Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000487 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000487
Unique NameTCONS_00000487
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2244

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000487 ID=TCONS_00000487|Name=TCONS_00000487|organism=Clytia hemisphaerica|type=transcript|length=2244bp
TTTAGATTGGATACCAATATagatttaaaaagttatttctAGATATCGAA
ATGTGAAGAAACAACATTAAGAGTATGGATTTGCCGGACACTCACAACCT
GACTTCAATTATCGGACAAATAGATACTTGGGACGAAGAGGGGCATTTGA
CGCAACTTTTATTATCGATTTTATCCATTGGAGTGACTATTAGTCCAGAA
TGTTGGTTGAAATTCCCTATCATGtgtaTAGGCTGCAATTGGCACCAAAT
CACAGCATCGCTTCGACAAACTGAATACCACGAAGTTGTCACCACTATAT
GTACACTCTGCAATCTTATCAATGGATTCATACCAGAGAACATAGAATTC
GAAAGAAAAGATTGGTTTGTGTTACAAAAACTTCGAAGATCTGCCCAGTA
TGAACCCAATTTGAGACCAAATTTCCCGAAAATATCCGAAACGGTTAACG
TTACAATACAACTGGTTACTATCGAAAATTTGGACCTGTCACACTCGaGC
TTCAAATTAGATTTCCTATTACGTCAAGAATGGAACGACCATCGATTACG
TCATCACCATCCGGCCGTCTTGGATGGATCCAACCTTCGAATGGGGGTTT
GGGTACCAGATTCGTATTTTGTTCAAGCAAAGCGTGGTGTGTTCAGCCGG
GTTGCACATGATGGGCAGACAATTAAAGTCAAAAGTAATGGAGATGTATC
ACACGGTGCAAGaATTACATTGGAGGTGAGCTGTCCCATCGACTTACGAA
ACTTTCCAATGGATATCCAACATTGCAATCTCGACATGGAAAGCTACGCA
TACAGCACAGAAGAAATAACATATAATTGGTCACCTCACGAAGTCATCAT
GAAGAATATCaaagaaacatcaaaatcactttCACAATACACGCTGGAAC
CAATCAAAACCGGCAAAGGATCTTCGGAATATGTGCTCGgtaaTTGGTCC
AAACTACAAATTGAATTCAAGTTTGTTCGGAACAGTATCATATTTATACC
AGCAATGTATTTCCCATGTGCCATGGTCGTCTTCATTACTTGGATCACAT
TCTTAATGGACTCGGCCCAGTACCCTGCCCGTACTTACTTATGTGTGACG
TCACTGTTGACTATCGTTACCCTACAGACGGCAATGAATGCTTCGTTACC
TAAGGTCAGCTACGTTAAAGCAATCGATAAATACATTGTTGGTTGCATTT
TGTTTGTGGCTGGTGCATTCTTGGAGTATGCGGTAGTTCTGCTAATCAAT
ATCAAGAAGAATAGTGTTCTGATGGAAAATTCGTCCCTGaTTTTCAATAA
CTTTTCGTACGCTCTTCAACCCAGAAGTGAAAAGTCTAAATCCTCTCTAA
AGAAGAAATTACGACGTCGCAAAATCACTTTCTTACGATCCCGATTAACG
AGCCCAAAGGAGTTCCACGACGATCAGACGTCATCGGTGAATGACCAACA
AATTGTATTAACAAAATTCGGAGCTATTTTTCATTTCTATCTGAGCGATG
CGTGGCCCAAGAAGCTGGATGTTATTTCAAGAGTTTTCTTCCCGTCCCTG
TTTTTAACTTTCAATTTGTTTTACTGGATAACTCATGTTGACGATCAGTA
TTGAGTCACACCAAAGCTGTATAGACGTGCTATATTGATttcatctgttt
tttttttcttttgcatgAAGACTGTTCGTTACCTTCTTGTAAACTGGAAT
CTGGTTTTTAATACAGTTGACCCTATTGTTTTTTCGAGCTCGAATGGCAT
GTCCAATTGTTTAAATTGCAGAAAGATTAATATTAGCGTGAGTCTAACGