACTA
AACTTCTCAATGGATCAAATTTTCAACCCTAATAAGATATCTGAGTCACC
TGTCTCCAAAGCAGCAAGTACCAGTTCTTCCTTTCACTTTCCAATCTCAT
CACCTTCCACCGTCAGCTCAACAACAACTTCATCAACAACGACAACCACA
ACTGCTTTACGTAAAAGCTCATCTAACTCATTTGACAATGGAATTATAAA
TAGTATTGTTTCTGATAAGGGATTTTTAACCTCACCCTTGGACAGTAATA
GTCAATTCATGAAAACATGGCAAGAACTACAGGATATGGATTTGagtgaa
attgagaaaaatgtcCTTGGACCTAAAGATCAAGATTCCCGAAACACTCC
ATTAGCAGATACTCCATTTTCAAACCCTACTACACCAACAGAAATGAATG
GGCTGCCACCAAAACCAATTGATTCTAACTTGAATAACATTGTTAATTCT
CTACCTGAAAACTCTCTGGATTTAAATAAGCATTccattgaaacaaaaga
atctttACAAATAACAAACACTGAAGATACACCACCACAACAGAATCTAT
TGAATCATCCAAGAAATTTATTATCAGTATCTCAAACAGCTCAAGCTAGC
TCCAATTATACAAACACCAGTGTAACGCAATCAGACATAAACTTGACACA
TGTATCAGAAAATTTACTTACCCATAATAGGTCTTGCGTTTCTTCATTTG
TTTCGCCTACGTCATCAGATTTGTATTGCAATCAAGATTTTGATAAGCAA
TCAAAACGAGGAGATGATATCAAGCATGAAGAATATTCTAATGAACTTCA
AAGCAATCACTCAAAATCATATGAAAAACAATCATCATCTTCACCTAcaa
cattaaaacaaaaatcaaaacaatcatttAGTAGTATTGAAAGTTTCCTT
GGTATGAGCAGCGATAGTAAAAAAACTGAAGATAATGATAATGAAAGGAT
TAATGACACCACTAAAAAGCGAGAAAGGATCCCATCAAGTGATGTACAAG
ATCGAATTTCAGTCATAAAACCATTACCAATTTCATCACCACAAATTTCA
AACACATCCTCTCCTTTGGATATTGTGAATAATGATCATGACACATTGAA
AAGTCCACAAGCAATTGAAAAGCTGAAATCTcctgaagaaattcaaaaag
taaTAGATCATTCTGAATCTGCACCTGTCACACTCATCCATCCATCTATG
CGCCTCAAAAAGCAAAGAAGTCTATCAAACAGTTCAATGACTGCCACCAG
TCCACAACCCGTTATGGAAaaggaaaaaccaaaaacaagtAATAGACGAC
CGTTACATCCTTCTATGCGATTACAGACcaataaaaataatacaaaagTT
GATAAAGCTGAACCTAAAAAGAGTAAGGTTGAAAATCTTGATAACAGTTT
TGACAGTGGAAAGAATATCTTACACAGTCCAAAAACTGGGCGTTATCAAT
CTGAACTTACAAGTACTTCCACCAAATCTTCAACTAGGAAGTTATCTCCG
TTCACTCCTCCAACTGTTACATCACCTTTAACCTCACCACCACTAGTATC
ACCTGGAATTCGAAGTCCCTTCAATGGAAAACCCCTCACTGGAAAACCAT
TCTCAACTGGTAAGCCTGTTCATGGAGGAAAACCAGCATCTTATTCAGCT
CAAGGTGGTGGTAAACCAATGCATATGGGAGGGAAACCGACTAGTTTCTC
TTCACATATGACTGTCAAAGAGGAAAAGTCACCAGAAAAAGAGCACACTG
GCAAACCTTTATCTTTTTTGAAGTCCATGGTAgaagaatcttccaaaaac
aCAAACACACTTCAAGGGAAAAAGATCACTGGCAAGAAAAGACCCAGAAA
GGAAACTATCGAGAAACCAGCttcaaaagaaactttaaaaaaagatgACA
TATCAAAATCCCCTGACTTGAAAACAAGTCGTATAACAAAAATGATATCA
ACCCCACCAAGCTCACAAAAATTGACAGATAATATCAAGACTAAGAAACC
ACCACAAGAAAAACAGGCACCTGTTAAAAAACTACCTGTCAAAAGGTCTC
CAAAAGTATCACCTCCCAAGAGAGAAGCTGTAAAAGATTCACCACTGAAA
GAAAATCCTTTTAGAAAATCTATCGTCCAAGCAAAGAGTAAACCAGTAct
gacaaaacagaaaaatttgaGTAAAGAGAATATTGAAGAATTGAGCACAA
GTGAGGAAAAAGATTCCCCAAAGAAGacattcaaattcaaagggaTCACA
TTTGATGCCAAGACTGAAGATGATGATAGCAGTGATTCTGATTCAGACAG
CTCATCAAATTCTGATTcagGGTCGTCAAGTGATAGCAGTGACAACAGTG
GAacagaagaagaaattgaagataTTGAAGACGAAGACGATGACGATACT
GCATCTCAAACAAGTTCAGTTACAAGCTCTCCTGCAAAGAAAACACAAAG
AGCTGGTCAAAAACGAAAAGCAGTTCCTGACAATGCAGAGGtGATTGCCA
GTTTGAAGAAACGAAAAGTTGTTGATTTGGATTTGATAAAAGCGCCATTA
AAATTTggATGGAGAAGGCAGACAAGACTCAGACCGAACAATGCTGGTGA
TGGGCTGAGGGGAGATGTTTATTATTATTCACCTTGTGGGAAAAAGCTGA
GGACGTATCCTGAGTTAAACAGTtACATCTTTCGAAATGATGTCGTTGAT
GTAGACTTGAAGAATTTCAGCTTTTCAACCAAACTTCGTGTTGGCGAATT
CATGCAGGCTAAGGATGGTTCAAAGTTTGTGACACTGACTGAAGAAGAGA
TCGATGAAACATTTGTTATGATGGAAGAAAGGAGAAGTGCTTCTGCAAAA
AGAGCTGaagaaaagaagagagaaaaacgTGAAAAGGAGGAGAAGCAACG
TCAGATACTTGAGGAGAGAAAAAAGAAGAGAGAAGAAGCCTTGGAAAGAA
AGAGATCGAAAGAAGAAGAAAGGAGAAAGGTTCAAAAAGACAAAGCATTG
GAAGCAAAGATGAAGAAGGAGAAAGAAAAGGAAGCAGCACAAGAAGCCAA
ACGATTGAAAGAGGAGGCAATAATGTTGAAGAAACTAGAAAGGCAAGCTC
AAATGGAAGCAAGTCGAATTGCCAAGCGTGAGAAAGTTCAAAATATGTTG
GCTGAAAAGCAGAAGATGAAAGAACAAAGAGAACATGAACGAGTCATGAA
GATTGAGAACCAAAAAGTGgagaaagaaatgaaattacAAGCAATCGAAA
ATgaGAAGGAACGTAAAAGGCTGCAACAAGTGAAAAGTAAAGTATCAGAA
AAAGAAAAGCGAAAACGAGAGCTGGTCATGATGAAAGCTTATGAAGCACA
ACGGAGAGCTGAGGAGAGAGAACGCCTCAAAGAACAAAAGAAGCTGGAGA
AAACCTTGATCAGGCAACGAAAATTGGAACAGAAAAGATATGAGCGCATG
ATCtctaaagaattgaaaaaacctATCGATGATATGGCTCTGAATGATTT
GAAGCCGTTGCCAGAGTTACCAAGGGTAACCAACATCAACATTCCTGGCA
AAGCATATGCAGATATCCTGATGGTTCAAGAGTTTGTTCACGCCTTTGGT
CATGTCATTGATATCGATCCAGAGAAGGAGTTTCCAAGCATGGGAGAGTT
GCAATCATCATTGTTGTGTGAATCTGGTAGCGATGAAGCAATCTTCACTG
CATGCCAAGCACTTCTTTTTTACGCCCTCTACGATCCCGGTGTATCTGGG
CCTTATGCCAAAACTTCACTGGGTTCAGACCTTACGAGTATCGAATTGAA
CGAGAACAACATATCAGAAGTATTACGTCTTTTCATCTTATCACGTAATG
AAGGAAAACAACACACACTCAGTGATCAGCTCACCAAATATCCTTTAGAA
GCTCTCTCACCCAGTAGTAAAGCTGCTGTTCTAGCTTTCATTGTCAACGA
ACTGCTTTGTGGAAAATCAGTTAGCAGAGAGATTGACGGTAGCTTggaga
acatttcaaatatgCGAAGGGATAAATGGAACCTGGAAGGAGATATACGG
AAaTTGAAAGCTGATCTATTATCAAAGCAACCCAAGAAAGCAGCCAGTGA
TCAACAACAGAAcctaaaaaacaacaaaggaGAGTCGAAGAAAAGAGACT
CTGACGAGGAGAACAATTCGGACGATGAAGGAACCACTATCACCACTGCT
AAGGAGAGCAATATCGATTTAAACGACACTGCGGAAGACACAGAAGCTGA
AAACCAGCCAGAGATGGTGAATCCTACTACACTCGACCAAATGGAGAAGA
AACTACGTTTGATGGAAAAGAAACACGCTCGCTACCGTAAAAAGTTGTTC
GATTCTTCACACACGATACGTGGTATAAATTTGGGTCAAGATCGATACCG
GCGCCGTTATTTCGTGCTTCCGAACGCCGGAGGGATTTACGTCGAAGGGC
TGGAAAGTGGATTTTTTGACGAAGAAACGAACGTGAAAACAAAGGAAGAA
AAGGAAGAATGCAAAGAACATTTAGATAGTTTACTGACCACCTTGAAATC
TCCAACTGTGTTGAAATCCCCTGTGACTGGCCCCAAAACACCGGCCACAA
ATACACCGTCTGTATCAGCATTATCCTCAAATTCAAACGAACTTTTAAAA
CCGAAACAAGAGAGTCCTATAcaaacacaacaacaacaaaaacagataaa
agtTGAGAATCCTTGTTCAAGTGATAGTAGTTATGTCAAATCTTGGTTTT
CCTTACGGACTAAAAAACGTTGCGAGTCTTACAAAACTTCAGCTATACGT
GAAACGCCTAAAGAGCGCAAACATTCGCTCATCGTTGCACCGAGGATAGA
ACGACTTGCCGACGACCACCAATTCTTAGAATCTATATACTCTTGTTATT
CCACTACTTCTCCTGGTGGGAAAAACACTTTATTACCTGTCAGCAGATTT
CCCTTATCCAAGGAAAGTATGCATCGGAACTCGTTACTAGGCTTACCGGC
TGAATTGGATATGAATTTACTTATACAACAAGACCCACAAAAAGCAGCGG
AAATTCTTGAAATACAGACTGCCAAGCCTCAAGAAATTCCGCCTGAAATG
CAGGCGGGTTGGTGGCGGATCACCGATCCAGAACAAATGCAGCGCCTGAA
CAAGTGCGCCCACGCCAGGGGTATGAGAGAACGGAACCTTCAAAAGACGG
TGGTGCGATTCCAAGACTACACCAACTCATCGTGTAAAGTTGACCATCTT
GCATtttctcTACTTCTCCCCGACGAAGAAAGTGAAAGCAAAGACAAAGT
AACAGAAGACGACAGCAGCGTTGCCACATCAACGGATACAAACAAATCGA
TACAAGATAAATGGTATCCACAGCTGGCGTATGCAAGTGACAAAGCCATT
TTGATTGAAGTCGAAGAATTAGAGGAAAAGGTCTTCTCGGCTAGTTTGCA
AGTCAAGGGCTGGCGTTTGTCTCAAAAGATCTCTCCAGCACTTCTGCTGA
GCACGAGTAACGATCAAGCTGAGTATGATCCACCCGAAGATAAATATCCC
ATCAGGATAGCGGCTTCCCGTCTCCTAGCTCTTGAGCTCGGTATCGAACG
ACGTTACATGAAGCCTCCATTCCGTACACCAGACAGCCTTCCTAAACCGG
ACGCCCCAGAGGCTAAAGAAGAACCAGTCAAGAATCCAAAAGCAACAGCC
CAACTGGAGAAATGGCGTGAAGCAGTAAGCGAAGCAAAATCGTCAGCTCA
GCTATCGATGTGTATCACAGCACTCTTCGAATGTGTCGCTTGGGAGAAGT
CCATCATGAAAGTGTTCTGCATACTATGTCGTAAAAGTGACAACGAAGAA
AGATTGTTGCTATGCGACGCATGTGATCGAGGCTGTCATACGTATTGTTG
TAAGCCGAAATTCGATAAGATTCCCGATGGTGACTGGTTTTGTCAAGATT
GTGTGTTGATGGCGTCTGGTAGTGATCAGTGCTACAAATGTAAATCGAAG
ACCGGACGACGTCTGAAATGTGCATTCTGTCCACGTCATTATCACATGGA
CTGCCTTGAACCACCATTACACAAaACACCTCGTTCGCCTTGGAGTTGTC
CCGTCTGCAAGAAAACACGCTCCAAGAGTAAACCTCCTCAACGTAAAAAA
CCACGCGCCGAAGAACTTCTCAAGAAAGAGGAACAGAGCAAACAAAAATC
CATGTCCAACAGCCGTGTGCAGACGTCCAAAGACATGGAACCGTGTCGTT
TCATATTGAACGAAATGGAAAATCACGAATCGTCATGGCCCTTTCTCGTC
CCTGTCAATATGAAGCAGTTTCCAGAGTATTATAAAGTGATCAAGCATCC
GATGGATTTCCATACCATGAAAACGAAGCTGCGTGATTACCAATACAAGT
CAAAAGAAGAGTTCGCACGTGACGCGCGGTTGGTGTTTTTCAATTGTAAA
ACGTACAACGAAGACGAATCGGAGGTTGGATGTGCAGGTGAAGCGATGCG
AagtttcttcgagaaacgttgGACCGCCCTCAAAAAGGGTGTCTCTTCCA
CAAACAGTGATAACAAATTCCACACCAACAAGAAGGGGGAGGGTGTGGAA
TCATCAGGCGATGAAGGAGAAGACGCTCAGGAGGAGGGTGAAGGCGATGA
AGAAGTATCCAGTTCGAGTTCTGAAGAAATCTCATCCGAAAGTGAGAGCA
GCGAAGTGGAGGAGGACAGTGAAAACGAGACCGACTCAAAAACATGAATG
GACAATCGTTCCGGTGGTCAAGGCAACCCATATGATCGACCTTACTATGG
GGACCCAAATGTCTTGAGACAACAAATTCCTGGGTATGCTAACTCTCCTG
GAATTTATCCATATTCCCAGCAGCAGCAACAAGATGGTTTTTCAGGGCGA
CGACCAGGGCAAGACCAGCTTGGTCTCAATAATCATGCTACCGCCAGAAC
CAACAGCTTGACTTCACCTCCACAATCAACCAATCCTTGGATGCACTCTT
ACCACAATCAAACACAACCAAATTCTATGAGCCCTAATTTCAATATGAAC
ATACCGAATATGTTTCATACAAGGTGGGAACAAGACCAAGCCTCACTTCT
ACAACAAAGAGAAATGATGCAAAGAGAAGAACATGCAAGGATGATGTATC
GAGAGCGCTTGCAAATGCAAGAGAGAGAAAATCAGTTGAAAATCCAGATG
CAGAAGGAGCAAGAGCGAGAGTTGCAACTTCAGCGTGAAAAAGAAGCACA
ACTTCAGCGTGAAAGGGAAGCAAAGGTTCAAAGAGAACGTGAAGCCCAAT
TAGAAAGAGAGCGACAAGCTCAACTTCAAAGAGAACGACAAGCTGCTCTG
GAGAAAGAAAGACAGCTACAGTTGCAGAGGGAAAGAGAAGCTCAATTACA
AAGAGAAGCTCAATTACAATATCAGATGCAAAGAGAAATGCAACTTGAAA
GAGAAAGAGAAGCAATGGCAATAAGAGAAAGAGATGCAATCCTTGAACGA
GATAGAAAAGCAATGCTCTACAGAGATGCTTATTTTGCACAACAACATCA
ACCACAGCAATttccaaaccattttggttccaTGCAAAATACATTGCCTA
ATTTGAATTTCACACAATCCAATGAGTCAATGTCTAATCAATTTAACTTC
TATAACCAGCCCAGTATGCATTCAAATGGTAATCTTCCTAGCAGTACATC
GTCTTCTATACTAAACTTCTCAATGGATCAAATTTTCAACCCTAATAAGA
TATCTGAGTCACCTGTCTCCAAAGCAGCAAGTACCAGTTCTTCCTTTCAC
TTTCCAATCTCATCACCTTCCACCGTCAGCTCAACAACAACTTCATCAAC
AACGACAACCACAACTGCTTTACGTAAAAGCTCATCTAACTCATTTGACA
ATGGAATTATAAATAGTATTGTTTCTGATAAGGGATTTTTAACCTCACCC
TTGGACAGTAATAGTCAATTCATGAAAACATGGCAAGAACTACAGGATAT
GGATTTGagtgaaattgagaaaaatgtcCTTGGACCTAAAGATCAAGATT
CCCGAAACACTCCATTAGCAGATACTCCATTTTCAAACCCTACTACACCA
ACAGAAATGAATGGGCTGCCACCAAAACCAATTGATTCTAACTTGAATAA
CATTGTTAATTCTCTACCTGAAAACTCTCTGGATTTAAATAAGCATTcca
ttgaaacaaaagaatctttACAAATAACAAACACTGAAGATACACCACCA
CAACAGAATCTATTGAATCATCCAAGAAATTTATTATCAGTATCTCAAAC
AGCTCAAGCTAGCTCCAATTATACAAACACCAGTGTAACGCAATCAGACA
TAAACTTGACACATGTATCAGAAAATTTACTTACCCATAATAGGTCTTGC
GTTTCTTCATTTGTTTCGCCTACGTCATCAGATTTGTATTGCAATCAAGA
TTTTGATAAGCAATCAAAACGAGGAGATGATATCAAGCATGAAGAATATT
CTAATGAACTTCAAAGCAATCACTCAAAATCATATGAAAAACAATCATCA
TCTTCACCTAcaacattaaaacaaaaatcaaaacaatcatttAGTAGTAT
TGAAAGTTTCCTTGGTATGAGCAGCGATAGTAAAAAAACTGAAGATAATG
ATAATGAAAGGATTAATGACACCACTAAAAAGCGAGAAAGGATCCCATCA
AGTGATGTACAAGATCGAATTTCAGTCATAAAACCATTACCAATTTCATC
ACCACAAATTTCAAACACATCCTCTCCTTTGGATATTGTGAATAATGATC
ATGACACATTGAAAAGTCCACAAGCAATTGAAAAGCTGAAATCTcctgaa
gaaattcaaaaagtaaTAGATCATTCTGAATCTGCACCTGTCACACTCAT
CCATCCATCTATGCGCCTCAAAAAGCAAAGAAGTCTATCAAACAGTTCAA
TGACTGCCACCAGTCCACAACCCGTTATGGAAaaggaaaaaccaaaaaca
agtAATAGACGACCGTTACATCCTTCTATGCGATTACAGACcaataaaaa
taatacaaaagTTGATAAAGCTGAACCTAAAAAGAGTAAGGTTGAAAATC
TTGATAACAGTTTTGACAGTGGAAAGAATATCTTACACAGTCCAAAAACT
GGGCGTTATCAATCTGAACTTACAAGTACTTCCACCAAATCTTCAACTAG
GAAGTTATCTCCGTTCACTCCTCCAACTGTTACATCACCTTTAACCTCAC
CACCACTAGTATCACCTGGAATTCGAAGTCCCTTCAATGGAAAACCCCTC
ACTGGAAAACCATTCTCAACTGGTAAGCCTGTTCATGGAGGAAAACCAGC
ATCTTATTCAGCTCAAGGTGGTGGTAAACCAATGCATATGGGAGGGAAAC
CGACTAGTTTCTCTTCACATATGACTGTCAAAGAGGAAAAGTCACCAGAA
AAAGAGCACACTGGCAAACCTTTATCTTTTTTGAAGTCCATGGTAgaaga
atcttccaaaaacaCAAACACACTTCAAGGGAAAAAGATCACTGGCAAGA
AAAGACCCAGAAAGGAAACTATCGAGAAACCAGCttcaaaagaaacttta
aaaaaagatgACATATCAAAATCCCCTGACTTGAAAACAAGTCGTATAAC
AAAAATGATATCAACCCCACCAAGCTCACAAAAATTGACAGATAATATCA
AGACTAAGAAACCACCACAAGAAAAACAGGCACCTGTTAAAAAACTACCT
GTCAAAAGGTCTCCAAAAGTATCACCTCCCAAGAGAGAAGCTGTAAAAGA
TTCACCACTGAAAGAAAATCCTTTTAGAAAATCTATCGTCCAAGCAAAGA
GTAAACCAGTActgacaaaacagaaaaatttgaGTAAAGAGAATATTGAA
GAATTGAGCACAAGTGAGGAAAAAGATTCCCCAAAGAAGacattcaaatt
caaagggaTCACATTTGATGCCAAGACTGAAGATGATGATAGCAGTGATT
CTGATTCAGACAGCTCATCAAATTCTGATTcagGGTCGTCAAGTGATAGC
AGTGACAACAGTGGAacagaagaagaaattgaagataTTGAAGACGAAGA
CGATGACGATACTGCATCTCAAACAAGTTCAGTTACAAGCTCTCCTGCAA
AGAAAACACAAAGAGCTGGTCAAAAACGAAAAGCAGTTCCTGACAATGCA
GAGGtGATTGCCAGTTTGAAGAAACGAAAAGTTGTTGATTTGGATTTGAT
AAAAGCGCCATTAAAATTTggATGGAGAAGGCAGACAAGACTCAGACCGA
ACAATGCTGGTGATGGGCTGAGGGGAGATGTTTATTATTATTCACCTTGT
GGGAAAAAGCTGAGGACGTATCCTGAGTTAAACAGTtACATCTTTCGAAA
TGATGTCGTTGATGTAGACTTGAAGAATTTCAGCTTTTCAACCAAACTTC
GTGTTGGCGAATTCATGCAGGCTAAGGATGGTTCAAAGTTTGTGACACTG
ACTGAAGAAGAGATCGATGAAACATTTGTTATGATGGAAGAAAGGAGAAG
TGCTTCTGCAAAAAGAGCTGaagaaaagaagagagaaaaacgTGAAAAGG
AGGAGAAGCAACGTCAGATACTTGAGGAGAGAAAAAAGAAGAGAGAAGAA
GCCTTGGAAAGAAAGAGATCGAAAGAAGAAGAAAGGAGAAAGGTTCAAAA
AGACAAAGCATTGGAAGCAAAGATGAAGAAGGAGAAAGAAAAGGAAGCAG
CACAAGAAGCCAAACGATTGAAAGAGGAGGCAATAATGTTGAAGAAACTA
GAAAGGCAAGCTCAAATGGAAGCAAGTCGAATTGCCAAGCGTGAGAAAGT
TCAAAATATGTTGGCTGAAAAGCAGAAGATGAAAGAACAAAGAGAACATG
AACGAGTCATGAAGATTGAGAACCAAAAAGTGgagaaagaaatgaaatta
cAAGCAATCGAAAATgaGAAGGAACGTAAAAGGCTGCAACAAGTGAAAAG
TAAAGTATCAGAAAAAGAAAAGCGAAAACGAGAGCTGGTCATGATGAAAG
CTTATGAAGCACAACGGAGAGCTGAGGAGAGAGAACGCCTCAAAGAACAA
AAGAAGCTGGAGAAAACCTTGATCAGGCAACGAAAATTGGAACAGAAAAG
ATATGAGCGCATGATCtctaaagaattgaaaaaacctATCGATGATATGG
CTCTGAATGATTTGAAGCCGTTGCCAGAGTTACCAAGGGTAACCAACATC
AACATTCCTGGCAAAGCATATGCAGATATCCTGATGGTTCAAGAGTTTGT
TCACGCCTTTGGTCATGTCATTGATATCGATCCAGAGAAGGAGTTTCCAA
GCATGGGAGAGTTGCAATCATCATTGTTGTGTGAATCTGGTAGCGATGAA
GCAATCTTCACTGCATGCCAAGCACTTCTTTTTTACGCCCTCTACGATCC
CGGTGTATCTGGGCCTTATGCCAAAACTTCACTGGGTTCAGACCTTACGA
GTATCGAATTGAACGAGAACAACATATCAGAAGTATTACGTCTTTTCATC
TTATCACGTAATGAAGGAAAACAACACACACTCAGTGATCAGCTCACCAA
ATATCCTTTAGAAGCTCTCTCACCCAGTAGTAAAGCTGCTGTTCTAGCTT
TCATTGTCAACGAACTGCTTTGTGGAAAATCAGTTAGCAGAGAGATTGAC
GGTAGCTTggagaacatttcaaatatgCGAAGGGATAAATGGAACCTGGA
AGGAGATATACGGAAaTTGAAAGCTGATCTATTATCAAAGCAACCCAAGA
AAGCAGCCAGTGATCAACAACAGAAcctaaaaaacaacaaaggaGAGTCG
AAGAAAAGAGACTCTGACGAGGAGAACAATTCGGACGATGAAGGAACCAC
TATCACCACTGCTAAGGAGAGCAATATCGATTTAAACGACACTGCGGAAG
ACACAGAAGCTGAAAACCAGCCAGAGATGGTGAATCCTACTACACTCGAC
CAAATGGAGAAGAAACTACGTTTGATGGAAAAGAAACACGCTCGCTACCG
TAAAAAGTTGTTCGATTCTTCACACACGATACGTGGTATAAATTTGGGTC
AAGATCGATACCGGCGCCGTTATTTCGTGCTTCCGAACGCCGGAGGGATT
TACGTCGAAGGGCTGGAAAGTGGATTTTTTGACGAAGAAACGAACGTGAA
AACAAAGGAAGAAAAGGAAGAATGCAAAGAACATTTAGATAGTTTACTGA
CCACCTTGAAATCTCCAACTGTGTTGAAATCCCCTGTGACTGGCCCCAAA
ACACCGGCCACAAATACACCGTCTGTATCAGCATTATCCTCAAATTCAAA
CGAACTTTTAAAACCGAAACAAGAGAGTCCTATAcaaacacaacaacaac
aaaaacagataaaagtTGAGAATCCTTGTTCAAGTGATAGTAGTTATGTC
AAATCTTGGTTTTCCTTACGGACTAAAAAACGTTGCGAGTCTTACAAAAC
TTCAGCTATACGTGAAACGCCTAAAGAGCGCAAACATTCGCTCATCGTTG
CACCGAGGATAGAACGACTTGCCGACGACCACCAATTCTTAGAATCTATA
TACTCTTGTTATTCCACTACTTCTCCTGGTGGGAAAAACACTTTATTACC
TGTCAGCAGATTTCCCTTATCCAAGGAAAGTATGCATCGGAACTCGTTAC
TAGGCTTACCGGCTGAATTGGATATGAATTTACTTATACAACAAGACCCA
CAAAAAGCAGCGGAAATTCTTGAAATACAGACTGCCAAGCCTCAAGAAAT
TCCGCCTGAAATGCAGGCGGGTTGGTGGCGGATCACCGATCCAGAACAAA
TGCAGCGCCTGAACAAGTGCGCCCACGCCAGGGGTATGAGAGAACGGAAC
CTTCAAAAGACGGTGGTGCGATTCCAAGACTACACCAACTCATCGTGTAA
AGTTGACCATCTTGCATtttctcTACTTCTCCCCGACGAAGAAAGTGAAA
GCAAAGACAAAGTAACAGAAGACGACAGCAGCGTTGCCACATCAACGGAT
ACAAACAAATCGATACAAGATAAATGGTATCCACAGCTGGCGTATGCAAG
TGACAAAGCCATTTTGATTGAAGTCGAAGAATTAGAGGAAAAGGTCTTCT
CGGCTAGTTTGCAAGTCAAGGGCTGGCGTTTGTCTCAAAAGATCTCTCCA
GCACTTCTGCTGAGCACGAGTAACGATCAAGCTGAGTATGATCCACCCGA
AGATAAATATCCCATCAGGATAGCGGCTTCCCGTCTCCTAGCTCTTGAGC
TCGGTATCGAACGACGTTACATGAAGCCTCCATTCCGTACACCAGACAGC
CTTCCTAAACCGGACGCCCCAGAGGCTAAAGAAGAACCAGTCAAGAATCC
AAAAGCAACAGCCCAACTGGAGAAATGGCGTGAAGCAGTAAGCGAAGCAA
AATCGTCAGCTCAGCTATCGATGTGTATCACAGCACTCTTCGAATGTGTC
GCTTGGGAGAAGTCCATCATGAAAGTGTTCTGCATACTATGTCGTAAAAG
TGACAACGAAGAAAGATTGTTGCTATGCGACGCATGTGATCGAGGCTGTC
ATACGTATTGTTGTAAGCCGAAATTCGATAAGATTCCCGATGGTGACTGG
TTTTGTCAAGATTGTGTGTTGATGGCGTCTGGTAGTGATCAGTGCTACAA
ATGTAAATCGAAGACCGGACGACGTCTGAAATGTGCATTCTGTCCACGTC
ATTATCACATGGACTGCCTTGAACCACCATTACACAAaACACCTCGTTCG
CCTTGGAGTTGTCCCGTCTGCAAGAAAACACGCTCCAAGAGTAAACCTCC
TCAACGTAAAAAACCACGCGCCGAAGAACTTCTCAAGAAAGAGGAACAGA
GCAAACAAAAATCCATGTCCAACAGCCGTGTGCAGACGTCCAAAGACATG
GAACCGTGTCGTTTCATATTGAACGAAATGGAAAATCACGAATCGTCATG
GCCCTTTCTCGTCCCTGTCAATATGAAGCAGTTTCCAGAGTATTATAAAG
TGATCAAGCATCCGATGGATTTCCATACCATGAAAACGAAGCTGCGTGAT
TACCAATACAAGTCAAAAGAAGAGTTCGCACGTGACGCGCGGTTGGTGTT
TTTCAATTGTAAAACGTACAACGAAGACGAATCGGAGGTTGGATGTGCAG
GTGAAGCGATGCGAagtttcttcgagaaacgttgGACCGCCCTCAAAAAG
GGTGTCTCTTCCACAAACAGTGATAACAAATTCCACACCAACAAGAAGGG
GGAGGGTGTGGAATCATCAGGCGATGAAGGAGAAGACGCTCAGGAGGAGG
GTGAAGGCGATGAAGAAGTATCCAGTTCGAGTTCTGAAGAAATCTCATCC
GAAAGTGAGAGCAGCGAAGTGGAGGAGGACAGTGAAAACGAGACCGACTC
AAAAACATGAATGGACAATCGTTCCGGTGGTCAAGGCAACCCATATGATC
GACCTTACTATGGGGACCCAAATGTCTTGAGACAACAAATTCCTGGGTAT
GCTAACTCTCCTGGAATTTATCCATATTCCCAGCAGCAGCAACAAGATGG
TTTTTCAGGGCGACGACCAGGGCAAGACCAGCTTGGTCTCAATAATCATG
CTACCGCCAGAACCAACAGCTTGACTTCACCTCCACAATCAACCAATCCT
TGGATGCACTCTTACCACAATCAAACACAACCAAATTCTATGAGCCCTAA
TTTCAATATGAACATACCGAATATGTTTCATACAAGGTGGGAACAAGACC
AAGCCTCACTTCTACAACAAAGAGAAATGATGCAAAGAGAAGAACATGCA
AGGATGATGTATCGAGAGCGCTTGCAAATGCAAGAGAGAGAAAATCAGTT
GAAAATCCAGATGCAGAAGGAGCAAGAGCGAGAGTTGCAACTTCAGCGTG
AAAAAGAAGCACAACTTCAGCGTGAAAGGGAAGCAAAGGTTCAAAGAGAA
CGTGAAGCCCAATTAGAAAGAGAGCGACAAGCTCAACTTCAAAGAGAACG
ACAAGCTGCTCTGGAGAAAGAAAGACAGCTACAGTTGCAGAGGGAAAGAG
AAGCTCAATTACAAAGAGAAGCTCAATTACAATATCAGATGCAAAGAGAA
ATGCAACTTGAAAGAGAAAGAGAAGCAATGGCAATAAGAGAAAGAGATGC
AATCCTTGAACGAGATAGAAAAGCAATGCTCTACAGAGATGCTTATTTTG
CACAACAACATCAACCACAGCAATttccaaaccattttggttccaTGCAA
AATACATTGCCTAATTTGAATTTCACACAATCCAATGAGTCAATGTCTAA
TCAATTTAACTTCTATAACCAGCCCAGTATGCATTCAAATGGTAATCTTC
CTAGCAGTACATCGTCTTCTATACTAAACTTCTCAATGGATCAAATTTTC
AACCCTAATAAGATATCTGAGTCACCTGTCTCCAAAGCAGCAAGTACCAG
TTCTTCCTTTCACTTTCCAATCTCATCACCTTCCACCGTCAGCTCAACAA
CAACTTCATCAACAACGACAACCACAACTGCTTTACGTAAAAGCTCATCT
AACTCATTTGACAATGGAATTATAAATAGTATTGTTTCTGATAAGGGATT
TTTAACCTCACCCTTGGACAGTAATAGTCAATTCATGAAAACATGGCAAG
AACTACAGGATATGGATTTGagtgaaattgagaaaaatgtcCTTGGACCT
AAAGATCAAGATTCCCGAAACACTCCATTAGCAGATACTCCATTTTCAAA
CCCTACTACACCAACAGAAATGAATGGGCTGCCACCAAAACCAATTGATT
CTAACTTGAATAACATTGTTAATTCTCTACCTGAAAACTCTCTGGATTTA
AATAAGCATTccattgaaacaaaagaatctttACAAATAACAAACACTGA
AGATACACCACCACAACAGAATCTATTGAATCATCCAAGAAATTTATTAT
CAGTATCTCAAACAGCTCAAGCTAGCTCCAATTATACAAACACCAGTGTA
ACGCAATCAGACATAAACTTGACACATGTATCAGAAAATTTACTTACCCA
TAATAGGTCTTGCGTTTCTTCATTTGTTTCGCCTACGTCATCAGATTTGT
ATTGCAATCAAGATTTTGATAAGCAATCAAAACGAGGAGATGATATCAAG
CATGAAGAATATTCTAATGAACTTCAAAGCAATCACTCAAAATCATATGA
AAAACAATCATCATCTTCACCTAcaacattaaaacaaaaatcaaaacaat
catttAGTAGTATTGAAAGTTTCCTTGGTATGAGCAGCGATAGTAAAAAA
ACTGAAGATAATGATAATGAAAGGATTAATGACACCACTAAAAAGCGAGA
AAGGATCCCATCAAGTGATGTACAAGATCGAATTTCAGTCATAAAACCAT
TACCAATTTCATCACCACAAATTTCAAACACATCCTCTCCTTTGGATATT
GTGAATAATGATCATGACACATTGAAAAGTCCACAAGCAATTGAAAAGCT
GAAATCTcctgaagaaattcaaaaagtaaTAGATCATTCTGAATCTGCAC
CTGTCACACTCATCCATCCATCTATGCGCCTCAAAAAGCAAAGAAGTCTA
TCAAACAGTTCAATGACTGCCACCAGTCCACAACCCGTTATGGAAaagga
aaaaccaaaaacaagtAATAGACGACCGTTACATCCTTCTATGCGATTAC
AGACcaataaaaataatacaaaagTTGATAAAGCTGAACCTAAAAAGAGT
AAGGTTGAAAATCTTGATAACAGTTTTGACAGTGGAAAGAATATCTTACA
CAGTCCAAAAACTGGGCGTTATCAATCTGAACTTACAAGTACTTCCACCA
AATCTTCAACTAGGAAGTTATCTCCGTTCACTCCTCCAACTGTTACATCA
CCTTTAACCTCACCACCACTAGTATCACCTGGAATTCGAAGTCCCTTCAA
TGGAAAACCCCTCACTGGAAAACCATTCTCAACTGGTAAGCCTGTTCATG
GAGGAAAACCAGCATCTTATTCAGCTCAAGGTGGTGGTAAACCAATGCAT
ATGGGAGGGAAACCGACTAGTTTCTCTTCACATATGACTGTCAAAGAGGA
AAAGTCACCAGAAAAAGAGCACACTGGCAAACCTTTATCTTTTTTGAAGT
CCATGGTAgaagaatcttccaaaaacaCAAACACACTTCAAGGGAAAAAG
ATCACTGGCAAGAAAAGACCCAGAAAGGAAACTATCGAGAAACCAGCttc
aaaagaaactttaaaaaaagatgACATATCAAAATCCCCTGACTTGAAAA
CAAGTCGTATAACAAAAATGATATCAACCCCACCAAGCTCACAAAAATTG
ACAGATAATATCAAGACTAAGAAACCACCACAAGAAAAACAGGCACCTGT
TAAAAAACTACCTGTCAAAAGGTCTCCAAAAGTATCACCTCCCAAGAGAG
AAGCTGTAAAAGATTCACCACTGAAAGAAAATCCTTTTAGAAAATCTATC
GTCCAAGCAAAGAGTAAACCAGTActgacaaaacagaaaaatttgaGTAA
AGAGAATATTGAAGAATTGAGCACAAGTGAGGAAAAAGATTCCCCAAAGA
AGacattcaaattcaaagggaTCACATTTGATGCCAAGACTGAAGATGAT
GATAGCAGTGATTCTGATTCAGACAGCTCATCAAATTCTGATTcagGGTC
GTCAAGTGATAGCAGTGACAACAGTGGAacagaagaagaaattgaagata
TTGAAGACGAAGACGATGACGATACTGCATCTCAAACAAGTTCAGTTACA
AGCTCTCCTGCAAAGAAAACACAAAGAGCTGGTCAAAAACGAAAAGCAGT
TCCTGACAATGCAGAGGtGATTGCCAGTTTGAAGAAACGAAAAGTTGTTG
ATTTGGATTTGATAAAAGCGCCATTAAAATTTggATGGAGAAGGCAGACA
AGACTCAGACCGAACAATGCTGGTGATGGGCTGAGGGGAGATGTTTATTA
TTATTCACCTTGTGGGAAAAAGCTGAGGACGTATCCTGAGTTAAACAGTt
ACATCTTTCGAAATGATGTCGTTGATGTAGACTTGAAGAATTTCAGCTTT
TCAACCAAACTTCGTGTTGGCGAATTCATGCAGGCTAAGGATGGTTCAAA
GTTTGTGACACTGACTGAAGAAGAGATCGATGAAACATTTGTTATGATGG
AAGAAAGGAGAAGTGCTTCTGCAAAAAGAGCTGaagaaaagaagagagaa
aaacgTGAAAAGGAGGAGAAGCAACGTCAGATACTTGAGGAGAGAAAAAA
GAAGAGAGAAGAAGCCTTGGAAAGAAAGAGATCGAAAGAAGAAGAAAGGA
GAAAGGTTCAAAAAGACAAAGCATTGGAAGCAAAGATGAAGAAGGAGAAA
GAAAAGGAAGCAGCACAAGAAGCCAAACGATTGAAAGAGGAGGCAATAAT
GTTGAAGAAACTAGAAAGGCAAGCTCAAATGGAAGCAAGTCGAATTGCCA
AGCGTGAGAAAGTTCAAAATATGTTGGCTGAAAAGCAGAAGATGAAAGAA
CAAAGAGAACATGAACGAGTCATGAAGATTGAGAACCAAAAAGTGgagaa
agaaatgaaattacAAGCAATCGAAAATgaGAAGGAACGTAAAAGGCTGC
AACAAGTGAAAAGTAAAGTATCAGAAAAAGAAAAGCGAAAACGAGAGCTG
GTCATGATGAAAGCTTATGAAGCACAACGGAGAGCTGAGGAGAGAGAACG
CCTCAAAGAACAAAAGAAGCTGGAGAAAACCTTGATCAGGCAACGAAAAT
TGGAACAGAAAAGATATGAGCGCATGATCtctaaagaattgaaaaaacct
ATCGATGATATGGCTCTGAATGATTTGAAGCCGTTGCCAGAGTTACCAAG
GGTAACCAACATCAACATTCCTGGCAAAGCATATGCAGATATCCTGATGG
TTCAAGAGTTTGTTCACGCCTTTGGTCATGTCATTGATATCGATCCAGAG
AAGGAGTTTCCAAGCATGGGAGAGTTGCAATCATCATTGTTGTGTGAATC
TGGTAGCGATGAAGCAATCTTCACTGCATGCCAAGCACTTCTTTTTTACG
CCCTCTACGATCCCGGTGTATCTGGGCCTTATGCCAAAACTTCACTGGGT
TCAGACCTTACGAGTATCGAATTGAACGAGAACAACATATCAGAAGTATT
ACGTCTTTTCATCTTATCACGTAATGAAGGAAAACAACACACACTCAGTG
ATCAGCTCACCAAATATCCTTTAGAAGCTCTCTCACCCAGTAGTAAAGCT
GCTGTTCTAGCTTTCATTGTCAACGAACTGCTTTGTGGAAAATCAGTTAG
CAGAGAGATTGACGGTAGCTTggagaacatttcaaatatgCGAAGGGATA
AATGGAACCTGGAAGGAGATATACGGAAaTTGAAAGCTGATCTATTATCA
AAGCAACCCAAGAAAGCAGCCAGTGATCAACAACAGAAcctaaaaaacaa
caaaggaGAGTCGAAGAAAAGAGACTCTGACGAGGAGAACAATTCGGACG
ATGAAGGAACCACTATCACCACTGCTAAGGAGAGCAATATCGATTTAAAC
GACACTGCGGAAGACACAGAAGCTGAAAACCAGCCAGAGATGGTGAATCC
TACTACACTCGACCAAATGGAGAAGAAACTACGTTTGATGGAAAAGAAAC
ACGCTCGCTACCGTAAAAAGTTGTTCGATTCTTCACACACGATACGTGGT
ATAAATTTGGGTCAAGATCGATACCGGCGCCGTTATTTCGTGCTTCCGAA
CGCCGGAGGGATTTACGTCGAAGGGCTGGAAAGTGGATTTTTTGACGAAG
AAACGAACGTGAAAACAAAGGAAGAAAAGGAAGAATGCAAAGAACATTTA
GATAGTTTACTGACCACCTTGAAATCTCCAACTGTGTTGAAATCCCCTGT
GACTGGCCCCAAAACACCGGCCACAAATACACCGTCTGTATCAGCATTAT
CCTCAAATTCAAACGAACTTTTAAAACCGAAACAAGAGAGTCCTATAcaa
acacaacaacaacaaaaacagataaaagtTGAGAATCCTTGTTCAAGTGA
TAGTAGTTATGTCAAATCTTGGTTTTCCTTACGGACTAAAAAACGTTGCG
AGTCTTACAAAACTTCAGCTATACGTGAAACGCCTAAAGAGCGCAAACAT
TCGCTCATCGTTGCACCGAGGATAGAACGACTTGCCGACGACCACCAATT
CTTAGAATCTATATACTCTTGTTATTCCACTACTTCTCCTGGTGGGAAAA
ACACTTTATTACCTGTCAGCAGATTTCCCTTATCCAAGGAAAGTATGCAT
CGGAACTCGTTACTAGGCTTACCGGCTGAATTGGATATGAATTTACTTAT
ACAACAAGACCCACAAAAAGCAGCGGAAATTCTTGAAATACAGACTGCCA
AGCCTCAAGAAATTCCGCCTGAAATGCAGGCGGGTTGGTGGCGGATCACC
GATCCAGAACAAATGCAGCGCCTGAACAAGTGCGCCCACGCCAGGGGTAT
GAGAGAACGGAACCTTCAAAAGACGGTGGTGCGATTCCAAGACTACACCA
ACTCATCGTGTAAAGTTGACCATCTTGCATtttctcTACTTCTCCCCGAC
GAAGAAAGTGAAAGCAAAGACAAAGTAACAGAAGACGACAGCAGCGTTGC
CACATCAACGGATACAAACAAATCGATACAAGATAAATGGTATCCACAGC
TGGCGTATGCAAGTGACAAAGCCATTTTGATTGAAGTCGAAGAATTAGAG
GAAAAGGTCTTCTCGGCTAGTTTGCAAGTCAAGGGCTGGCGTTTGTCTCA
AAAGATCTCTCCAGCACTTCTGCTGAGCACGAGTAACGATCAAGCTGAGT
ATGATCCACCCGAAGATAAATATCCCATCAGGATAGCGGCTTCCCGTCTC
CTAGCTCTTGAGCTCGGTATCGAACGACGTTACATGAAGCCTCCATTCCG
TACACCAGACAGCCTTCCTAAACCGGACGCCCCAGAGGCTAAAGAAGAAC
CAGTCAAGAATCCAAAAGCAACAGCCCAACTGGAGAAATGGCGTGAAGCA
GTAAGCGAAGCAAAATCGTCAGCTCAGCTATCGATGTGTATCACAGCACT
CTTCGAATGTGTCGCTTGGGAGAAGTCCATCATGAAAGTGTTCTGCATAC
TATGTCGTAAAAGTGACAACGAAGAAAGATTGTTGCTATGCGACGCATGT
GATCGAGGCTGTCATACGTATTGTTGTAAGCCGAAATTCGATAAGATTCC
CGATGGTGACTGGTTTTGTCAAGATTGTGTGTTGATGGCGTCTGGTAGTG
ATCAGTGCTACAAATGTAAATCGAAGACCGGACGACGTCTGAAATGTGCA
TTCTGTCCACGTCATTATCACATGGACTGCCTTGAACCACCATTACACAA
aACACCTCGTTCGCCTTGGAGTTGTCCCGTCTGCAAGAAAACACGCTCCA
AGAGTAAACCTCCTCAACGTAAAAAACCACGCGCCGAAGAACTTCTCAAG
AAAGAGGAACAGAGCAAACAAAAATCCATGTCCAACAGCCGTGTGCAGAC
GTCCAAAGACATGGAACCGTGTCGTTTCATATTGAACGAAATGGAAAATC
ACGAATCGTCATGGCCCTTTCTCGTCCCTGTCAATATGAAGCAGTTTCCA
GAGTATTATAAAGTGATCAAGCATCCGATGGATTTCCATACCATGAAAAC
GAAGCTGCGTGATTACCAATACAAGTCAAAAGAAGAGTTCGCACGTGACG
CGCGGTTGGTGTTTTTCAATTGTAAAACGTACAACGAAGACGAATCGGAG
GTTGGATGTGCAGGTGAAGCGATGCGAagtttcttcgagaaacgttgGAC
CGCCCTCAAAAAGGGTGTCTCTTCCACAAACAGTGATAACAAATTCCACA
CCAACAAGAAGGGGGAGGGTGTGGAATCATCAGGCGATGAAGGAGAAGAC
GCTCAGGAGGAGGGTGAAGGCGATGAAGAAGTATCCAGTTCGAGTTCTGA
AGAAATCTCATCCGAAAGTGAGAGCAGCGAAGTGGAGGAGGACAGTGAAA
ACGAGACCGACTCAAAAACATGAATGGACAATCGTTCCGGTGGTCAAGGC
AACCCATATGATCGACCTTACTATGGGGACCCAAATGTCTTGAGACAACA
AATTCCTGGGTATGCTAACTCTCCTGGAATTTATCCATATTCCCAGCAGC
AGCAACAAGATGGTTTTTCAGGGCGACGACCAGGGCAAGACCAGCTTGGT
CTCAATAATCATGCTACCGCCAGAACCAACAGCTTGACTTCACCTCCACA
ATCAACCAATCCTTGGATGCACTCTTACCACAATCAAACACAACCAAATT
CTATGAGCCCTAATTTCAATATGAACATACCGAATATGTTTCATACAAGG
TGGGAACAAGACCAAGCCTCACTTCTACAACAAAGAGAAATGATGCAAAG
AGAAGAACATGCAAGGATGATGTATCGAGAGCGCTTGCAAATGCAAGAGA
GAGAAAATCAGTTGAAAATCCAGATGCAGAAGGAGCAAGAGCGAGAGTTG
CAACTTCAGCGTGAAAAAGAAGCACAACTTCAGCGTGAAAGGGAAGCAAA
GGTTCAAAGAGAACGTGAAGCCCAATTAGAAAGAGAGCGACAAGCTCAAC
TTCAAAGAGAACGACAAGCTGCTCTGGAGAAAGAAAGACAGCTACAGTTG
CAGAGGGAAAGAGAAGCTCAATTACAAAGAGAAGCTCAATTACAATATCA
GATGCAAAGAGAAATGCAACTTGAAAGAGAAAGAGAAGCAATGGCAATAA
GAGAAAGAGATGCAATCCTTGAACGAGATAGAAAAGCAATGCTCTACAGA
GATGCTTATTTTGCACAACAACATCAACCACAGCAATttccaaaccattt
tggttccaTGCAAAATACATTGCCTAATTTGAATTTCACACAATCCAATG
AGTCAATGTCTAATCAATTTAACTTCTATAACCAGCCCAGTATGCATTCA
AATGGTAATCTTCCTAGCAGTACATCGTCTTCTATACTAAACTTCTCAAT
GGATCAAATTTTCAACCCTAATAAGATATCTGAGTCACCTGTCTCCAAAG
CAGCAAGTACCAGTTCTTCCTTTCACTTTCCAATCTCATCACCTTCCACC
GTCAGCTCAACAACAACTTCATCAACAACGACAACCACAACTGCTTTACG
TAAAAGCTCATCTAACTCATTTGACAATGGAATTATAAATAGTATTGTTT
CTGATAAGGGATTTTTAACCTCACCCTTGGACAGTAATAGTCAATTCATG
AAAACATGGCAAGAACTACAGGATATGGATTTGagtgaaattgagaaaaa
tgtcCTTGGACCTAAAGATCAAGATTCCCGAAACACTCCATTAGCAGATA
CTCCATTTTCAAACCCTACTACACCAACAGAAATGAATGGGCTGCCACCA
AAACCAATTGATTCTAACTTGAATAACATTGTTAATTCTCTACCTGAAAA
CTCTCTGGATTTAAATAAGCATTccattgaaacaaaagaatctttACAAA
TAACAAACACTGAAGATACACCACCACAACAGAATCTATTGAATCATCCA
AGAAATTTATTATCAGTATCTCAAACAGCTCAAGCTAGCTCCAATTATAC
AAACACCAGTGTAACGCAATCAGACATAAACTTGACACATGTATCAGAAA
ATTTACTTACCCATAATAGGTCTTGCGTTTCTTCATTTGTTTCGCCTACG
TCATCAGATTTGTATTGCAATCAAGATTTTGATAAGCAATCAAAACGAGG
AGATGATATCAAGCATGAAGAATATTCTAATGAACTTCAAAGCAATCACT
CAAAATCATATGAAAAACAATCATCATCTTCACCTAcaacattaaaacaa
aaatcaaaacaatcatttAGTAGTATTGAAAGTTTCCTTGGTATGAGCAG
CGATAGTAAAAAAACTGAAGATAATGATAATGAAAGGATTAATGACACCA
CTAAAAAGCGAGAAAGGATCCCATCAAGTGATGTACAAGATCGAATTTCA
GTCATAAAACCATTACCAATTTCATCACCACAAATTTCAAACACATCCTC
TCCTTTGGATATTGTGAATAATGATCATGACACATTGAAAAGTCCACAAG
CAATTGAAAAGCTGAAATCTcctgaagaaattcaaaaagtaaTAGATCAT
TCTGAATCTGCACCTGTCACACTCATCCATCCATCTATGCGCCTCAAAAA
GCAAAGAAGTCTATCAAACAGTTCAATGACTGCCACCAGTCCACAACCCG
TTATGGAAaaggaaaaaccaaaaacaagtAATAGACGACCGTTACATCCT
TCTATGCGATTACAGACcaataaaaataatacaaaagTTGATAAAGCTGA
ACCTAAAAAGAGTAAGGTTGAAAATCTTGATAACAGTTTTGACAGTGGAA
AGAATATCTTACACAGTCCAAAAACTGGGCGTTATCAATCTGAACTTACA
AGTACTTCCACCAAATCTTCAACTAGGAAGTTATCTCCGTTCACTCCTCC
AACTGTTACATCACCTTTAACCTCACCACCACTAGTATCACCTGGAATTC
GAAGTCCCTTCAATGGAAAACCCCTCACTGGAAAACCATTCTCAACTGGT
AAGCCTGTTCATGGAGGAAAACCAGCATCTTATTCAGCTCAAGGTGGTGG
TAAACCAATGCATATGGGAGGGAAACCGACTAGTTTCTCTTCACATATGA
CTGTCAAAGAGGAAAAGTCACCAGAAAAAGAGCACACTGGCAAACCTTTA
TCTTTTTTGAAGTCCATGGTAgaagaatcttccaaaaacaCAAACACACT
TCAAGGGAAAAAGATCACTGGCAAGAAAAGACCCAGAAAGGAAACTATCG
AGAAACCAGCttcaaaagaaactttaaaaaaagatgACATATCAAAATCC
CCTGACTTGAAAACAAGTCGTATAACAAAAATGATATCAACCCCACCAAG
CTCACAAAAATTGACAGATAATATCAAGACTAAGAAACCACCACAAGAAA
AACAGGCACCTGTTAAAAAACTACCTGTCAAAAGGTCTCCAAAAGTATCA
CCTCCCAAGAGAGAAGCTGTAAAAGATTCACCACTGAAAGAAAATCCTTT
TAGAAAATCTATCGTCCAAGCAAAGAGTAAACCAGTActgacaaaacaga
aaaatttgaGTAAAGAGAATATTGAAGAATTGAGCACAAGTGAGGAAAAA
GATTCCCCAAAGAAGacattcaaattcaaagggaTCACATTTGATGCCAA
GACTGAAGATGATGATAGCAGTGATTCTGATTCAGACAGCTCATCAAATT
CTGATTcagGGTCGTCAAGTGATAGCAGTGACAACAGTGGAacagaagaa
gaaattgaagataTTGAAGACGAAGACGATGACGATACTGCATCTCAAAC
AAGTTCAGTTACAAGCTCTCCTGCAAAGAAAACACAAAGAGCTGGTCAAA
AACGAAAAGCAGTTCCTGACAATGCAGAGGtGATTGCCAGTTTGAAGAAA
CGAAAAGTTGTTGATTTGGATTTGATAAAAGCGCCATTAAAATTTggATG
GAGAAGGCAGACAAGACTCAGACCGAACAATGCTGGTGATGGGCTGAGGG
GAGATGTTTATTATTATTCACCTTGTGGGAAAAAGCTGAGGACGTATCCT
GAGTTAAACAGTtACATCTTTCGAAATGATGTCGTTGATGTAGACTTGAA
GAATTTCAGCTTTTCAACCAAACTTCGTGTTGGCGAATTCATGCAGGCTA
AGGATGGTTCAAAGTTTGTGACACTGACTGAAGAAGAGATCGATGAAACA
TTTGTTATGATGGAAGAAAGGAGAAGTGCTTCTGCAAAAAGAGCTGaaga
aaagaagagagaaaaacgTGAAAAGGAGGAGAAGCAACGTCAGATACTTG
AGGAGAGAAAAAAGAAGAGAGAAGAAGCCTTGGAAAGAAAGAGATCGAAA
GAAGAAGAAAGGAGAAAGGTTCAAAAAGACAAAGCATTGGAAGCAAAGAT
GAAGAAGGAGAAAGAAAAGGAAGCAGCACAAGAAGCCAAACGATTGAAAG
AGGAGGCAATAATGTTGAAGAAACTAGAAAGGCAAGCTCAAATGGAAGCA
AGTCGAATTGCCAAGCGTGAGAAAGTTCAAAATATGTTGGCTGAAAAGCA
GAAGATGAAAGAACAAAGAGAACATGAACGAGTCATGAAGATTGAGAACC
AAAAAGTGgagaaagaaatgaaattacAAGCAATCGAAAATgaGAAGGAA
CGTAAAAGGCTGCAACAAGTGAAAAGTAAAGTATCAGAAAAAGAAAAGCG
AAAACGAGAGCTGGTCATGATGAAAGCTTATGAAGCACAACGGAGAGCTG
AGGAGAGAGAACGCCTCAAAGAACAAAAGAAGCTGGAGAAAACCTTGATC
AGGCAACGAAAATTGGAACAGAAAAGATATGAGCGCATGATCtctaaaga
attgaaaaaacctATCGATGATATGGCTCTGAATGATTTGAAGCCGTTGC
CAGAGTTACCAAGGGTAACCAACATCAACATTCCTGGCAAAGCATATGCA
GATATCCTGATGGTTCAAGAGTTTGTTCACGCCTTTGGTCATGTCATTGA
TATCGATCCAGAGAAGGAGTTTCCAAGCATGGGAGAGTTGCAATCATCAT
TGTTGTGTGAATCTGGTAGCGATGAAGCAATCTTCACTGCATGCCAAGCA
CTTCTTTTTTACGCCCTCTACGATCCCGGTGTATCTGGGCCTTATGCCAA
AACTTCACTGGGTTCAGACCTTACGAGTATCGAATTGAACGAGAACAACA
TATCAGAAGTATTACGTCTTTTCATCTTATCACGTAATGAAGGAAAACAA
CACACACTCAGTGATCAGCTCACCAAATATCCTTTAGAAGCTCTCTCACC
CAGTAGTAAAGCTGCTGTTCTAGCTTTCATTGTCAACGAACTGCTTTGTG
GAAAATCAGTTAGCAGAGAGATTGACGGTAGCTTggagaacatttcaaat
atgCGAAGGGATAAATGGAACCTGGAAGGAGATATACGGAAaTTGAAAGC
TGATCTATTATCAAAGCAACCCAAGAAAGCAGCCAGTGATCAACAACAGA
AcctaaaaaacaacaaaggaGAGTCGAAGAAAAGAGACTCTGACGAGGAG
AACAATTCGGACGATGAAGGAACCACTATCACCACTGCTAAGGAGAGCAA
TATCGATTTAAACGACACTGCGGAAGACACAGAAGCTGAAAACCAGCCAG
AGATGGTGAATCCTACTACACTCGACCAAATGGAGAAGAAACTACGTTTG
ATGGAAAAGAAACACGCTCGCTACCGTAAAAAGTTGTTCGATTCTTCACA
CACGATACGTGGTATAAATTTGGGTCAAGATCGATACCGGCGCCGTTATT
TCGTGCTTCCGAACGCCGGAGGGATTTACGTCGAAGGGCTGGAAAGTGGA
TTTTTTGACGAAGAAACGAACGTGAAAACAAAGGAAGAAAAGGAAGAATG
CAAAGAACATTTAGATAGTTTACTGACCACCTTGAAATCTCCAACTGTGT
TGAAATCCCCTGTGACTGGCCCCAAAACACCGGCCACAAATACACCGTCT
GTATCAGCATTATCCTCAAATTCAAACGAACTTTTAAAACCGAAACAAGA
GAGTCCTATAcaaacacaacaacaacaaaaacagataaaagtTGAGAATC
CTTGTTCAAGTGATAGTAGTTATGTCAAATCTTGGTTTTCCTTACGGACT
AAAAAACGTTGCGAGTCTTACAAAACTTCAGCTATACGTGAAACGCCTAA
AGAGCGCAAACATTCGCTCATCGTTGCACCGAGGATAGAACGACTTGCCG
ACGACCACCAATTCTTAGAATCTATATACTCTTGTTATTCCACTACTTCT
CCTGGTGGGAAAAACACTTTATTACCTGTCAGCAGATTTCCCTTATCCAA
GGAAAGTATGCATCGGAACTCGTTACTAGGCTTACCGGCTGAATTGGATA
TGAATTTACTTATACAACAAGACCCACAAAAAGCAGCGGAAATTCTTGAA
ATACAGACTGCCAAGCCTCAAGAAATTCCGCCTGAAATGCAGGCGGGTTG
GTGGCGGATCACCGATCCAGAACAAATGCAGCGCCTGAACAAGTGCGCCC
ACGCCAGGGGTATGAGAGAACGGAACCTTCAAAAGACGGTGGTGCGATTC
CAAGACTACACCAACTCATCGTGTAAAGTTGACCATCTTGCATtttctcT
ACTTCTCCCCGACGAAGAAAGTGAAAGCAAAGACAAAGTAACAGAAGACG
ACAGCAGCGTTGCCACATCAACGGATACAAACAAATCGATACAAGATAAA
TGGTATCCACAGCTGGCGTATGCAAGTGACAAAGCCATTTTGATTGAAGT
CGAAGAATTAGAGGAAAAGGTCTTCTCGGCTAGTTTGCAAGTCAAGGGCT
GGCGTTTGTCTCAAAAGATCTCTCCAGCACTTCTGCTGAGCACGAGTAAC
GATCAAGCTGAGTATGATCCACCCGAAGATAAATATCCCATCAGGATAGC
GGCTTCCCGTCTCCTAGCTCTTGAGCTCGGTATCGAACGACGTTACATGA
AGCCTCCATTCCGTACACCAGACAGCCTTCCTAAACCGGACGCCCCAGAG
GCTAAAGAAGAACCAGTCAAGAATCCAAAAGCAACAGCCCAACTGGAGAA
ATGGCGTGAAGCAGTAAGCGAAGCAAAATCGTCAGCTCAGCTATCGATGT
GTATCACAGCACTCTTCGAATGTGTCGCTTGGGAGAAGTCCATCATGAAA
GTGTTCTGCATACTATGTCGTAAAAGTGACAACGAAGAAAGATTGTTGCT
ATGCGACGCATGTGATCGAGGCTGTCATACGTATTGTTGTAAGCCGAAAT
TCGATAAGATTCCCGATGGTGACTGGTTTTGTCAAGATTGTGTGTTGATG
GCGTCTGGTAGTGATCAGTGCTACAAATGTAAATCGAAGACCGGACGACG
TCTGAAATGTGCATTCTGTCCACGTCATTATCACATGGACTGCCTTGAAC
CACCATTACACAAaACACCTCGTTCGCCTTGGAGTTGTCCCGTCTGCAAG
AAAACACGCTCCAAGAGTAAACCTCCTCAACGTAAAAAACCACGCGCCGA
AGAACTTCTCAAGAAAGAGGAACAGAGCAAACAAAAATCCATGTCCAACA
GCCGTGTGCAGACGTCCAAAGACATGGAACCGTGTCGTTTCATATTGAAC
GAAATGGAAAATCACGAATCGTCATGGCCCTTTCTCGTCCCTGTCAATAT
GAAGCAGTTTCCAGAGTATTATAAAGTGATCAAGCATCCGATGGATTTCC
ATACCATGAAAACGAAGCTGCGTGATTACCAATACAAGTCAAAAGAAGAG
TTCGCACGTGACGCGCGGTTGGTGTTTTTCAATTGTAAAACGTACAACGA
AGACGAATCGGAGGTTGGATGTGCAGGTGAAGCGATGCGAagtttcttcg
agaaacgttgGACCGCCCTCAAAAAGGGTGTCTCTTCCACAAACAGTGAT
AACAAATTCCACACCAACAAGAAGGGGGAGGGTGTGGAATCATCAGGCGA
TGAAGGAGAAGACGCTCAGGAGGAGGGTGAAGGCGATGAAGAAGTATCCA
GTTCGAGTTCTGAAGAAATCTCATCCGAAAGTGAGAGCAGCGAAGTGGAG
GAGGACAGTGAAAACGAGACCGACTCAAAAACATGAATGGACAATCGTTC
CGGTGGTCAAGGCAACCCATATGATCGACCTTACTATGGGGACCCAAATG
TCTTGAGACAACAAATTCCTGGGTATGCTAACTCTCCTGGAATTTATCCA
TATTCCCAGCAGCAGCAACAAGATGGTTTTTCAGGGCGACGACCAGGGCA
AGACCAGCTTGGTCTCAATAATCATGCTACCGCCAGAACCAACAGCTTGA
CTTCACCTCCACAATCAACCAATCCTTGGATGCACTCTTACCACAATCAA
ACACAACCAAATTCTATGAGCCCTAATTTCAATATGAACATACCGAATAT
GTTTCATACAAGGTGGGAACAAGACCAAGCCTCACTTCTACAACAAAGAG
AAATGATGCAAAGAGAAGAACATGCAAGGATGATGTATCGAGAGCGCTTG
CAAATGCAAGAGAGAGAAAATCAGTTGAAAATCCAGATGCAGAAGGAGCA
AGAGCGAGAGTTGCAACTTCAGCGTGAAAAAGAAGCACAACTTCAGCGTG
AAAGGGAAGCAAAGGTTCAAAGAGAACGTGAAGCCCAATTAGAAAGAGAG
CGACAAGCTCAACTTCAAAGAGAACGACAAGCTGCTCTGGAGAAAGAAAG
ACAGCTACAGTTGCAGAGGGAAAGAGAAGCTCAATTACAAAGAGAAGCTC
AATTACAATATCAGATGCAAAGAGAAATGCAACTTGAAAGAGAAAGAGAA
GCAATGGCAATAAGAGAAAGAGATGCAATCCTTGAACGAGATAGAAAAGC
AATGCTCTACAGAGATGCTTATTTTGCACAACAACATCAACCACAGCAAT
ttccaaaccattttggttccaTGCAAAATACATTGCCTAATTTGAATTTC
ACACAATCCAATGAGTCAATGTCTAATCAATTTAACTTCTATAACCAGCC
CAGTATGCATTCAAATGGTAATCTTCCTAGCAGTACATCGTCTTCTATAC
TAAACTTCTCAATGGATCAAATTTTCAACCCTAATAAGATATCTGAGTCA
CCTGTCTCCAAAGCAGCAAGTACCAGTTCTTCCTTTCACTTTCCAATCTC
ATCACCTTCCACCGTCAGCTCAACAACAACTTCATCAACAACGACAACCA
CAACTGCTTTACGTAAAAGCTCATCTAACTCATTTGACAATGGAATTATA
AATAGTATTGTTTCTGATAAGGGATTTTTAACCTCACCCTTGGACAGTAA
TAGTCAATTCATGAAAACATGGCAAGAACTACAGGATATGGATTTGagtg
aaattgagaaaaatgtcCTTGGACCTAAAGATCAAGATTCCCGAAACACT
CCATTAGCAGATACTCCATTTTCAAACCCTACTACACCAACAGAAATGAA
TGGGCTGCCACCAAAACCAATTGATTCTAACTTGAATAACATTGTTAATT
CTCTACCTGAAAACTCTCTGGATTTAAATAAGCATTccattgaaacaaaa
gaatctttACAAATAACAAACACTGAAGATACACCACCACAACAGAATCT
ATTGAATCATCCAAGAAATTTATTATCAGTATCTCAAACAGCTCAAGCTA
GCTCCAATTATACAAACACCAGTGTAACGCAATCAGACATAAACTTGACA
CATGTATCAGAAAATTTACTTACCCATAATAGGTCTTGCGTTTCTTCATT
TGTTTCGCCTACGTCATCAGATTTGTATTGCAATCAAGATTTTGATAAGC
AATCAAAACGAGGAGATGATATCAAGCATGAAGAATATTCTAATGAACTT
CAAAGCAATCACTCAAAATCATATGAAAAACAATCATCATCTTCACCTAc
aacattaaaacaaaaatcaaaacaatcatttAGTAGTATTGAAAGTTTCC
TTGGTATGAGCAGCGATAGTAAAAAAACTGAAGATAATGATAATGAAAGG
ATTAATGACACCACTAAAAAGCGAGAAAGGATCCCATCAAGTGATGTACA
AGATCGAATTTCAGTCATAAAACCATTACCAATTTCATCACCACAAATTT
CAAACACATCCTCTCCTTTGGATATTGTGAATAATGATCATGACACATTG
AAAAGTCCACAAGCAATTGAAAAGCTGAAATCTcctgaagaaattcaaaa
agtaaTAGATCATTCTGAATCTGCACCTGTCACACTCATCCATCCATCTA
TGCGCCTCAAAAAGCAAAGAAGTCTATCAAACAGTTCAATGACTGCCACC
AGTCCACAACCCGTTATGGAAaaggaaaaaccaaaaacaagtAATAGACG
ACCGTTACATCCTTCTATGCGATTACAGACcaataaaaataatacaaaag
TTGATAAAGCTGAACCTAAAAAGAGTAAGGTTGAAAATCTTGATAACAGT
TTTGACAGTGGAAAGAATATCTTACACAGTCCAAAAACTGGGCGTTATCA
ATCTGAACTTACAAGTACTTCCACCAAATCTTCAACTAGGAAGTTATCTC
CGTTCACTCCTCCAACTGTTACATCACCTTTAACCTCACCACCACTAGTA
TCACCTGGAATTCGAAGTCCCTTCAATGGAAAACCCCTCACTGGAAAACC
ATTCTCAACTGGTAAGCCTGTTCATGGAGGAAAACCAGCATCTTATTCAG
CTCAAGGTGGTGGTAAACCAATGCATATGGGAGGGAAACCGACTAGTTTC
TCTTCACATATGACTGTCAAAGAGGAAAAGTCACCAGAAAAAGAGCACAC
TGGCAAACCTTTATCTTTTTTGAAGTCCATGGTAgaagaatcttccaaaa
acaCAAACACACTTCAAGGGAAAAAGATCACTGGCAAGAAAAGACCCAGA
AAGGAAACTATCGAGAAACCAGCttcaaaagaaactttaaaaaaagatgA
CATATCAAAATCCCCTGACTTGAAAACAAGTCGTATAACAAAAATGATAT
CAACCCCACCAAGCTCACAAAAATTGACAGATAATATCAAGACTAAGAAA
CCACCACAAGAAAAACAGGCACCTGTTAAAAAACTACCTGTCAAAAGGTC
TCCAAAAGTATCACCTCCCAAGAGAGAAGCTGTAAAAGATTCACCACTGA
AAGAAAATCCTTTTAGAAAATCTATCGTCCAAGCAAAGAGTAAACCAGTA
ctgacaaaacagaaaaatttgaGTAAAGAGAATATTGAAGAATTGAGCAC
AAGTGAGGAAAAAGATTCCCCAAAGAAGacattcaaattcaaagggaTCA
CATTTGATGCCAAGACTGAAGATGATGATAGCAGTGATTCTGATTCAGAC
AGCTCATCAAATTCTGATTcagGGTCGTCAAGTGATAGCAGTGACAACAG
TGGAacagaagaagaaattgaagataTTGAAGACGAAGACGATGACGATA
CTGCATCTCAAACAAGTTCAGTTACAAGCTCTCCTGCAAAGAAAACACAA
AGAGCTGGTCAAAAACGAAAAGCAGTTCCTGACAATGCAGAGGtGATTGC
CAGTTTGAAGAAACGAAAAGTTGTTGATTTGGATTTGATAAAAGCGCCAT
TAAAATTTggATGGAGAAGGCAGACAAGACTCAGACCGAACAATGCTGGT
GATGGGCTGAGGGGAGATGTTTATTATTATTCACCTTGTGGGAAAAAGCT
GAGGACGTATCCTGAGTTAAACAGTtACATCTTTCGAAATGATGTCGTTG
ATGTAGACTTGAAGAATTTCAGCTTTTCAACCAAACTTCGTGTTGGCGAA
TTCATGCAGGCTAAGGATGGTTCAAAGTTTGTGACACTGACTGAAGAAGA
GATCGATGAAACATTTGTTATGATGGAAGAAAGGAGAAGTGCTTCTGCAA
AAAGAGCTGaagaaaagaagagagaaaaacgTGAAAAGGAGGAGAAGCAA
CGTCAGATACTTGAGGAGAGAAAAAAGAAGAGAGAAGAAGCCTTGGAAAG
AAAGAGATCGAAAGAAGAAGAAAGGAGAAAGGTTCAAAAAGACAAAGCAT
TGGAAGCAAAGATGAAGAAGGAGAAAGAAAAGGAAGCAGCACAAGAAGCC
AAACGATTGAAAGAGGAGGCAATAATGTTGAAGAAACTAGAAAGGCAAGC
TCAAATGGAAGCAAGTCGAATTGCCAAGCGTGAGAAAGTTCAAAATATGT
TGGCTGAAAAGCAGAAGATGAAAGAACAAAGAGAACATGAACGAGTCATG
AAGATTGAGAACCAAAAAGTGgagaaagaaatgaaattacAAGCAATCGA
AAATgaGAAGGAACGTAAAAGGCTGCAACAAGTGAAAAGTAAAGTATCAG
AAAAAGAAAAGCGAAAACGAGAGCTGGTCATGATGAAAGCTTATGAAGCA
CAACGGAGAGCTGAGGAGAGAGAACGCCTCAAAGAACAAAAGAAGCTGGA
GAAAACCTTGATCAGGCAACGAAAATTGGAACAGAAAAGATATGAGCGCA
TGATCtctaaagaattgaaaaaacctATCGATGATATGGCTCTGAATGAT
TTGAAGCCGTTGCCAGAGTTACCAAGGGTAACCAACATCAACATTCCTGG
CAAAGCATATGCAGATATCCTGATGGTTCAAGAGTTTGTTCACGCCTTTG
GTCATGTCATTGATATCGATCCAGAGAAGGAGTTTCCAAGCATGGGAGAG
TTGCAATCATCATTGTTGTGTGAATCTGGTAGCGATGAAGCAATCTTCAC
TGCATGCCAAGCACTTCTTTTTTACGCCCTCTACGATCCCGGTGTATCTG
GGCCTTATGCCAAAACTTCACTGGGTTCAGACCTTACGAGTATCGAATTG
AACGAGAACAACATATCAGAAGTATTACGTCTTTTCATCTTATCACGTAA
TGAAGGAAAACAACACACACTCAGTGATCAGCTCACCAAATATCCTTTAG
AAGCTCTCTCACCCAGTAGTAAAGCTGCTGTTCTAGCTTTCATTGTCAAC
GAACTGCTTTGTGGAAAATCAGTTAGCAGAGAGATTGACGGTAGCTTgga
gaacatttcaaatatgCGAAGGGATAAATGGAACCTGGAAGGAGATATAC
GGAAaTTGAAAGCTGATCTATTATCAAAGCAACCCAAGAAAGCAGCCAGT
GATCAACAACAGAAcctaaaaaacaacaaaggaGAGTCGAAGAAAAGAGA
CTCTGACGAGGAGAACAATTCGGACGATGAAGGAACCACTATCACCACTG
CTAAGGAGAGCAATATCGATTTAAACGACACTGCGGAAGACACAGAAGCT
GAAAACCAGCCAGAGATGGTGAATCCTACTACACTCGACCAAATGGAGAA
GAAACTACGTTTGATGGAAAAGAAACACGCTCGCTACCGTAAAAAGTTGT
TCGATTCTTCACACACGATACGTGGTATAAATTTGGGTCAAGATCGATAC
CGGCGCCGTTATTTCGTGCTTCCGAACGCCGGAGGGATTTACGTCGAAGG
GCTGGAAAGTGGATTTTTTGACGAAGAAACGAACGTGAAAACAAAGGAAG
AAAAGGAAGAATGCAAAGAACATTTAGATAGTTTACTGACCACCTTGAAA
TCTCCAACTGTGTTGAAATCCCCTGTGACTGGCCCCAAAACACCGGCCAC
AAATACACCGTCTGTATCAGCATTATCCTCAAATTCAAACGAACTTTTAA
AACCGAAACAAGAGAGTCCTATAcaaacacaacaacaacaaaaacagata
aaagtTGAGAATCCTTGTTCAAGTGATAGTAGTTATGTCAAATCTTGGTT
TTCCTTACGGACTAAAAAACGTTGCGAGTCTTACAAAACTTCAGCTATAC
GTGAAACGCCTAAAGAGCGCAAACATTCGCTCATCGTTGCACCGAGGATA
GAACGACTTGCCGACGACCACCAATTCTTAGAATCTATATACTCTTGTTA
TTCCACTACTTCTCCTGGTGGGAAAAACACTTTATTACCTGTCAGCAGAT
TTCCCTTATCCAAGGAAAGTATGCATCGGAACTCGTTACTAGGCTTACCG
GCTGAATTGGATATGAATTTACTTATACAACAAGACCCACAAAAAGCAGC
GGAAATTCTTGAAATACAGACTGCCAAGCCTCAAGAAATTCCGCCTGAAA
TGCAGGCGGGTTGGTGGCGGATCACCGATCCAGAACAAATGCAGCGCCTG
AACAAGTGCGCCCACGCCAGGGGTATGAGAGAACGGAACCTTCAAAAGAC
GGTGGTGCGATTCCAAGACTACACCAACTCATCGTGTAAAGTTGACCATC
TTGCATtttctcTACTTCTCCCCGACGAAGAAAGTGAAAGCAAAGACAAA
GTAACAGAAGACGACAGCAGCGTTGCCACATCAACGGATACAAACAAATC
GATACAAGATAAATGGTATCCACAGCTGGCGTATGCAAGTGACAAAGCCA
TTTTGATTGAAGTCGAAGAATTAGAGGAAAAGGTCTTCTCGGCTAGTTTG
CAAGTCAAGGGCTGGCGTTTGTCTCAAAAGATCTCTCCAGCACTTCTGCT
GAGCACGAGTAACGATCAAGCTGAGTATGATCCACCCGAAGATAAATATC
CCATCAGGATAGCGGCTTCCCGTCTCCTAGCTCTTGAGCTCGGTATCGAA
CGACGTTACATGAAGCCTCCATTCCGTACACCAGACAGCCTTCCTAAACC
GGACGCCCCAGAGGCTAAAGAAGAACCAGTCAAGAATCCAAAAGCAACAG
CCCAACTGGAGAAATGGCGTGAAGCAGTAAGCGAAGCAAAATCGTCAGCT
CAGCTATCGATGTGTATCACAGCACTCTTCGAATGTGTCGCTTGGGAGAA
GTCCATCATGAAAGTGTTCTGCATACTATGTCGTAAAAGTGACAACGAAG
AAAGATTGTTGCTATGCGACGCATGTGATCGAGGCTGTCATACGTATTGT
TGTAAGCCGAAATTCGATAAGATTCCCGATGGTGACTGGTTTTGTCAAGA
TTGTGTGTTGATGGCGTCTGGTAGTGATCAGTGCTACAAATGTAAATCGA
AGACCGGACGACGTCTGAAATGTGCATTCTGTCCACGTCATTATCACATG
GACTGCCTTGAACCACCATTACACAAaACACCTCGTTCGCCTTGGAGTTG
TCCCGTCTGCAAGAAAACACGCTCCAAGAGTAAACCTCCTCAACGTAAAA
AACCACGCGCCGAAGAACTTCTCAAGAAAGAGGAACAGAGCAAACAAAAA
TCCATGTCCAACAGCCGTGTGCAGACGTCCAAAGACATGGAACCGTGTCG
TTTCATATTGAACGAAATGGAAAATCACGAATCGTCATGGCCCTTTCTCG
TCCCTGTCAATATGAAGCAGTTTCCAGAGTATTATAAAGTGATCAAGCAT
CCGATGGATTTCCATACCATGAAAACGAAGCTGCGTGATTACCAATACAA
GTCAAAAGAAGAGTTCGCACGTGACGCGCGGTTGGTGTTTTTCAATTGTA
AAACGTACAACGAAGACGAATCGGAGGTTGGATGTGCAGGTGAAGCGATG
CGAagtttcttcgagaaacgttgGACCGCCCTCAAAAAGGGTGTCTCTTC
CACAAACAGTGATAACAAATTCCACACCAACAAGAAGGGGGAGGGTGTGG
AATCATCAGGCGATGAAGGAGAAGACGCTCAGGAGGAGGGTGAAGGCGAT
GAAGAAGTATCCAGTTCGAGTTCTGAAGAAATCTCATCCGAAAGTGAGAG
CAGCGAAGTGGAGGAGGACAGTGAAAACGAGACCGACTCAAAAACATGAA
TGGACAATCGTTCCGGTGGTCAAGGCAACCCATATGATCGACCTTACTAT
GGGGACCCAAATGTCTTGAGACAACAAATTCCTGGGTATGCTAACTCTCC
TGGAATTTATCCATATTCCCAGCAGCAGCAACAAGATGGTTTTTCAGGGC
GACGACCAGGGCAAGACCAGCTTGGTCTCAATAATCATGCTACCGCCAGA
ACCAACAGCTTGACTTCACCTCCACAATCAACCAATCCTTGGATGCACTC
TTACCACAATCAAACACAACCAAATTCTATGAGCCCTAATTTCAATATGA
ACATACCGAATATGTTTCATACAAGGTGGGAACAAGACCAAGCCTCACTT
CTACAACAAAGAGAAATGATGCAAAGAGAAGAACATGCAAGGATGATGTA
TCGAGAGCGCTTGCAAATGCAAGAGAGAGAAAATCAGTTGAAAATCCAGA
TGCAGAAGGAGCAAGAGCGAGAGTTGCAACTTCAGCGTGAAAAAGAAGCA
CAACTTCAGCGTGAAAGGGAAGCAAAGGTTCAAAGAGAACGTGAAGCCCA
ATTAGAAAGAGAGCGACAAGCTCAACTTCAAAGAGAACGACAAGCTGCTC
TGGAGAAAGAAAGACAGCTACAGTTGCAGAGGGAAAGAGAAGCTCAATTA
CAAAGAGAAGCTCAATTACAATATCAGATGCAAAGAGAAATGCAACTTGA
AAGAGAAAGAGAAGCAATGGCAATAAGAGAAAGAGATGCAATCCTTGAAC
GAGATAGAAAAGCAATGCTCTACAGAGATGCTTATTTTGCACAACAACAT
CAACCACAGCAATttccaaaccattttggttccaTGCAAAATACATTGCC
TAATTTGAATTTCACACAATCCAATGAGTCAATGTCTAATCAATTTAACT
TCTATAACCAGCCCAGTATGCATTCAAATGGTAATCTTCCTAGCAGTACA
TCGTCTTCTATACTAAACTTCTCAATGGATCAAATTTTCAACCCTAATAA
GATATCTGAGTCACCTGTCTCCAAAGCAGCAAGTACCAGTTCTTCCTTTC
ACTTTCCAATCTCATCACCTTCCACCGTCAGCTCAACAACAACTTCATCA
ACAACGACAACCACAACTGCTTTACGTAAAAGCTCATCTAACTCATTTGA
CAATGGAATTATAAATAGTATTGTTTCTGATAAGGGATTTTTAACCTCAC
CCTTGGACAGTAATAGTCAATTCATGAAAACATGGCAAGAACTACAGGAT
ATGGATTTGagtgaaattgagaaaaatgtcCTTGGACCTAAAGATCAAGA
TTCCCGAAACACTCCATTAGCAGATACTCCATTTTCAAACCCTACTACAC
CAACAGAAATGAATGGGCTGCCACCAAAACCAATTGATTCTAACTTGAAT
AACATTGTTAATTCTCTACCTGAAAACTCTCTGGATTTAAATAAGCATTc
cattgaaacaaaagaatctttACAAATAACAAACACTGAAGATACACCAC
CACAACAGAATCTATTGAATCATCCAAGAAATTTATTATCAGTATCTCAA
ACAGCTCAAGCTAGCTCCAATTATACAAACACCAGTGTAACGCAATCAGA
CATAAACTTGACACATGTATCAGAAAATTTACTTACCCATAATAGGTCTT
GCGTTTCTTCATTTGTTTCGCCTACGTCATCAGATTTGTATTGCAATCAA
GATTTTGATAAGCAATCAAAACGAGGAGATGATATCAAGCATGAAGAATA
TTCTAATGAACTTCAAAGCAATCACTCAAAATCATATGAAAAACAATCAT
CATCTTCACCTAcaacattaaaacaaaaatcaaaacaatcatttAGTAGT
ATTGAAAGTTTCCTTGGTATGAGCAGCGATAGTAAAAAAACTGAAGATAA
TGATAATGAAAGGATTAATGACACCACTAAAAAGCGAGAAAGGATCCCAT
CAAGTGATGTACAAGATCGAATTTCAGTCATAAAACCATTACCAATTTCA
TCACCACAAATTTCAAACACATCCTCTCCTTTGGATATTGTGAATAATGA
TCATGACACATTGAAAAGTCCACAAGCAATTGAAAAGCTGAAATCTcctg
aagaaattcaaaaagtaaTAGATCATTCTGAATCTGCACCTGTCACACTC
ATCCATCCATCTATGCGCCTCAAAAAGCAAAGAAGTCTATCAAACAGTTC
AATGACTGCCACCAGTCCACAACCCGTTATGGAAaaggaaaaaccaaaaa
caagtAATAGACGACCGTTACATCCTTCTATGCGATTACAGACcaataaa
aataatacaaaagTTGATAAAGCTGAACCTAAAAAGAGTAAGGTTGAAAA
TCTTGATAACAGTTTTGACAGTGGAAAGAATATCTTACACAGTCCAAAAA
CTGGGCGTTATCAATCTGAACTTACAAGTACTTCCACCAAATCTTCAACT
AGGAAGTTATCTCCGTTCACTCCTCCAACTGTTACATCACCTTTAACCTC
ACCACCACTAGTATCACCTGGAATTCGAAGTCCCTTCAATGGAAAACCCC
TCACTGGAAAACCATTCTCAACTGGTAAGCCTGTTCATGGAGGAAAACCA
GCATCTTATTCAGCTCAAGGTGGTGGTAAACCAATGCATATGGGAGGGAA
ACCGACTAGTTTCTCTTCACATATGACTGTCAAAGAGGAAAAGTCACCAG
AAAAAGAGCACACTGGCAAACCTTTATCTTTTTTGAAGTCCATGGTAgaa
gaatcttccaaaaacaCAAACACACTTCAAGGGAAAAAGATCACTGGCAA
GAAAAGACCCAGAAAGGAAACTATCGAGAAACCAGCttcaaaagaaactt
taaaaaaagatgACATATCAAAATCCCCTGACTTGAAAACAAGTCGTATA
ACAAAAATGATATCAACCCCACCAAGCTCACAAAAATTGACAGATAATAT
CAAGACTAAGAAACCACCACAAGAAAAACAGGCACCTGTTAAAAAACTAC
CTGTCAAAAGGTCTCCAAAAGTATCACCTCCCAAGAGAGAAGCTGTAAAA
GATTCACCACTGAAAGAAAATCCTTTTAGAAAATCTATCGTCCAAGCAAA
GAGTAAACCAGTActgacaaaacagaaaaatttgaGTAAAGAGAATATTG
AAGAATTGAGCACAAGTGAGGAAAAAGATTCCCCAAAGAAGacattcaaa
ttcaaagggaTCACATTTGATGCCAAGACTGAAGATGATGATAGCAGTGA
TTCTGATTCAGACAGCTCATCAAATTCTGATTcagGGTCGTCAAGTGATA
GCAGTGACAACAGTGGAacagaagaagaaattgaagataTTGAAGACGAA
GACGATGACGATACTGCATCTCAAACAAGTTCAGTTACAAGCTCTCCTGC
AAAGAAAACACAAAGAGCTGGTCAAAAACGAAAAGCAGTTCCTGACAATG
CAGAGGtGATTGCCAGTTTGAAGAAACGAAAAGTTGTTGATTTGGATTTG
ATAAAAGCGCCATTAAAATTTggATGGAGAAGGCAGACAAGACTCAGACC
GAACAATGCTGGTGATGGGCTGAGGGGAGATGTTTATTATTATTCACCTT
GTGGGAAAAAGCTGAGGACGTATCCTGAGTTAAACAGTtACATCTTTCGA
AATGATGTCGTTGATGTAGACTTGAAGAATTTCAGCTTTTCAACCAAACT
TCGTGTTGGCGAATTCATGCAGGCTAAGGATGGTTCAAAGTTTGTGACAC
TGACTGAAGAAGAGATCGATGAAACATTTGTTATGATGGAAGAAAGGAGA
AGTGCTTCTGCAAAAAGAGCTGaagaaaagaagagagaaaaacgTGAAAA
GGAGGAGAAGCAACGTCAGATACTTGAGGAGAGAAAAAAGAAGAGAGAAG
AAGCCTTGGAAAGAAAGAGATCGAAAGAAGAAGAAAGGAGAAAGGTTCAA
AAAGACAAAGCATTGGAAGCAAAGATGAAGAAGGAGAAAGAAAAGGAAGC
AGCACAAGAAGCCAAACGATTGAAAGAGGAGGCAATAATGTTGAAGAAAC
TAGAAAGGCAAGCTCAAATGGAAGCAAGTCGAATTGCCAAGCGTGAGAAA
GTTCAAAATATGTTGGCTGAAAAGCAGAAGATGAAAGAACAAAGAGAACA
TGAACGAGTCATGAAGATTGAGAACCAAAAAGTGgagaaagaaatgaaat
tacAAGCAATCGAAAATgaGAAGGAACGTAAAAGGCTGCAACAAGTGAAA
AGTAAAGTATCAGAAAAAGAAAAGCGAAAACGAGAGCTGGTCATGATGAA
AGCTTATGAAGCACAACGGAGAGCTGAGGAGAGAGAACGCCTCAAAGAAC
AAAAGAAGCTGGAGAAAACCTTGATCAGGCAACGAAAATTGGAACAGAAA
AGATATGAGCGCATGATCtctaaagaattgaaaaaacctATCGATGATAT
GGCTCTGAATGATTTGAAGCCGTTGCCAGAGTTACCAAGGGTAACCAACA
TCAACATTCCTGGCAAAGCATATGCAGATATCCTGATGGTTCAAGAGTTT
GTTCACGCCTTTGGTCATGTCATTGATATCGATCCAGAGAAGGAGTTTCC
AAGCATGGGAGAGTTGCAATCATCATTGTTGTGTGAATCTGGTAGCGATG
AAGCAATCTTCACTGCATGCCAAGCACTTCTTTTTTACGCCCTCTACGAT
CCCGGTGTATCTGGGCCTTATGCCAAAACTTCACTGGGTTCAGACCTTAC
GAGTATCGAATTGAACGAGAACAACATATCAGAAGTATTACGTCTTTTCA
TCTTATCACGTAATGAAGGAAAACAACACACACTCAGTGATCAGCTCACC
AAATATCCTTTAGAAGCTCTCTCACCCAGTAGTAAAGCTGCTGTTCTAGC
TTTCATTGTCAACGAACTGCTTTGTGGAAAATCAGTTAGCAGAGAGATTG
ACGGTAGCTTggagaacatttcaaatatgCGAAGGGATAAATGGAACCTG
GAAGGAGATATACGGAAaTTGAAAGCTGATCTATTATCAAAGCAACCCAA
GAAAGCAGCCAGTGATCAACAACAGAAcctaaaaaacaacaaaggaGAGT
CGAAGAAAAGAGACTCTGACGAGGAGAACAATTCGGACGATGAAGGAACC
ACTATCACCACTGCTAAGGAGAGCAATATCGATTTAAACGACACTGCGGA
AGACACAGAAGCTGAAAACCAGCCAGAGATGGTGAATCCTACTACACTCG
ACCAAATGGAGAAGAAACTACGTTTGATGGAAAAGAAACACGCTCGCTAC
CGTAAAAAGTTGTTCGATTCTTCACACACGATACGTGGTATAAATTTGGG
TCAAGATCGATACCGGCGCCGTTATTTCGTGCTTCCGAACGCCGGAGGGA
TTTACGTCGAAGGGCTGGAAAGTGGATTTTTTGACGAAGAAACGAACGTG
AAAACAAAGGAAGAAAAGGAAGAATGCAAAGAACATTTAGATAGTTTACT
GACCACCTTGAAATCTCCAACTGTGTTGAAATCCCCTGTGACTGGCCCCA
AAACACCGGCCACAAATACACCGTCTGTATCAGCATTATCCTCAAATTCA
AACGAACTTTTAAAACCGAAACAAGAGAGTCCTATAcaaacacaacaaca
acaaaaacagataaaagtTGAGAATCCTTGTTCAAGTGATAGTAGTTATG
TCAAATCTTGGTTTTCCTTACGGACTAAAAAACGTTGCGAGTCTTACAAA
ACTTCAGCTATACGTGAAACGCCTAAAGAGCGCAAACATTCGCTCATCGT
TGCACCGAGGATAGAACGACTTGCCGACGACCACCAATTCTTAGAATCTA
TATACTCTTGTTATTCCACTACTTCTCCTGGTGGGAAAAACACTTTATTA
CCTGTCAGCAGATTTCCCTTATCCAAGGAAAGTATGCATCGGAACTCGTT
ACTAGGCTTACCGGCTGAATTGGATATGAATTTACTTATACAACAAGACC
CACAAAAAGCAGCGGAAATTCTTGAAATACAGACTGCCAAGCCTCAAGAA
ATTCCGCCTGAAATGCAGGCGGGTTGGTGGCGGATCACCGATCCAGAACA
AATGCAGCGCCTGAACAAGTGCGCCCACGCCAGGGGTATGAGAGAACGGA
ACCTTCAAAAGACGGTGGTGCGATTCCAAGACTACACCAACTCATCGTGT
AAAGTTGACCATCTTGCATtttctcTACTTCTCCCCGACGAAGAAAGTGA
AAGCAAAGACAAAGTAACAGAAGACGACAGCAGCGTTGCCACATCAACGG
ATACAAACAAATCGATACAAGATAAATGGTATCCACAGCTGGCGTATGCA
AGTGACAAAGCCATTTTGATTGAAGTCGAAGAATTAGAGGAAAAGGTCTT
CTCGGCTAGTTTGCAAGTCAAGGGCTGGCGTTTGTCTCAAAAGATCTCTC
CAGCACTTCTGCTGAGCACGAGTAACGATCAAGCTGAGTATGATCCACCC
GAAGATAAATATCCCATCAGGATAGCGGCTTCCCGTCTCCTAGCTCTTGA
GCTCGGTATCGAACGACGTTACATGAAGCCTCCATTCCGTACACCAGACA
GCCTTCCTAAACCGGACGCCCCAGAGGCTAAAGAAGAACCAGTCAAGAAT
CCAAAAGCAACAGCCCAACTGGAGAAATGGCGTGAAGCAGTAAGCGAAGC
AAAATCGTCAGCTCAGCTATCGATGTGTATCACAGCACTCTTCGAATGTG
TCGCTTGGGAGAAGTCCATCATGAAAGTGTTCTGCATACTATGTCGTAAA
AGTGACAACGAAGAAAGATTGTTGCTATGCGACGCATGTGATCGAGGCTG
TCATACGTATTGTTGTAAGCCGAAATTCGATAAGATTCCCGATGGTGACT
GGTTTTGTCAAGATTGTGTGTTGATGGCGTCTGGTAGTGATCAGTGCTAC
AAATGTAAATCGAAGACCGGACGACGTCTGAAATGTGCATTCTGTCCACG
TCATTATCACATGGACTGCCTTGAACCACCATTACACAAaACACCTCGTT
CGCCTTGGAGTTGTCCCGTCTGCAAGAAAACACGCTCCAAGAGTAAACCT
CCTCAACGTAAAAAACCACGCGCCGAAGAACTTCTCAAGAAAGAGGAACA
GAGCAAACAAAAATCCATGTCCAACAGCCGTGTGCAGACGTCCAAAGACA
TGGAACCGTGTCGTTTCATATTGAACGAAATGGAAAATCACGAATCGTCA
TGGCCCTTTCTCGTCCCTGTCAATATGAAGCAGTTTCCAGAGTATTATAA
AGTGATCAAGCATCCGATGGATTTCCATACCATGAAAACGAAGCTGCGTG
ATTACCAATACAAGTCAAAAGAAGAGTTCGCACGTGACGCGCGGTTGGTG
TTTTTCAATTGTAAAACGTACAACGAAGACGAATCGGAGGTTGGATGTGC
AGGTGAAGCGATGCGAagtttcttcgagaaacgttgGACCGCCCTCAAAA
AGGGTGTCTCTTCCACAAACAGTGATAACAAATTCCACACCAACAAGAAG
GGGGAGGGTGTGGAATCATCAGGCGATGAAGGAGAAGACGCTCAGGAGGA
GGGTGAAGGCGATGAAGAAGTATCCAGTTCGAGTTCTGAAGAAATCTCAT
CCGAAAGTGAGAGCAGCGAAGTGGAGGAGGACAGTGAAAACGAGACCGAC
TCAAAAACATGAATGGACAATCGTTCCGGTGGTCAAGGCAACCCATATGA
TCGACCTTACTATGGGGACCCAAATGTCTTGAGACAACAAATTCCTGGGT
ATGCTAACTCTCCTGGAATTTATCCATATTCCCAGCAGCAGCAACAAGAT
GGTTTTTCAGGGCGACGACCAGGGCAAGACCAGCTTGGTCTCAATAATCA
TGCTACCGCCAGAACCAACAGCTTGACTTCACCTCCACAATCAACCAATC
CTTGGATGCACTCTTACCACAATCAAACACAACCAAATTCTATGAGCCCT
AATTTCAATATGAACATACCGAATATGTTTCATACAAGGTGGGAACAAGA
CCAAGCCTCACTTCTACAACAAAGAGAAATGATGCAAAGAGAAGAACATG
CAAGGATGATGTATCGAGAGCGCTTGCAAATGCAAGAGAGAGAAAATCAG
TTGAAAATCCAGATGCAGAAGGAGCAAGAGCGAGAGTTGCAACTTCAGCG
TGAAAAAGAAGCACAACTTCAGCGTGAAAGGGAAGCAAAGGTTCAAAGAG
AACGTGAAGCCCAATTAGAAAGAGAGCGACAAGCTCAACTTCAAAGAGAA
CGACAAGCTGCTCTGGAGAAAGAAAGACAGCTACAGTTGCAGAGGGAAAG
AGAAGCTCAATTACAAAGAGAAGCTCAATTACAATATCAGATGCAAAGAG
AAATGCAACTTGAAAGAGAAAGAGAAGCAATGGCAATAAGAGAAAGAGAT
GCAATCCTTGAACGAGATAGAAAAGCAATGCTCTACAGAGATGCTTATTT
TGCACAACAACATCAACCACAGCAATttccaaaccattttggttccaTGC
AAAATACATTGCCTAATTTGAATTTCACACAATCCAATGAGTCAATGTCT
AATCAATTTAACTTCTATAACCAGCCCAGTATGCATTCAAATGGTAATCT
TCCTAGCAGTACATCGTCTTCTATACTAAACTTCTCAATGGATCAAATTT
TCAACCCTAATAAGATATCTGAGTCACCTGTCTCCAAAGCAGCAAGTACC
AGTTCTTCCTTTCACTTTCCAATCTCATCACCTTCCACCGTCAGCTCAAC
AACAACTTCATCAACAACGACAACCACAACTGCTTTACGTAAAAGCTCAT
CTAACTCATTTGACAATGGAATTATAAATAGTATTGTTTCTGATAAGGGA
TTTTTAACCTCACCCTTGGACAGTAATAGTCAATTCATGAAAACATGGCA
AGAACTACAGGATATGGATTTGagtgaaattgagaaaaatgtcCTTGGAC
CTAAAGATCAAGATTCCCGAAACACTCCATTAGCAGATACTCCATTTTCA
AACCCTACTACACCAACAGAAATGAATGGGCTGCCACCAAAACCAATTGA
TTCTAACTTGAATAACATTGTTAATTCTCTACCTGAAAACTCTCTGGATT
TAAATAAGCATTccattgaaacaaaagaatctttACAAATAACAAACACT
GAAGATACACCACCACAACAGAATCTATTGAATCATCCAAGAAATTTATT
ATCAGTATCTCAAACAGCTCAAGCTAGCTCCAATTATACAAACACCAGTG
TAACGCAATCAGACATAAACTTGACACATGTATCAGAAAATTTACTTACC
CATAATAGGTCTTGCGTTTCTTCATTTGTTTCGCCTACGTCATCAGATTT
GTATTGCAATCAAGATTTTGATAAGCAATCAAAACGAGGAGATGATATCA
AGCATGAAGAATATTCTAATGAACTTCAAAGCAATCACTCAAAATCATAT
GAAAAACAATCATCATCTTCACCTAcaacattaaaacaaaaatcaaaaca
atcatttAGTAGTATTGAAAGTTTCCTTGGTATGAGCAGCGATAGTAAAA
AAACTGAAGATAATGATAATGAAAGGATTAATGACACCACTAAAAAGCGA
GAAAGGATCCCATCAAGTGATGTACAAGATCGAATTTCAGTCATAAAACC
ATTACCAATTTCATCACCACAAATTTCAAACACATCCTCTCCTTTGGATA
TTGTGAATAATGATCATGACACATTGAAAAGTCCACAAGCAATTGAAAAG
CTGAAATCTcctgaagaaattcaaaaagtaaTAGATCATTCTGAATCTGC
ACCTGTCACACTCATCCATCCATCTATGCGCCTCAAAAAGCAAAGAAGTC
TATCAAACAGTTCAATGACTGCCACCAGTCCACAACCCGTTATGGAAaag
gaaaaaccaaaaacaagtAATAGACGACCGTTACATCCTTCTATGCGATT
ACAGACcaataaaaataatacaaaagTTGATAAAGCTGAACCTAAAAAGA
GTAAGGTTGAAAATCTTGATAACAGTTTTGACAGTGGAAAGAATATCTTA
CACAGTCCAAAAACTGGGCGTTATCAATCTGAACTTACAAGTACTTCCAC
CAAATCTTCAACTAGGAAGTTATCTCCGTTCACTCCTCCAACTGTTACAT
CACCTTTAACCTCACCACCACTAGTATCACCTGGAATTCGAAGTCCCTTC
AATGGAAAACCCCTCACTGGAAAACCATTCTCAACTGGTAAGCCTGTTCA
TGGAGGAAAACCAGCATCTTATTCAGCTCAAGGTGGTGGTAAACCAATGC
ATATGGGAGGGAAACCGACTAGTTTCTCTTCACATATGACTGTCAAAGAG
GAAAAGTCACCAGAAAAAGAGCACACTGGCAAACCTTTATCTTTTTTGAA
GTCCATGGTAgaagaatcttccaaaaacaCAAACACACTTCAAGGGAAAA
AGATCACTGGCAAGAAAAGACCCAGAAAGGAAACTATCGAGAAACCAGCt
tcaaaagaaactttaaaaaaagatgACATATCAAAATCCCCTGACTTGAA
AACAAGTCGTATAACAAAAATGATATCAACCCCACCAAGCTCACAAAAAT
TGACAGATAATATCAAGACTAAGAAACCACCACAAGAAAAACAGGCACCT
GTTAAAAAACTACCTGTCAAAAGGTCTCCAAAAGTATCACCTCCCAAGAG
AGAAGCTGTAAAAGATTCACCACTGAAAGAAAATCCTTTTAGAAAATCTA
TCGTCCAAGCAAAGAGTAAACCAGTActgacaaaacagaaaaatttgaGT
AAAGAGAATATTGAAGAATTGAGCACAAGTGAGGAAAAAGATTCCCCAAA
GAAGacattcaaattcaaagggaTCACATTTGATGCCAAGACTGAAGATG
ATGATAGCAGTGATTCTGATTCAGACAGCTCATCAAATTCTGATTcagGG
TCGTCAAGTGATAGCAGTGACAACAGTGGAacagaagaagaaattgaaga
taTTGAAGACGAAGACGATGACGATACTGCATCTCAAACAAGTTCAGTTA
CAAGCTCTCCTGCAAAGAAAACACAAAGAGCTGGTCAAAAACGAAAAGCA
GTTCCTGACAATGCAGAGGtGATTGCCAGTTTGAAGAAACGAAAAGTTGT
TGATTTGGATTTGATAAAAGCGCCATTAAAATTTggATGGAGAAGGCAGA
CAAGACTCAGACCGAACAATGCTGGTGATGGGCTGAGGGGAGATGTTTAT
TATTATTCACCTTGTGGGAAAAAGCTGAGGACGTATCCTGAGTTAAACAG
TtACATCTTTCGAAATGATGTCGTTGATGTAGACTTGAAGAATTTCAGCT
TTTCAACCAAACTTCGTGTTGGCGAATTCATGCAGGCTAAGGATGGTTCA
AAGTTTGTGACACTGACTGAAGAAGAGATCGATGAAACATTTGTTATGAT
GGAAGAAAGGAGAAGTGCTTCTGCAAAAAGAGCTGaagaaaagaagagag
aaaaacgTGAAAAGGAGGAGAAGCAACGTCAGATACTTGAGGAGAGAAAA
AAGAAGAGAGAAGAAGCCTTGGAAAGAAAGAGATCGAAAGAAGAAGAAAG
GAGAAAGGTTCAAAAAGACAAAGCATTGGAAGCAAAGATGAAGAAGGAGA
AAGAAAAGGAAGCAGCACAAGAAGCCAAACGATTGAAAGAGGAGGCAATA
ATGTTGAAGAAACTAGAAAGGCAAGCTCAAATGGAAGCAAGTCGAATTGC
CAAGCGTGAGAAAGTTCAAAATATGTTGGCTGAAAAGCAGAAGATGAAAG
AACAAAGAGAACATGAACGAGTCATGAAGATTGAGAACCAAAAAGTGgag
aaagaaatgaaattacAAGCAATCGAAAATgaGAAGGAACGTAAAAGGCT
GCAACAAGTGAAAAGTAAAGTATCAGAAAAAGAAAAGCGAAAACGAGAGC
TGGTCATGATGAAAGCTTATGAAGCACAACGGAGAGCTGAGGAGAGAGAA
CGCCTCAAAGAACAAAAGAAGCTGGAGAAAACCTTGATCAGGCAACGAAA
ATTGGAACAGAAAAGATATGAGCGCATGATCtctaaagaattgaaaaaac
ctATCGATGATATGGCTCTGAATGATTTGAAGCCGTTGCCAGAGTTACCA
AGGGTAACCAACATCAACATTCCTGGCAAAGCATATGCAGATATCCTGAT
GGTTCAAGAGTTTGTTCACGCCTTTGGTCATGTCATTGATATCGATCCAG
AGAAGGAGTTTCCAAGCATGGGAGAGTTGCAATCATCATTGTTGTGTGAA
TCTGGTAGCGATGAAGCAATCTTCACTGCATGCCAAGCACTTCTTTTTTA
CGCCCTCTACGATCCCGGTGTATCTGGGCCTTATGCCAAAACTTCACTGG
GTTCAGACCTTACGAGTATCGAATTGAACGAGAACAACATATCAGAAGTA
TTACGTCTTTTCATCTTATCACGTAATGAAGGAAAACAACACACACTCAG
TGATCAGCTCACCAAATATCCTTTAGAAGCTCTCTCACCCAGTAGTAAAG
CTGCTGTTCTAGCTTTCATTGTCAACGAACTGCTTTGTGGAAAATCAGTT
AGCAGAGAGATTGACGGTAGCTTggagaacatttcaaatatgCGAAGGGA
TAAATGGAACCTGGAAGGAGATATACGGAAaTTGAAAGCTGATCTATTAT
CAAAGCAACCCAAGAAAGCAGCCAGTGATCAACAACAGAAcctaaaaaac
aacaaaggaGAGTCGAAGAAAAGAGACTCTGACGAGGAGAACAATTCGGA
CGATGAAGGAACCACTATCACCACTGCTAAGGAGAGCAATATCGATTTAA
ACGACACTGCGGAAGACACAGAAGCTGAAAACCAGCCAGAGATGGTGAAT
CCTACTACACTCGACCAAATGGAGAAGAAACTACGTTTGATGGAAAAGAA
ACACGCTCGCTACCGTAAAAAGTTGTTCGATTCTTCACACACGATACGTG
GTATAAATTTGGGTCAAGATCGATACCGGCGCCGTTATTTCGTGCTTCCG
AACGCCGGAGGGATTTACGTCGAAGGGCTGGAAAGTGGATTTTTTGACGA
AGAAACGAACGTGAAAACAAAGGAAGAAAAGGAAGAATGCAAAGAACATT
TAGATAGTTTACTGACCACCTTGAAATCTCCAACTGTGTTGAAATCCCCT
GTGACTGGCCCCAAAACACCGGCCACAAATACACCGTCTGTATCAGCATT
ATCCTCAAATTCAAACGAACTTTTAAAACCGAAACAAGAGAGTCCTATAc
aaacacaacaacaacaaaaacagataaaagtTGAGAATCCTTGTTCAAGT
GATAGTAGTTATGTCAAATCTTGGTTTTCCTTACGGACTAAAAAACGTTG
CGAGTCTTACAAAACTTCAGCTATACGTGAAACGCCTAAAGAGCGCAAAC
ATTCGCTCATCGTTGCACCGAGGATAGAACGACTTGCCGACGACCACCAA
TTCTTAGAATCTATATACTCTTGTTATTCCACTACTTCTCCTGGTGGGAA
AAACACTTTATTACCTGTCAGCAGATTTCCCTTATCCAAGGAAAGTATGC
ATCGGAACTCGTTACTAGGCTTACCGGCTGAATTGGATATGAATTTACTT
ATACAACAAGACCCACAAAAAGCAGCGGAAATTCTTGAAATACAGACTGC
CAAGCCTCAAGAAATTCCGCCTGAAATGCAGGCGGGTTGGTGGCGGATCA
CCGATCCAGAACAAATGCAGCGCCTGAACAAGTGCGCCCACGCCAGGGGT
ATGAGAGAACGGAACCTTCAAAAGACGGTGGTGCGATTCCAAGACTACAC
CAACTCATCGTGTAAAGTTGACCATCTTGCATtttctcTACTTCTCCCCG
ACGAAGAAAGTGAAAGCAAAGACAAAGTAACAGAAGACGACAGCAGCGTT
GCCACATCAACGGATACAAACAAATCGATACAAGATAAATGGTATCCACA
GCTGGCGTATGCAAGTGACAAAGCCATTTTGATTGAAGTCGAAGAATTAG
AGGAAAAGGTCTTCTCGGCTAGTTTGCAAGTCAAGGGCTGGCGTTTGTCT
CAAAAGATCTCTCCAGCACTTCTGCTGAGCACGAGTAACGATCAAGCTGA
GTATGATCCACCCGAAGATAAATATCCCATCAGGATAGCGGCTTCCCGTC
TCCTAGCTCTTGAGCTCGGTATCGAACGACGTTACATGAAGCCTCCATTC
CGTACACCAGACAGCCTTCCTAAACCGGACGCCCCAGAGGCTAAAGAAGA
ACCAGTCAAGAATCCAAAAGCAACAGCCCAACTGGAGAAATGGCGTGAAG
CAGTAAGCGAAGCAAAATCGTCAGCTCAGCTATCGATGTGTATCACAGCA
CTCTTCGAATGTGTCGCTTGGGAGAAGTCCATCATGAAAGTGTTCTGCAT
ACTATGTCGTAAAAGTGACAACGAAGAAAGATTGTTGCTATGCGACGCAT
GTGATCGAGGCTGTCATACGTATTGTTGTAAGCCGAAATTCGATAAGATT
CCCGATGGTGACTGGTTTTGTCAAGATTGTGTGTTGATGGCGTCTGGTAG
TGATCAGTGCTACAAATGTAAATCGAAGACCGGACGACGTCTGAAATGTG
CATTCTGTCCACGTCATTATCACATGGACTGCCTTGAACCACCATTACAC
AAaACACCTCGTTCGCCTTGGAGTTGTCCCGTCTGCAAGAAAACACGCTC
CAAGAGTAAACCTCCTCAACGTAAAAAACCACGCGCCGAAGAACTTCTCA
AGAAAGAGGAACAGAGCAAACAAAAATCCATGTCCAACAGCCGTGTGCAG
ACGTCCAAAGACATGGAACCGTGTCGTTTCATATTGAACGAAATGGAAAA
TCACGAATCGTCATGGCCCTTTCTCGTCCCTGTCAATATGAAGCAGTTTC
CAGAGTATTATAAAGTGATCAAGCATCCGATGGATTTCCATACCATGAAA
ACGAAGCTGCGTGATTACCAATACAAGTCAAAAGAAGAGTTCGCACGTGA
CGCGCGGTTGGTGTTTTTCAATTGTAAAACGTACAACGAAGACGAATCGG
AGGTTGGATGTGCAGGTGAAGCGATGCGAagtttcttcgagaaacgttgG
ACCGCCCTCAAAAAGGGTGTCTCTTCCACAAACAGTGATAACAAATTCCA
CACCAACAAGAAGGGGGAGGGTGTGGAATCATCAGGCGATGAAGGAGAAG
ACGCTCAGGAGGAGGGTGAAGGCGATGAAGAAGTATCCAGTTCGAGTTCT
GAAGAAATCTCATCCGAAAGTGAGAGCAGCGAAGTGGAGGAGGACAGTGA
AAACGAGACCGACTCAAAAACATGAATGGACAATCGTTCCGGTGGTCAAG
GCAACCCATATGATCGACCTTACTATGGGGACCCAAATGTCTTGAGACAA
CAAATTCCTGGGTATGCTAACTCTCCTGGAATTTATCCATATTCCCAGCA
GCAGCAACAAGATGGTTTTTCAGGGCGACGACCAGGGCAAGACCAGCTTG
GTCTCAATAATCATGCTACCGCCAGAACCAACAGCTTGACTTCACCTCCA
CAATCAACCAATCCTTGGATGCACTCTTACCACAATCAAACACAACCAAA
TTCTATGAGCCCTAATTTCAATATGAACATACCGAATATGTTTCATACAA
GGTGGGAACAAGACCAAGCCTCACTTCTACAACAAAGAGAAATGATGCAA
AGAGAAGAACATGCAAGGATGATGTATCGAGAGCGCTTGCAAATGCAAGA
GAGAGAAAATCAGTTGAAAATCCAGATGCAGAAGGAGCAAGAGCGAGAGT
TGCAACTTCAGCGTGAAAAAGAAGCACAACTTCAGCGTGAAAGGGAAGCA
AAGGTTCAAAGAGAACGTGAAGCCCAATTAGAAAGAGAGCGACAAGCTCA
ACTTCAAAGAGAACGACAAGCTGCTCTGGAGAAAGAAAGACAGCTACAGT
TGCAGAGGGAAAGAGAAGCTCAATTACAAAGAGAAGCTCAATTACAATAT
CAGATGCAAAGAGAAATGCAACTTGAAAGAGAAAGAGAAGCAATGGCAAT
AAGAGAAAGAGATGCAATCCTTGAACGAGATAGAAAAGCAATGCTCTACA
GAGATGCTTATTTTGCACAACAACATCAACCACAGCAATttccaaaccat
tttggttccaTGCAAAATACATTGCCTAATTTGAATTTCACACAATCCAA
TGAGTCAATGTCTAATCAATTTAACTTCTATAACCAGCCCAGTATGCATT
CAAATGGTAATCTTCCTAGCAGTACATCGTCTTCTATACTAAACTTCTCA
ATGGATCAAATTTTCAACCCTAATAAGATATCTGAGTCACCTGTCTCCAA
AGCAGCAAGTACCAGTTCTTCCTTTCACTTTCCAATCTCATCACCTTCCA
CCGTCAGCTCAACAACAACTTCATCAACAACGACAACCACAACTGCTTTA
CGTAAAAGCTCATCTAACTCATTTGACAATGGAATTATAAATAGTATTGT
TTCTGATAAGGGATTTTTAACCTCACCCTTGGACAGTAATAGTCAATTCA
TGAAAACATGGCAAGAACTACAGGATATGGATTTGagtgaaattgagaaa
aatgtcCTTGGACCTAAAGATCAAGATTCCCGAAACACTCCATTAGCAGA
TACTCCATTTTCAAACCCTACTACACCAACAGAAATGAATGGGCTGCCAC
CAAAACCAATTGATTCTAACTTGAATAACATTGTTAATTCTCTACCTGAA
AACTCTCTGGATTTAAATAAGCATTccattgaaacaaaagaatctttACA
AATAACAAACACTGAAGATACACCACCACAACAGAATCTATTGAATCATC
CAAGAAATTTATTATCAGTATCTCAAACAGCTCAAGCTAGCTCCAATTAT
ACAAACACCAGTGTAACGCAATCAGACATAAACTTGACACATGTATCAGA
AAATTTACTTACCCATAATAGGTCTTGCGTTTCTTCATTTGTTTCGCCTA
CGTCATCAGATTTGTATTGCAATCAAGATTTTGATAAGCAATCAAAACGA
GGAGATGATATCAAGCATGAAGAATATTCTAATGAACTTCAAAGCAATCA
CTCAAAATCATATGAAAAACAATCATCATCTTCACCTAcaacattaaaac
aaaaatcaaaacaatcatttAGTAGTATTGAAAGTTTCCTTGGTATGAGC
AGCGATAGTAAAAAAACTGAAGATAATGATAATGAAAGGATTAATGACAC
CACTAAAAAGCGAGAAAGGATCCCATCAAGTGATGTACAAGATCGAATTT
CAGTCATAAAACCATTACCAATTTCATCACCACAAATTTCAAACACATCC
TCTCCTTTGGATATTGTGAATAATGATCATGACACATTGAAAAGTCCACA
AGCAATTGAAAAGCTGAAATCTcctgaagaaattcaaaaagtaaTAGATC
ATTCTGAATCTGCACCTGTCACACTCATCCATCCATCTATGCGCCTCAAA
AAGCAAAGAAGTCTATCAAACAGTTCAATGACTGCCACCAGTCCACAACC
CGTTATGGAAaaggaaaaaccaaaaacaagtAATAGACGACCGTTACATC
CTTCTATGCGATTACAGACcaataaaaataatacaaaagTTGATAAAGCT
GAACCTAAAAAGAGTAAGGTTGAAAATCTTGATAACAGTTTTGACAGTGG
AAAGAATATCTTACACAGTCCAAAAACTGGGCGTTATCAATCTGAACTTA
CAAGTACTTCCACCAAATCTTCAACTAGGAAGTTATCTCCGTTCACTCCT
CCAACTGTTACATCACCTTTAACCTCACCACCACTAGTATCACCTGGAAT
TCGAAGTCCCTTCAATGGAAAACCCCTCACTGGAAAACCATTCTCAACTG
GTAAGCCTGTTCATGGAGGAAAACCAGCATCTTATTCAGCTCAAGGTGGT
GGTAAACCAATGCATATGGGAGGGAAACCGACTAGTTTCTCTTCACATAT
GACTGTCAAAGAGGAAAAGTCACCAGAAAAAGAGCACACTGGCAAACCTT
TATCTTTTTTGAAGTCCATGGTAgaagaatcttccaaaaacaCAAACACA
CTTCAAGGGAAAAAGATCACTGGCAAGAAAAGACCCAGAAAGGAAACTAT
CGAGAAACCAGCttcaaaagaaactttaaaaaaagatgACATATCAAAAT
CCCCTGACTTGAAAACAAGTCGTATAACAAAAATGATATCAACCCCACCA
AGCTCACAAAAATTGACAGATAATATCAAGACTAAGAAACCACCACAAGA
AAAACAGGCACCTGTTAAAAAACTACCTGTCAAAAGGTCTCCAAAAGTAT
CACCTCCCAAGAGAGAAGCTGTAAAAGATTCACCACTGAAAGAAAATCCT
TTTAGAAAATCTATCGTCCAAGCAAAGAGTAAACCAGTActgacaaaaca
gaaaaatttgaGTAAAGAGAATATTGAAGAATTGAGCACAAGTGAGGAAA
AAGATTCCCCAAAGAAGacattcaaattcaaagggaTCACATTTGATGCC
AAGACTGAAGATGATGATAGCAGTGATTCTGATTCAGACAGCTCATCAAA
TTCTGATTcagGGTCGTCAAGTGATAGCAGTGACAACAGTGGAacagaag
aagaaattgaagataTTGAAGACGAAGACGATGACGATACTGCATCTCAA
ACAAGTTCAGTTACAAGCTCTCCTGCAAAGAAAACACAAAGAGCTGGTCA
AAAACGAAAAGCAGTTCCTGACAATGCAGAGGtGATTGCCAGTTTGAAGA
AACGAAAAGTTGTTGATTTGGATTTGATAAAAGCGCCATTAAAATTTggA
TGGAGAAGGCAGACAAGACTCAGACCGAACAATGCTGGTGATGGGCTGAG
GGGAGATGTTTATTATTATTCACCTTGTGGGAAAAAGCTGAGGACGTATC
CTGAGTTAAACAGTtACATCTTTCGAAATGATGTCGTTGATGTAGACTTG
AAGAATTTCAGCTTTTCAACCAAACTTCGTGTTGGCGAATTCATGCAGGC
TAAGGATGGTTCAAAGTTTGTGACACTGACTGAAGAAGAGATCGATGAAA
CATTTGTTATGATGGAAGAAAGGAGAAGTGCTTCTGCAAAAAGAGCTGaa
gaaaagaagagagaaaaacgTGAAAAGGAGGAGAAGCAACGTCAGATACT
TGAGGAGAGAAAAAAGAAGAGAGAAGAAGCCTTGGAAAGAAAGAGATCGA
AAGAAGAAGAAAGGAGAAAGGTTCAAAAAGACAAAGCATTGGAAGCAAAG
ATGAAGAAGGAGAAAGAAAAGGAAGCAGCACAAGAAGCCAAACGATTGAA
AGAGGAGGCAATAATGTTGAAGAAACTAGAAAGGCAAGCTCAAATGGAAG
CAAGTCGAATTGCCAAGCGTGAGAAAGTTCAAAATATGTTGGCTGAAAAG
CAGAAGATGAAAGAACAAAGAGAACATGAACGAGTCATGAAGATTGAGAA
CCAAAAAGTGgagaaagaaatgaaattacAAGCAATCGAAAATgaGAAGG
AACGTAAAAGGCTGCAACAAGTGAAAAGTAAAGTATCAGAAAAAGAAAAG
CGAAAACGAGAGCTGGTCATGATGAAAGCTTATGAAGCACAACGGAGAGC
TGAGGAGAGAGAACGCCTCAAAGAACAAAAGAAGCTGGAGAAAACCTTGA
TCAGGCAACGAAAATTGGAACAGAAAAGATATGAGCGCATGATCtctaaa
gaattgaaaaaacctATCGATGATATGGCTCTGAATGATTTGAAGCCGTT
GCCAGAGTTACCAAGGGTAACCAACATCAACATTCCTGGCAAAGCATATG
CAGATATCCTGATGGTTCAAGAGTTTGTTCACGCCTTTGGTCATGTCATT
GATATCGATCCAGAGAAGGAGTTTCCAAGCATGGGAGAGTTGCAATCATC
ATTGTTGTGTGAATCTGGTAGCGATGAAGCAATCTTCACTGCATGCCAAG
CACTTCTTTTTTACGCCCTCTACGATCCCGGTGTATCTGGGCCTTATGCC
AAAACTTCACTGGGTTCAGACCTTACGAGTATCGAATTGAACGAGAACAA
CATATCAGAAGTATTACGTCTTTTCATCTTATCACGTAATGAAGGAAAAC
AACACACACTCAGTGATCAGCTCACCAAATATCCTTTAGAAGCTCTCTCA
CCCAGTAGTAAAGCTGCTGTTCTAGCTTTCATTGTCAACGAACTGCTTTG
TGGAAAATCAGTTAGCAGAGAGATTGACGGTAGCTTggagaacatttcaa
atatgCGAAGGGATAAATGGAACCTGGAAGGAGATATACGGAAaTTGAAA
GCTGATCTATTATCAAAGCAACCCAAGAAAGCAGCCAGTGATCAACAACA
GAAcctaaaaaacaacaaaggaGAGTCGAAGAAAAGAGACTCTGACGAGG
AGAACAATTCGGACGATGAAGGAACCACTATCACCACTGCTAAGGAGAGC
AATATCGATTTAAACGACACTGCGGAAGACACAGAAGCTGAAAACCAGCC
AGAGATGGTGAATCCTACTACACTCGACCAAATGGAGAAGAAACTACGTT
TGATGGAAAAGAAACACGCTCGCTACCGTAAAAAGTTGTTCGATTCTTCA
CACACGATACGTGGTATAAATTTGGGTCAAGATCGATACCGGCGCCGTTA
TTTCGTGCTTCCGAACGCCGGAGGGATTTACGTCGAAGGGCTGGAAAGTG
GATTTTTTGACGAAGAAACGAACGTGAAAACAAAGGAAGAAAAGGAAGAA
TGCAAAGAACATTTAGATAGTTTACTGACCACCTTGAAATCTCCAACTGT
GTTGAAATCCCCTGTGACTGGCCCCAAAACACCGGCCACAAATACACCGT
CTGTATCAGCATTATCCTCAAATTCAAACGAACTTTTAAAACCGAAACAA
GAGAGTCCTATAcaaacacaacaacaacaaaaacagataaaagtTGAGAA
TCCTTGTTCAAGTGATAGTAGTTATGTCAAATCTTGGTTTTCCTTACGGA
CTAAAAAACGTTGCGAGTCTTACAAAACTTCAGCTATACGTGAAACGCCT
AAAGAGCGCAAACATTCGCTCATCGTTGCACCGAGGATAGAACGACTTGC
CGACGACCACCAATTCTTAGAATCTATATACTCTTGTTATTCCACTACTT
CTCCTGGTGGGAAAAACACTTTATTACCTGTCAGCAGATTTCCCTTATCC
AAGGAAAGTATGCATCGGAACTCGTTACTAGGCTTACCGGCTGAATTGGA
TATGAATTTACTTATACAACAAGACCCACAAAAAGCAGCGGAAATTCTTG
AAATACAGACTGCCAAGCCTCAAGAAATTCCGCCTGAAATGCAGGCGGGT
TGGTGGCGGATCACCGATCCAGAACAAATGCAGCGCCTGAACAAGTGCGC
CCACGCCAGGGGTATGAGAGAACGGAACCTTCAAAAGACGGTGGTGCGAT
TCCAAGACTACACCAACTCATCGTGTAAAGTTGACCATCTTGCATtttct
cTACTTCTCCCCGACGAAGAAAGTGAAAGCAAAGACAAAGTAACAGAAGA
CGACAGCAGCGTTGCCACATCAACGGATACAAACAAATCGATACAAGATA
AATGGTATCCACAGCTGGCGTATGCAAGTGACAAAGCCATTTTGATTGAA
GTCGAAGAATTAGAGGAAAAGGTCTTCTCGGCTAGTTTGCAAGTCAAGGG
CTGGCGTTTGTCTCAAAAGATCTCTCCAGCACTTCTGCTGAGCACGAGTA
ACGATCAAGCTGAGTATGATCCACCCGAAGATAAATATCCCATCAGGATA
GCGGCTTCCCGTCTCCTAGCTCTTGAGCTCGGTATCGAACGACGTTACAT
GAAGCCTCCATTCCGTACACCAGACAGCCTTCCTAAACCGGACGCCCCAG
AGGCTAAAGAAGAACCAGTCAAGAATCCAAAAGCAACAGCCCAACTGGAG
AAATGGCGTGAAGCAGTAAGCGAAGCAAAATCGTCAGCTCAGCTATCGAT
GTGTATCACAGCACTCTTCGAATGTGTCGCTTGGGAGAAGTCCATCATGA
AAGTGTTCTGCATACTATGTCGTAAAAGTGACAACGAAGAAAGATTGTTG
CTATGCGACGCATGTGATCGAGGCTGTCATACGTATTGTTGTAAGCCGAA
ATTCGATAAGATTCCCGATGGTGACTGGTTTTGTCAAGATTGTGTGTTGA
TGGCGTCTGGTAGTGATCAGTGCTACAAATGTAAATCGAAGACCGGACGA
CGTCTGAAATGTGCATTCTGTCCACGTCATTATCACATGGACTGCCTTGA
ACCACCATTACACAAaACACCTCGTTCGCCTTGGAGTTGTCCCGTCTGCA
AGAAAACACGCTCCAAGAGTAAACCTCCTCAACGTAAAAAACCACGCGCC
GAAGAACTTCTCAAGAAAGAGGAACAGAGCAAACAAAAATCCATGTCCAA
CAGCCGTGTGCAGACGTCCAAAGACATGGAACCGTGTCGTTTCATATTGA
ACGAAATGGAAAATCACGAATCGTCATGGCCCTTTCTCGTCCCTGTCAAT
ATGAAGCAGTTTCCAGAGTATTATAAAGTGATCAAGCATCCGATGGATTT
CCATACCATGAAAACGAAGCTGCGTGATTACCAATACAAGTCAAAAGAAG
AGTTCGCACGTGACGCGCGGTTGGTGTTTTTCAATTGTAAAACGTACAAC
GAAGACGAATCGGAGGTTGGATGTGCAGGTGAAGCGATGCGAagtttctt
cgagaaacgttgGACCGCCCTCAAAAAGGGTGTCTCTTCCACAAACAGTG
ATAACAAATTCCACACCAACAAGAAGGGGGAGGGTGTGGAATCATCAGGC
GATGAAGGAGAAGACGCTCAGGAGGAGGGTGAAGGCGATGAAGAAGTATC
CAGTTCGAGTTCTGAAGAAATCTCATCCGAAAGTGAGAGCAGCGAAGTGG
AGGAGGACAGTGAAAACGAGACCGACTCAAAAACATGAATGGACAATCGT
TCCGGTGGTCAAGGCAACCCATATGATCGACCTTACTATGGGGACCCAAA
TGTCTTGAGACAACAAATTCCTGGGTATGCTAACTCTCCTGGAATTTATC
CATATTCCCAGCAGCAGCAACAAGATGGTTTTTCAGGGCGACGACCAGGG
CAAGACCAGCTTGGTCTCAATAATCATGCTACCGCCAGAACCAACAGCTT
GACTTCACCTCCACAATCAACCAATCCTTGGATGCACTCTTACCACAATC
AAACACAACCAAATTCTATGAGCCCTAATTTCAATATGAACATACCGAAT
ATGTTTCATACAAGGTGGGAACAAGACCAAGCCTCACTTCTACAACAAAG
AGAAATGATGCAAAGAGAAGAACATGCAAGGATGATGTATCGAGAGCGCT
TGCAAATGCAAGAGAGAGAAAATCAGTTGAAAATCCAGATGCAGAAGGAG
CAAGAGCGAGAGTTGCAACTTCAGCGTGAAAAAGAAGCACAACTTCAGCG
TGAAAGGGAAGCAAAGGTTCAAAGAGAACGTGAAGCCCAATTAGAAAGAG
AGCGACAAGCTCAACTTCAAAGAGAACGACAAGCTGCTCTGGAGAAAGAA
AGACAGCTACAGTTGCAGAGGGAAAGAGAAGCTCAATTACAAAGAGAAGC
TCAATTACAATATCAGATGCAAAGAGAAATGCAACTTGAAAGAGAAAGAG
AAGCAATGGCAATAAGAGAAAGAGATGCAATCCTTGAACGAGATAGAAAA
GCAATGCTCTACAGAGATGCTTATTTTGCACAACAACATCAACCACAGCA
ATttccaaaccattttggttccaTGCAAAATACATTGCCTAATTTGAATT
TCACACAATCCAATGAGTCAATGTCTAATCAATTTAACTTCTATAACCAG
CCCAGTATGCATTCAAATGGTAATCTTCCTAGCAGTACATCGTCTTCTAT
ACTAAACTTCTCAATGGATCAAATTTTCAACCCTAATAAGATATCTGAGT
CACCTGTCTCCAAAGCAGCAAGTACCAGTTCTTCCTTTCACTTTCCAATC
TCATCACCTTCCACCGTCAGCTCAACAACAACTTCATCAACAACGACAAC
CACAACTGCTTTACGTAAAAGCTCATCTAACTCATTTGACAATGGAATTA
TAAATAGTATTGTTTCTGATAAGGGATTTTTAACCTCACCCTTGGACAGT
AATAGTCAATTCATGAAAACATGGCAAGAACTACAGGATATGGATTTGag
tgaaattgagaaaaatgtcCTTGGACCTAAAGATCAAGATTCCCGAAACA
CTCCATTAGCAGATACTCCATTTTCAAACCCTACTACACCAACAGAAATG
AATGGGCTGCCACCAAAACCAATTGATTCTAACTTGAATAACATTGTTAA
TTCTCTACCTGAAAACTCTCTGGATTTAAATAAGCATTccattgaaacaa
aagaatctttACAAATAACAAACACTGAAGATACACCACCACAACAGAAT
CTATTGAATCATCCAAGAAATTTATTATCAGTATCTCAAACAGCTCAAGC
TAGCTCCAATTATACAAACACCAGTGTAACGCAATCAGACATAAACTTGA
CACATGTATCAGAAAATTTACTTACCCATAATAGGTCTTGCGTTTCTTCA
TTTGTTTCGCCTACGTCATCAGATTTGTATTGCAATCAAGATTTTGATAA
GCAATCAAAACGAGGAGATGATATCAAGCATGAAGAATATTCTAATGAAC
TTCAAAGCAATCACTCAAAATCATATGAAAAACAATCATCATCTTCACCT
AcaacattaaaacaaaaatcaaaacaatcatttAGTAGTATTGAAAGTTT
CCTTGGTATGAGCAGCGATAGTAAAAAAACTGAAGATAATGATAATGAAA
GGATTAATGACACCACTAAAAAGCGAGAAAGGATCCCATCAAGTGATGTA
CAAGATCGAATTTCAGTCATAAAACCATTACCAATTTCATCACCACAAAT
TTCAAACACATCCTCTCCTTTGGATATTGTGAATAATGATCATGACACAT
TGAAAAGTCCACAAGCAATTGAAAAGCTGAAATCTcctgaagaaattcaa
aaagtaaTAGATCATTCTGAATCTGCACCTGTCACACTCATCCATCCATC
TATGCGCCTCAAAAAGCAAAGAAGTCTATCAAACAGTTCAATGACTGCCA
CCAGTCCACAACCCGTTATGGAAaaggaaaaaccaaaaacaagtAATAGA
CGACCGTTACATCCTTCTATGCGATTACAGACcaataaaaataatacaaa
agTTGATAAAGCTGAACCTAAAAAGAGTAAGGTTGAAAATCTTGATAACA
GTTTTGACAGTGGAAAGAATATCTTACACAGTCCAAAAACTGGGCGTTAT
CAATCTGAACTTACAAGTACTTCCACCAAATCTTCAACTAGGAAGTTATC
TCCGTTCACTCCTCCAACTGTTACATCACCTTTAACCTCACCACCACTAG
TATCACCTGGAATTCGAAGTCCCTTCAATGGAAAACCCCTCACTGGAAAA
CCATTCTCAACTGGTAAGCCTGTTCATGGAGGAAAACCAGCATCTTATTC
AGCTCAAGGTGGTGGTAAACCAATGCATATGGGAGGGAAACCGACTAGTT
TCTCTTCACATATGACTGTCAAAGAGGAAAAGTCACCAGAAAAAGAGCAC
ACTGGCAAACCTTTATCTTTTTTGAAGTCCATGGTAgaagaatcttccaa
aaacaCAAACACACTTCAAGGGAAAAAGATCACTGGCAAGAAAAGACCCA
GAAAGGAAACTATCGAGAAACCAGCttcaaaagaaactttaaaaaaagat
gACATATCAAAATCCCCTGACTTGAAAACAAGTCGTATAACAAAAATGAT
ATCAACCCCACCAAGCTCACAAAAATTGACAGATAATATCAAGACTAAGA
AACCACCACAAGAAAAACAGGCACCTGTTAAAAAACTACCTGTCAAAAGG
TCTCCAAAAGTATCACCTCCCAAGAGAGAAGCTGTAAAAGATTCACCACT
GAAAGAAAATCCTTTTAGAAAATCTATCGTCCAAGCAAAGAGTAAACCAG
TActgacaaaacagaaaaatttgaGTAAAGAGAATATTGAAGAATTGAGC
ACAAGTGAGGAAAAAGATTCCCCAAAGAAGacattcaaattcaaagggaT
CACATTTGATGCCAAGACTGAAGATGATGATAGCAGTGATTCTGATTCAG
ACAGCTCATCAAATTCTGATTcagGGTCGTCAAGTGATAGCAGTGACAAC
AGTGGAacagaagaagaaattgaagataTTGAAGACGAAGACGATGACGA
TACTGCATCTCAAACAAGTTCAGTTACAAGCTCTCCTGCAAAGAAAACAC
AAAGAGCTGGTCAAAAACGAAAAGCAGTTCCTGACAATGCAGAGGtGATT
GCCAGTTTGAAGAAACGAAAAGTTGTTGATTTGGATTTGATAAAAGCGCC
ATTAAAATTTggATGGAGAAGGCAGACAAGACTCAGACCGAACAATGCTG
GTGATGGGCTGAGGGGAGATGTTTATTATTATTCACCTTGTGGGAAAAAG
CTGAGGACGTATCCTGAGTTAAACAGTtACATCTTTCGAAATGATGTCGT
TGATGTAGACTTGAAGAATTTCAGCTTTTCAACCAAACTTCGTGTTGGCG
AATTCATGCAGGCTAAGGATGGTTCAAAGTTTGTGACACTGACTGAAGAA
GAGATCGATGAAACATTTGTTATGATGGAAGAAAGGAGAAGTGCTTCTGC
AAAAAGAGCTGaagaaaagaagagagaaaaacgTGAAAAGGAGGAGAAGC
AACGTCAGATACTTGAGGAGAGAAAAAAGAAGAGAGAAGAAGCCTTGGAA
AGAAAGAGATCGAAAGAAGAAGAAAGGAGAAAGGTTCAAAAAGACAAAGC
ATTGGAAGCAAAGATGAAGAAGGAGAAAGAAAAGGAAGCAGCACAAGAAG
CCAAACGATTGAAAGAGGAGGCAATAATGTTGAAGAAACTAGAAAGGCAA
GCTCAAATGGAAGCAAGTCGAATTGCCAAGCGTGAGAAAGTTCAAAATAT
GTTGGCTGAAAAGCAGAAGATGAAAGAACAAAGAGAACATGAACGAGTCA
TGAAGATTGAGAACCAAAAAGTGgagaaagaaatgaaattacAAGCAATC
GAAAATgaGAAGGAACGTAAAAGGCTGCAACAAGTGAAAAGTAAAGTATC
AGAAAAAGAAAAGCGAAAACGAGAGCTGGTCATGATGAAAGCTTATGAAG
CACAACGGAGAGCTGAGGAGAGAGAACGCCTCAAAGAACAAAAGAAGCTG
GAGAAAACCTTGATCAGGCAACGAAAATTGGAACAGAAAAGATATGAGCG
CATGATCtctaaagaattgaaaaaacctATCGATGATATGGCTCTGAATG
ATTTGAAGCCGTTGCCAGAGTTACCAAGGGTAACCAACATCAACATTCCT
GGCAAAGCATATGCAGATATCCTGATGGTTCAAGAGTTTGTTCACGCCTT
TGGTCATGTCATTGATATCGATCCAGAGAAGGAGTTTCCAAGCATGGGAG
AGTTGCAATCATCATTGTTGTGTGAATCTGGTAGCGATGAAGCAATCTTC
ACTGCATGCCAAGCACTTCTTTTTTACGCCCTCTACGATCCCGGTGTATC
TGGGCCTTATGCCAAAACTTCACTGGGTTCAGACCTTACGAGTATCGAAT
TGAACGAGAACAACATATCAGAAGTATTACGTCTTTTCATCTTATCACGT
AATGAAGGAAAACAACACACACTCAGTGATCAGCTCACCAAATATCCTTT
AGAAGCTCTCTCACCCAGTAGTAAAGCTGCTGTTCTAGCTTTCATTGTCA
ACGAACTGCTTTGTGGAAAATCAGTTAGCAGAGAGATTGACGGTAGCTTg
gagaacatttcaaatatgCGAAGGGATAAATGGAACCTGGAAGGAGATAT
ACGGAAaTTGAAAGCTGATCTATTATCAAAGCAACCCAAGAAAGCAGCCA
GTGATCAACAACAGAAcctaaaaaacaacaaaggaGAGTCGAAGAAAAGA
GACTCTGACGAGGAGAACAATTCGGACGATGAAGGAACCACTATCACCAC
TGCTAAGGAGAGCAATATCGATTTAAACGACACTGCGGAAGACACAGAAG
CTGAAAACCAGCCAGAGATGGTGAATCCTACTACACTCGACCAAATGGAG
AAGAAACTACGTTTGATGGAAAAGAAACACGCTCGCTACCGTAAAAAGTT
GTTCGATTCTTCACACACGATACGTGGTATAAATTTGGGTCAAGATCGAT
ACCGGCGCCGTTATTTCGTGCTTCCGAACGCCGGAGGGATTTACGTCGAA
GGGCTGGAAAGTGGATTTTTTGACGAAGAAACGAACGTGAAAACAAAGGA
AGAAAAGGAAGAATGCAAAGAACATTTAGATAGTTTACTGACCACCTTGA
AATCTCCAACTGTGTTGAAATCCCCTGTGACTGGCCCCAAAACACCGGCC
ACAAATACACCGTCTGTATCAGCATTATCCTCAAATTCAAACGAACTTTT
AAAACCGAAACAAGAGAGTCCTATAcaaacacaacaacaacaaaaacaga
taaaagtTGAGAATCCTTGTTCAAGTGATAGTAGTTATGTCAAATCTTGG
TTTTCCTTACGGACTAAAAAACGTTGCGAGTCTTACAAAACTTCAGCTAT
ACGTGAAACGCCTAAAGAGCGCAAACATTCGCTCATCGTTGCACCGAGGA
TAGAACGACTTGCCGACGACCACCAATTCTTAGAATCTATATACTCTTGT
TATTCCACTACTTCTCCTGGTGGGAAAAACACTTTATTACCTGTCAGCAG
ATTTCCCTTATCCAAGGAAAGTATGCATCGGAACTCGTTACTAGGCTTAC
CGGCTGAATTGGATATGAATTTACTTATACAACAAGACCCACAAAAAGCA
GCGGAAATTCTTGAAATACAGACTGCCAAGCCTCAAGAAATTCCGCCTGA
AATGCAGGCGGGTTGGTGGCGGATCACCGATCCAGAACAAATGCAGCGCC
TGAACAAGTGCGCCCACGCCAGGGGTATGAGAGAACGGAACCTTCAAAAG
ACGGTGGTGCGATTCCAAGACTACACCAACTCATCGTGTAAAGTTGACCA
TCTTGCATtttctcTACTTCTCCCCGACGAAGAAAGTGAAAGCAAAGACA
AAGTAACAGAAGACGACAGCAGCGTTGCCACATCAACGGATACAAACAAA
TCGATACAAGATAAATGGTATCCACAGCTGGCGTATGCAAGTGACAAAGC
CATTTTGATTGAAGTCGAAGAATTAGAGGAAAAGGTCTTCTCGGCTAGTT
TGCAAGTCAAGGGCTGGCGTTTGTCTCAAAAGATCTCTCCAGCACTTCTG
CTGAGCACGAGTAACGATCAAGCTGAGTATGATCCACCCGAAGATAAATA
TCCCATCAGGATAGCGGCTTCCCGTCTCCTAGCTCTTGAGCTCGGTATCG
AACGACGTTACATGAAGCCTCCATTCCGTACACCAGACAGCCTTCCTAAA
CCGGACGCCCCAGAGGCTAAAGAAGAACCAGTCAAGAATCCAAAAGCAAC
AGCCCAACTGGAGAAATGGCGTGAAGCAGTAAGCGAAGCAAAATCGTCAG
CTCAGCTATCGATGTGTATCACAGCACTCTTCGAATGTGTCGCTTGGGAG
AAGTCCATCATGAAAGTGTTCTGCATACTATGTCGTAAAAGTGACAACGA
AGAAAGATTGTTGCTATGCGACGCATGTGATCGAGGCTGTCATACGTATT
GTTGTAAGCCGAAATTCGATAAGATTCCCGATGGTGACTGGTTTTGTCAA
GATTGTGTGTTGATGGCGTCTGGTAGTGATCAGTGCTACAAATGTAAATC
GAAGACCGGACGACGTCTGAAATGTGCATTCTGTCCACGTCATTATCACA
TGGACTGCCTTGAACCACCATTACACAAaACACCTCGTTCGCCTTGGAGT
TGTCCCGTCTGCAAGAAAACACGCTCCAAGAGTAAACCTCCTCAACGTAA
AAAACCACGCGCCGAAGAACTTCTCAAGAAAGAGGAACAGAGCAAACAAA
AATCCATGTCCAACAGCCGTGTGCAGACGTCCAAAGACATGGAACCGTGT
CGTTTCATATTGAACGAAATGGAAAATCACGAATCGTCATGGCCCTTTCT
CGTCCCTGTCAATATGAAGCAGTTTCCAGAGTATTATAAAGTGATCAAGC
ATCCGATGGATTTCCATACCATGAAAACGAAGCTGCGTGATTACCAATAC
AAGTCAAAAGAAGAGTTCGCACGTGACGCGCGGTTGGTGTTTTTCAATTG
TAAAACGTACAACGAAGACGAATCGGAGGTTGGATGTGCAGGTGAAGCGA
TGCGAagtttcttcgagaaacgttgGACCGCCCTCAAAAAGGGTGTCTCT
TCCACAAACAGTGATAACAAATTCCACACCAACAAGAAGGGGGAGGGTGT
GGAATCATCAGGCGATGAAGGAGAAGACGCTCAGGAGGAGGGTGAAGGCG
ATGAAGAAGTATCCAGTTCGAGTTCTGAAGAAATCTCATCCGAAAGTGAG
AGCAGCGAAGTGGAGGAGGACAGTGAAAACGAGACCGACTCAAAAACATG
AATGGACAATCGTTCCGGTGGTCAAGGCAACCCATATGATCGACCTTACT
ATGGGGACCCAAATGTCTTGAGACAACAAATTCCTGGGTATGCTAACTCT
CCTGGAATTTATCCATATTCCCAGCAGCAGCAACAAGATGGTTTTTCAGG
GCGACGACCAGGGCAAGACCAGCTTGGTCTCAATAATCATGCTACCGCCA
GAACCAACAGCTTGACTTCACCTCCACAATCAACCAATCCTTGGATGCAC
TCTTACCACAATCAAACACAACCAAATTCTATGAGCCCTAATTTCAATAT
GAACATACCGAATATGTTTCATACAAGGTGGGAACAAGACCAAGCCTCAC
TTCTACAACAAAGAGAAATGATGCAAAGAGAAGAACATGCAAGGATGATG
TATCGAGAGCGCTTGCAAATGCAAGAGAGAGAAAATCAGTTGAAAATCCA
GATGCAGAAGGAGCAAGAGCGAGAGTTGCAACTTCAGCGTGAAAAAGAAG
CACAACTTCAGCGTGAAAGGGAAGCAAAGGTTCAAAGAGAACGTGAAGCC
CAATTAGAAAGAGAGCGACAAGCTCAACTTCAAAGAGAACGACAAGCTGC
TCTGGAGAAAGAAAGACAGCTACAGTTGCAGAGGGAAAGAGAAGCTCAAT
TACAAAGAGAAGCTCAATTACAATATCAGATGCAAAGAGAAATGCAACTT
GAAAGAGAAAGAGAAGCAATGGCAATAAGAGAAAGAGATGCAATCCTTGA
ACGAGATAGAAAAGCAATGCTCTACAGAGATGCTTATTTTGCACAACAAC
ATCAACCACAGCAATttccaaaccattttggttccaTGCAAAATACATTG
CCTAATTTGAATTTCACACAATCCAATGAGTCAATGTCTAATCAATTTAA
CTTCTATAACCAGCCCAGTATGCATTCAAATGGTAATCTTCCTAGCAGTA
CATCGTCTTCTATACTAAACTTCTCAATGGATCAAATTTTCAACCCTAAT
AAGATATCTGAGTCACCTGTCTCCAAAGCAGCAAGTACCAGTTCTTCCTT
TCACTTTCCAATCTCATCACCTTCCACCGTCAGCTCAACAACAACTTCAT
CAACAACGACAACCACAACTGCTTTACGTAAAAGCTCATCTAACTCATTT
GACAATGGAATTATAAATAGTATTGTTTCTGATAAGGGATTTTTAACCTC
ACCCTTGGACAGTAATAGTCAATTCATGAAAACATGGCAAGAACTACAGG
ATATGGATTTGagtgaaattgagaaaaatgtcCTTGGACCTAAAGATCAA
GATTCCCGAAACACTCCATTAGCAGATACTCCATTTTCAAACCCTACTAC
ACCAACAGAAATGAATGGGCTGCCACCAAAACCAATTGATTCTAACTTGA
ATAACATTGTTAATTCTCTACCTGAAAACTCTCTGGATTTAAATAAGCAT
TccattgaaacaaaagaatctttACAAATAACAAACACTGAAGATACACC
ACCACAACAGAATCTATTGAATCATCCAAGAAATTTATTATCAGTATCTC
AAACAGCTCAAGCTAGCTCCAATTATACAAACACCAGTGTAACGCAATCA
GACATAAACTTGACACATGTATCAGAAAATTTACTTACCCATAATAGGTC
TTGCGTTTCTTCATTTGTTTCGCCTACGTCATCAGATTTGTATTGCAATC
AAGATTTTGATAAGCAATCAAAACGAGGAGATGATATCAAGCATGAAGAA
TATTCTAATGAACTTCAAAGCAATCACTCAAAATCATATGAAAAACAATC
ATCATCTTCACCTAcaacattaaaacaaaaatcaaaacaatcatttAGTA
GTATTGAAAGTTTCCTTGGTATGAGCAGCGATAGTAAAAAAACTGAAGAT
AATGATAATGAAAGGATTAATGACACCACTAAAAAGCGAGAAAGGATCCC
ATCAAGTGATGTACAAGATCGAATTTCAGTCATAAAACCATTACCAATTT
CATCACCACAAATTTCAAACACATCCTCTCCTTTGGATATTGTGAATAAT
GATCATGACACATTGAAAAGTCCACAAGCAATTGAAAAGCTGAAATCTcc
tgaagaaattcaaaaagtaaTAGATCATTCTGAATCTGCACCTGTCACAC
TCATCCATCCATCTATGCGCCTCAAAAAGCAAAGAAGTCTATCAAACAGT
TCAATGACTGCCACCAGTCCACAACCCGTTATGGAAaaggaaaaaccaaa
aacaagtAATAGACGACCGTTACATCCTTCTATGCGATTACAGACcaata
aaaataatacaaaagTTGATAAAGCTGAACCTAAAAAGAGTAAGGTTGAA
AATCTTGATAACAGTTTTGACAGTGGAAAGAATATCTTACACAGTCCAAA
AACTGGGCGTTATCAATCTGAACTTACAAGTACTTCCACCAAATCTTCAA
CTAGGAAGTTATCTCCGTTCACTCCTCCAACTGTTACATCACCTTTAACC
TCACCACCACTAGTATCACCTGGAATTCGAAGTCCCTTCAATGGAAAACC
CCTCACTGGAAAACCATTCTCAACTGGTAAGCCTGTTCATGGAGGAAAAC
CAGCATCTTATTCAGCTCAAGGTGGTGGTAAACCAATGCATATGGGAGGG
AAACCGACTAGTTTCTCTTCACATATGACTGTCAAAGAGGAAAAGTCACC
AGAAAAAGAGCACACTGGCAAACCTTTATCTTTTTTGAAGTCCATGGTAg
aagaatcttccaaaaacaCAAACACACTTCAAGGGAAAAAGATCACTGGC
AAGAAAAGACCCAGAAAGGAAACTATCGAGAAACCAGCttcaaaagaaac
tttaaaaaaagatgACATATCAAAATCCCCTGACTTGAAAACAAGTCGTA
TAACAAAAATGATATCAACCCCACCAAGCTCACAAAAATTGACAGATAAT
ATCAAGACTAAGAAACCACCACAAGAAAAACAGGCACCTGTTAAAAAACT
ACCTGTCAAAAGGTCTCCAAAAGTATCACCTCCCAAGAGAGAAGCTGTAA
AAGATTCACCACTGAAAGAAAATCCTTTTAGAAAATCTATCGTCCAAGCA
AAGAGTAAACCAGTActgacaaaacagaaaaatttgaGTAAAGAGAATAT
TGAAGAATTGAGCACAAGTGAGGAAAAAGATTCCCCAAAGAAGacattca
aattcaaagggaTCACATTTGATGCCAAGACTGAAGATGATGATAGCAGT
GATTCTGATTCAGACAGCTCATCAAATTCTGATTcagGGTCGTCAAGTGA
TAGCAGTGACAACAGTGGAacagaagaagaaattgaagataTTGAAGACG
AAGACGATGACGATACTGCATCTCAAACAAGTTCAGTTACAAGCTCTCCT
GCAAAGAAAACACAAAGAGCTGGTCAAAAACGAAAAGCAGTTCCTGACAA
TGCAGAGGtGATTGCCAGTTTGAAGAAACGAAAAGTTGTTGATTTGGATT
TGATAAAAGCGCCATTAAAATTTggATGGAGAAGGCAGACAAGACTCAGA
CCGAACAATGCTGGTGATGGGCTGAGGGGAGATGTTTATTATTATTCACC
TTGTGGGAAAAAGCTGAGGACGTATCCTGAGTTAAACAGTtACATCTTTC
GAAATGATGTCGTTGATGTAGACTTGAAGAATTTCAGCTTTTCAACCAAA
CTTCGTGTTGGCGAATTCATGCAGGCTAAGGATGGTTCAAAGTTTGTGAC
ACTGACTGAAGAAGAGATCGATGAAACATTTGTTATGATGGAAGAAAGGA
GAAGTGCTTCTGCAAAAAGAGCTGaagaaaagaagagagaaaaacgTGAA
AAGGAGGAGAAGCAACGTCAGATACTTGAGGAGAGAAAAAAGAAGAGAGA
AGAAGCCTTGGAAAGAAAGAGATCGAAAGAAGAAGAAAGGAGAAAGGTTC
AAAAAGACAAAGCATTGGAAGCAAAGATGAAGAAGGAGAAAGAAAAGGAA
GCAGCACAAGAAGCCAAACGATTGAAAGAGGAGGCAATAATGTTGAAGAA
ACTAGAAAGGCAAGCTCAAATGGAAGCAAGTCGAATTGCCAAGCGTGAGA
AAGTTCAAAATATGTTGGCTGAAAAGCAGAAGATGAAAGAACAAAGAGAA
CATGAACGAGTCATGAAGATTGAGAACCAAAAAGTGgagaaagaaatgaa
attacAAGCAATCGAAAATgaGAAGGAACGTAAAAGGCTGCAACAAGTGA
AAAGTAAAGTATCAGAAAAAGAAAAGCGAAAACGAGAGCTGGTCATGATG
AAAGCTTATGAAGCACAACGGAGAGCTGAGGAGAGAGAACGCCTCAAAGA
ACAAAAGAAGCTGGAGAAAACCTTGATCAGGCAACGAAAATTGGAACAGA
AAAGATATGAGCGCATGATCtctaaagaattgaaaaaacctATCGATGAT
ATGGCTCTGAATGATTTGAAGCCGTTGCCAGAGTTACCAAGGGTAACCAA
CATCAACATTCCTGGCAAAGCATATGCAGATATCCTGATGGTTCAAGAGT
TTGTTCACGCCTTTGGTCATGTCATTGATATCGATCCAGAGAAGGAGTTT
CCAAGCATGGGAGAGTTGCAATCATCATTGTTGTGTGAATCTGGTAGCGA
TGAAGCAATCTTCACTGCATGCCAAGCACTTCTTTTTTACGCCCTCTACG
ATCCCGGTGTATCTGGGCCTTATGCCAAAACTTCACTGGGTTCAGACCTT
ACGAGTATCGAATTGAACGAGAACAACATATCAGAAGTATTACGTCTTTT
CATCTTATCACGTAATGAAGGAAAACAACACACACTCAGTGATCAGCTCA
CCAAATATCCTTTAGAAGCTCTCTCACCCAGTAGTAAAGCTGCTGTTCTA
GCTTTCATTGTCAACGAACTGCTTTGTGGAAAATCAGTTAGCAGAGAGAT
TGACGGTAGCTTggagaacatttcaaatatgCGAAGGGATAAATGGAACC
TGGAAGGAGATATACGGAAaTTGAAAGCTGATCTATTATCAAAGCAACCC
AAGAAAGCAGCCAGTGATCAACAACAGAAcctaaaaaacaacaaaggaGA
GTCGAAGAAAAGAGACTCTGACGAGGAGAACAATTCGGACGATGAAGGAA
CCACTATCACCACTGCTAAGGAGAGCAATATCGATTTAAACGACACTGCG
GAAGACACAGAAGCTGAAAACCAGCCAGAGATGGTGAATCCTACTACACT
CGACCAAATGGAGAAGAAACTACGTTTGATGGAAAAGAAACACGCTCGCT
ACCGTAAAAAGTTGTTCGATTCTTCACACACGATACGTGGTATAAATTTG
GGTCAAGATCGATACCGGCGCCGTTATTTCGTGCTTCCGAACGCCGGAGG
GATTTACGTCGAAGGGCTGGAAAGTGGATTTTTTGACGAAGAAACGAACG
TGAAAACAAAGGAAGAAAAGGAAGAATGCAAAGAACATTTAGATAGTTTA
CTGACCACCTTGAAATCTCCAACTGTGTTGAAATCCCCTGTGACTGGCCC
CAAAACACCGGCCACAAATACACCGTCTGTATCAGCATTATCCTCAAATT
CAAACGAACTTTTAAAACCGAAACAAGAGAGTCCTATAcaaacacaacaa
caacaaaaacagataaaagtTGAGAATCCTTGTTCAAGTGATAGTAGTTA
TGTCAAATCTTGGTTTTCCTTACGGACTAAAAAACGTTGCGAGTCTTACA
AAACTTCAGCTATACGTGAAACGCCTAAAGAGCGCAAACATTCGCTCATC
GTTGCACCGAGGATAGAACGACTTGCCGACGACCACCAATTCTTAGAATC
TATATACTCTTGTTATTCCACTACTTCTCCTGGTGGGAAAAACACTTTAT
TACCTGTCAGCAGATTTCCCTTATCCAAGGAAAGTATGCATCGGAACTCG
TTACTAGGCTTACCGGCTGAATTGGATATGAATTTACTTATACAACAAGA
CCCACAAAAAGCAGCGGAAATTCTTGAAATACAGACTGCCAAGCCTCAAG
AAATTCCGCCTGAAATGCAGGCGGGTTGGTGGCGGATCACCGATCCAGAA
CAAATGCAGCGCCTGAACAAGTGCGCCCACGCCAGGGGTATGAGAGAACG
GAACCTTCAAAAGACGGTGGTGCGATTCCAAGACTACACCAACTCATCGT
GTAAAGTTGACCATCTTGCATtttctcTACTTCTCCCCGACGAAGAAAGT
GAAAGCAAAGACAAAGTAACAGAAGACGACAGCAGCGTTGCCACATCAAC
GGATACAAACAAATCGATACAAGATAAATGGTATCCACAGCTGGCGTATG
CAAGTGACAAAGCCATTTTGATTGAAGTCGAAGAATTAGAGGAAAAGGTC
TTCTCGGCTAGTTTGCAAGTCAAGGGCTGGCGTTTGTCTCAAAAGATCTC
TCCAGCACTTCTGCTGAGCACGAGTAACGATCAAGCTGAGTATGATCCAC
CCGAAGATAAATATCCCATCAGGATAGCGGCTTCCCGTCTCCTAGCTCTT
GAGCTCGGTATCGAACGACGTTACATGAAGCCTCCATTCCGTACACCAGA
CAGCCTTCCTAAACCGGACGCCCCAGAGGCTAAAGAAGAACCAGTCAAGA
ATCCAAAAGCAACAGCCCAACTGGAGAAATGGCGTGAAGCAGTAAGCGAA
GCAAAATCGTCAGCTCAGCTATCGATGTGTATCACAGCACTCTTCGAATG
TGTCGCTTGGGAGAAGTCCATCATGAAAGTGTTCTGCATACTATGTCGTA
AAAGTGACAACGAAGAAAGATTGTTGCTATGCGACGCATGTGATCGAGGC
TGTCATACGTATTGTTGTAAGCCGAAATTCGATAAGATTCCCGATGGTGA
CTGGTTTTGTCAAGATTGTGTGTTGATGGCGTCTGGTAGTGATCAGTGCT
ACAAATGTAAATCGAAGACCGGACGACGTCTGAAATGTGCATTCTGTCCA
CGTCATTATCACATGGACTGCCTTGAACCACCATTACACAAaACACCTCG
TTCGCCTTGGAGTTGTCCCGTCTGCAAGAAAACACGCTCCAAGAGTAAAC
CTCCTCAACGTAAAAAACCACGCGCCGAAGAACTTCTCAAGAAAGAGGAA
CAGAGCAAACAAAAATCCATGTCCAACAGCCGTGTGCAGACGTCCAAAGA
CATGGAACCGTGTCGTTTCATATTGAACGAAATGGAAAATCACGAATCGT
CATGGCCCTTTCTCGTCCCTGTCAATATGAAGCAGTTTCCAGAGTATTAT
AAAGTGATCAAGCATCCGATGGATTTCCATACCATGAAAACGAAGCTGCG
TGATTACCAATACAAGTCAAAAGAAGAGTTCGCACGTGACGCGCGGTTGG
TGTTTTTCAATTGTAAAACGTACAACGAAGACGAATCGGAGGTTGGATGT
GCAGGTGAAGCGATGCGAagtttcttcgagaaacgttgGACCGCCCTCAA
AAAGGGTGTCTCTTCCACAAACAGTGATAACAAATTCCACACCAACAAGA
AGGGGGAGGGTGTGGAATCATCAGGCGATGAAGGAGAAGACGCTCAGGAG
GAGGGTGAAGGCGATGAAGAAGTATCCAGTTCGAGTTCTGAAGAAATCTC
ATCCGAAAGTGAGAGCAGCGAAGTGGAGGAGGACAGTGAAAACGAGACCG
ACTCAAAAACATGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000309XLOC_000309Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000499-exon-sc0000002-1491911889:1572459..1572625TCONS_00000499-exon-sc0000002-1491911889:1572459..1572625Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1572459..1572625TCONS_00000499-exon-sc0000002-1510915933:1572459..1572625Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1572459..1572625TCONS_00000499-exon-sc0000002-1575043694:1572459..1572625Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1575209..1575346TCONS_00000499-exon-sc0000002-1491911889:1575209..1575346Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1575209..1575346TCONS_00000499-exon-sc0000002-1510915933:1575209..1575346Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1575209..1575346TCONS_00000499-exon-sc0000002-1575043694:1575209..1575346Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1575484..1578699TCONS_00000499-exon-sc0000002-1491911889:1575484..1578699Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1575484..1578699TCONS_00000499-exon-sc0000002-1510915933:1575484..1578699Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1575484..1578699TCONS_00000499-exon-sc0000002-1575043694:1575484..1578699Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1579035..1579205TCONS_00000499-exon-sc0000002-1491911889:1579035..1579205Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1579035..1579205TCONS_00000499-exon-sc0000002-1510915933:1579035..1579205Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1579035..1579205TCONS_00000499-exon-sc0000002-1575043694:1579035..1579205Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1579512..1579578TCONS_00000499-exon-sc0000002-1491911889:1579512..1579578Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1579512..1579578TCONS_00000499-exon-sc0000002-1510915933:1579512..1579578Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1579512..1579578TCONS_00000499-exon-sc0000002-1575043694:1579512..1579578Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1579729..1579843TCONS_00000499-exon-sc0000002-1491911889:1579729..1579843Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1579729..1579843TCONS_00000499-exon-sc0000002-1510915933:1579729..1579843Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1579729..1579843TCONS_00000499-exon-sc0000002-1575043694:1579729..1579843Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1580291..1580383TCONS_00000499-exon-sc0000002-1491911889:1580291..1580383Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1580291..1580383TCONS_00000499-exon-sc0000002-1510915933:1580291..1580383Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1580291..1580383TCONS_00000499-exon-sc0000002-1575043694:1580291..1580383Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1580584..1580797TCONS_00000499-exon-sc0000002-1491911889:1580584..1580797Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1580584..1580797TCONS_00000499-exon-sc0000002-1510915933:1580584..1580797Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1580584..1580797TCONS_00000499-exon-sc0000002-1575043694:1580584..1580797Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1581088..1581168TCONS_00000499-exon-sc0000002-1491911889:1581088..1581168Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1581088..1581168TCONS_00000499-exon-sc0000002-1510915933:1581088..1581168Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1581088..1581168TCONS_00000499-exon-sc0000002-1575043694:1581088..1581168Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1581287..1581411TCONS_00000499-exon-sc0000002-1491911889:1581287..1581411Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1581287..1581411TCONS_00000499-exon-sc0000002-1510915933:1581287..1581411Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1581287..1581411TCONS_00000499-exon-sc0000002-1575043694:1581287..1581411Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1581591..1581656TCONS_00000499-exon-sc0000002-1491911889:1581591..1581656Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1581591..1581656TCONS_00000499-exon-sc0000002-1510915933:1581591..1581656Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1581591..1581656TCONS_00000499-exon-sc0000002-1575043694:1581591..1581656Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1581850..1581960TCONS_00000499-exon-sc0000002-1491911889:1581850..1581960Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1581850..1581960TCONS_00000499-exon-sc0000002-1510915933:1581850..1581960Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1581850..1581960TCONS_00000499-exon-sc0000002-1575043694:1581850..1581960Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1582217..1582469TCONS_00000499-exon-sc0000002-1491911889:1582217..1582469Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1582217..1582469TCONS_00000499-exon-sc0000002-1510915933:1582217..1582469Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1582217..1582469TCONS_00000499-exon-sc0000002-1575043694:1582217..1582469Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1582583..1582722TCONS_00000499-exon-sc0000002-1491911889:1582583..1582722Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1582583..1582722TCONS_00000499-exon-sc0000002-1510915933:1582583..1582722Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1582583..1582722TCONS_00000499-exon-sc0000002-1575043694:1582583..1582722Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1583005..1583225TCONS_00000499-exon-sc0000002-1491911889:1583005..1583225Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1583005..1583225TCONS_00000499-exon-sc0000002-1510915933:1583005..1583225Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1583005..1583225TCONS_00000499-exon-sc0000002-1575043694:1583005..1583225Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1583507..1583581TCONS_00000499-exon-sc0000002-1491911889:1583507..1583581Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1583507..1583581TCONS_00000499-exon-sc0000002-1510915933:1583507..1583581Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1583507..1583581TCONS_00000499-exon-sc0000002-1575043694:1583507..1583581Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1585119..1585329TCONS_00000499-exon-sc0000002-1491911889:1585119..1585329Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1585119..1585329TCONS_00000499-exon-sc0000002-1510915933:1585119..1585329Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1585119..1585329TCONS_00000499-exon-sc0000002-1575043694:1585119..1585329Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1585608..1585664TCONS_00000499-exon-sc0000002-1491911889:1585608..1585664Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1585608..1585664TCONS_00000499-exon-sc0000002-1510915933:1585608..1585664Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1585608..1585664TCONS_00000499-exon-sc0000002-1575043694:1585608..1585664Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1585927..1586774TCONS_00000499-exon-sc0000002-1491911889:1585927..1586774Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1585927..1586774TCONS_00000499-exon-sc0000002-1510915933:1585927..1586774Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1585927..1586774TCONS_00000499-exon-sc0000002-1575043694:1585927..1586774Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1587050..1587135TCONS_00000499-exon-sc0000002-1491911889:1587050..1587135Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1587050..1587135TCONS_00000499-exon-sc0000002-1510915933:1587050..1587135Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1587050..1587135TCONS_00000499-exon-sc0000002-1575043694:1587050..1587135Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1588238..1588440TCONS_00000499-exon-sc0000002-1491911889:1588238..1588440Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1588238..1588440TCONS_00000499-exon-sc0000002-1510915933:1588238..1588440Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1588238..1588440TCONS_00000499-exon-sc0000002-1575043694:1588238..1588440Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1588656..1589012TCONS_00000499-exon-sc0000002-1491911889:1588656..1589012Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1588656..1589012TCONS_00000499-exon-sc0000002-1510915933:1588656..1589012Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1588656..1589012TCONS_00000499-exon-sc0000002-1575043694:1588656..1589012Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1589345..1589434TCONS_00000499-exon-sc0000002-1491911889:1589345..1589434Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1589345..1589434TCONS_00000499-exon-sc0000002-1510915933:1589345..1589434Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1589345..1589434TCONS_00000499-exon-sc0000002-1575043694:1589345..1589434Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1589546..1589602TCONS_00000499-exon-sc0000002-1491911889:1589546..1589602Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1589546..1589602TCONS_00000499-exon-sc0000002-1510915933:1589546..1589602Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1589546..1589602TCONS_00000499-exon-sc0000002-1575043694:1589546..1589602Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1589928..1590040TCONS_00000499-exon-sc0000002-1491911889:1589928..1590040Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1589928..1590040TCONS_00000499-exon-sc0000002-1510915933:1589928..1590040Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1589928..1590040TCONS_00000499-exon-sc0000002-1575043694:1589928..1590040Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1590521..1590764TCONS_00000499-exon-sc0000002-1491911889:1590521..1590764Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1590521..1590764TCONS_00000499-exon-sc0000002-1510915933:1590521..1590764Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1590521..1590764TCONS_00000499-exon-sc0000002-1575043694:1590521..1590764Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1591049..1591122TCONS_00000499-exon-sc0000002-1491911889:1591049..1591122Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1591049..1591122TCONS_00000499-exon-sc0000002-1510915933:1591049..1591122Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1591049..1591122TCONS_00000499-exon-sc0000002-1575043694:1591049..1591122Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1591403..1591484TCONS_00000499-exon-sc0000002-1491911889:1591403..1591484Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1591403..1591484TCONS_00000499-exon-sc0000002-1510915933:1591403..1591484Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1591403..1591484TCONS_00000499-exon-sc0000002-1575043694:1591403..1591484Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1491911889:1591818..1593587TCONS_00000499-exon-sc0000002-1491911889:1591818..1593587Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1510915933:1591818..1593587TCONS_00000499-exon-sc0000002-1510915933:1591818..1593587Clytia hemisphaericaexon
TCONS_00000499-exon-sc0000002-1575043694:1591818..1593587TCONS_00000499-exon-sc0000002-1575043694:1591818..1593587Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000499-proteinTCONS_00000499-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1572459..1593587 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.40227 1.35478 1.93721 1.32465 4.53252 2.768 1.968 1.50678 1.61297 1.94254 0.758103 1.11667 1.77357 0.34456 2.30654 2.41956 2.5236 2.39408 1.87494 1.92898 2.52843 1.6398 1.95466 2.3385 0.653102 0.691373 0.648679 1.47313 1.8065 1.99533
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001487Bromodomain
IPR001965Znf_PHD
IPR001739Methyl_CpG_DNA-bd
IPR013083Znf_RING/FYVE/PHD
IPR019787Znf_PHD-finger
IPR018359Bromodomain_CS
IPR018501DDT_dom
IPR016177DNA-bd_dom
IPR011011Znf_FYVE_PHD
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0003677DNA binding
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0005634 nucleus
molecular_function GO:0003677 DNA binding
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00000499 vs. Swiss-Prot (Human)
Match: BAZ2B (Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens GN=BAZ2B PE=1 SV=3)

HSP 1 Score: 259.61 bits (662), Expect = 6.944e-69
Identity = 183/503 (36.38%), Postives = 303/503 (60.24%), Query Frame = 2
Query: 4274 MLKKLERQAQMEASRIAKREKVQNMLAEKQKMKEQ----REHERVMKIENQKVEKEMKLQAIE----------------------NEKERKRLXXXXXXXXXXXXXXXELVMMKAYXXXXXXXXXXXXXXXXXXXXTLIRQRKLEQKRYERMISKELKKPIDDMALNDLKPLPELPRVTNINIPGKAYADILMVQEFVHAFGHVIDIDPEKEFPSMGELQSSLLCESGSDEAIFTACQALLFYALYDPG-VSGPYAKTSLGSDLTSIELNENNISEVLRLFILSRNEGKQHTLSDQLTKYPLEALSPSSKAAVLAFIVNELLCGKSVSREIDGSLENISNMRRDKWNLEGDIRKLKADLLSKQPKKAAS------DQQQNLKNNKGESKKRXXXXXXXXXXXGTTITTAKESNIDLNDTAEDTEA-------ENQPEMVNPTTLDQMEKKLRLMEKKHARYRKKLFDSSHTIRGINLGQDRYRRRYFVLPNAGGIYVEGLESG 5662
            +L+KL++Q Q   ++ AK+++      EK+K KEQ    ++ E++ +I+  ++EKE++ Q I                        EKE +R Q V  K  E+E+R++ +++MKA EA+++AEE+ERLK++K+ EK L ++RKLEQ+R E  ++KELKKP +DM L D KPLPELPR+  + + G  ++D LMV +F+  FG V+  D   + P++  LQ  LL    S   +      LL  A+ DPG ++G  AKT+LG  L ++ +N +N+SE+L++F+ +     Q  L++ L     +A +P+ KA+VLAF++NEL C KSV  EID +++ +SN+RRDKW +EG +RKL+     K  K+  S      ++Q  L       K+R    +++ DD+    +  +    D ++  ++ +        E++ E     +++++EK++  + K+ ++YR+KLFD+SH++R +  GQDRYRRRY++LP  GGI+VEG+ESG
Sbjct:  903 LLRKLQKQEQARVAKEAKKQQAIMAAEEKRKQKEQIKIMKQQEKIKRIQQIRMEKELRAQQILEAKKKKKEEAANAKLLEAEKRIKEKEMRRQQAVLLKHQERERRRQHMMLMKAMEARKKAEEKERLKQEKRDEKRLNKERKLEQRRLELEMAKELKKPNEDMCLADQKPLPELPRIPGLVLSGSTFSDCLMVVQFLRNFGKVLGFDVNIDVPNLSVLQEGLLNIGDSMGEVQDLLVRLLSAAVCDPGLITGYKAKTALGEHLLNVGVNRDNVSEILQIFMEAH--CGQTELTESLKTKAFQAHTPAQKASVLAFLINELACSKSVVSEIDKNIDYMSNLRRDKWVVEGKLRKLRIIHAKKTGKRDTSGGIDLGEEQHPLGTPTPGRKRRRKGGDSDYDDDDDDDSDDQGDEDDEDEEDKEDKKGKKTDICEDEDEGDQAASVEELEKQIEKLSKQQSQYRRKLFDASHSLRSVMFGQDRYRRRYWILPQCGGIFVEGMESG 1403          

HSP 2 Score: 201.06 bits (510), Expect = 5.271e-51
Identity = 129/323 (39.94%), Postives = 167/323 (51.70%), Query Frame = 2
Query: 6278 PQEIPPEMQAGWWRITDPEQMQRLNKCAHARGMRERNLQKTVVRFQDYTNSSC-KVDHLAFSLLLPDEESESKDKVTEDDSSVATSTDTNKSIQDKW-YPQLAYASDXXXXXXXXXXXXXXFSASLQVKGWRLSQKISPALLLS------------------TSNDQAEYDPPEDKY--PIRIAASRLLALELGIERRY---MKPPFRTPDSLXXXXXXXXXXXXVKNPKATAQLEKWREAVSEAKSSAQLSMCITALFECVAWEKSIMKVFCILCRKSDNEERLLLCDACDRGCHTYCCKPKFDKIPDGDWFCQDCVLMASG 7171
            P+ IP EMQ GWWRI DPE ++ L K  H RG+RE+ LQK + +  DY   +C K   +A   L  +EE    ++VT D             I + W   + A   D ++L +VE+LE +V SASLQVKGW   +  S    L                   T  D++     E K   P+ IA +RL  LE  IERR    + P  R                             WR A+SEA+S+AQ+++CI  L + +AWEKSIMKV+C +CRK DNEE LLLCD CD+GCHTYC +PK   IPDGDWFC  C+  ASG
Sbjct: 1707 PKPIPEEMQFGWWRIIDPEDLKALLKVLHLRGIREKALQKQIQKHLDYITQACLKNKDVAIIELNENEE----NQVTRD-------------IVENWSVEEQAMEMDLSVLQQVEDLERRVASASLQVKGWMCPEPASEREDLVYFEHKSFTKLCKEHDGEFTGEDESSAHALERKSDNPLDIAVTRLADLERNIERRIEEDIAPGLRV----------------------------WRRALSEARSAAQVALCIQQLQKSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIAKASG 1984          

HSP 3 Score: 135.961 bits (341), Expect = 2.732e-31
Identity = 59/100 (59.00%), Postives = 73/100 (73.00%), Query Frame = 2
Query: 7427 SKDMEPCRFILNEMENHESSWPFLVPVNMKQFPEYYKVIKHPMDFHTMKTKLRDYQYKSKEEFARDARLVFFNCKTYNEDESEVGCAGEAMRSFFEKRWT 7726
            SKD+  C  IL EME HE +WPFL+PVN+K  P Y KVIK PMDF T++ KL   QY + E FA D RLVF NC+T+NED+S++G AG  MR +FEK+WT
Sbjct: 2063 SKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWT 2162          

HSP 4 Score: 111.309 bits (277), Expect = 8.208e-24
Identity = 49/102 (48.04%), Postives = 74/102 (72.55%), Query Frame = 2
Query: 3707 KKRKVVDLDLIKAPLKFGWRRQTRLRPNNAGDGLRGDVYYYSPCGKKLRTYPELNSYIFRNDVVDVDLKNFSFSTKLRVGEFMQAKDGS---KFVTLTEEEI 4003
            K+R+V D   ++ PL++GW+R+TR+R  N G  L+G+V YY+PCGKKLR YPE+  Y+ RN ++D+   NFSFS K+RVG+F +A+DG    ++  L EE++
Sbjct:  735 KRRRVTDERELRIPLEYGWQRETRIR--NFGGRLQGEVAYYAPCGKKLRQYPEVIKYLSRNGIMDISRDNFSFSAKIRVGDFYEARDGPQGMQWCLLKEEDV 834          
The following BLAST results are available for this feature:
BLAST of TCONS_00000499 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
BAZ2B6.944e-6936.38Bromodomain adjacent to zinc finger domain protein... [more]
back to top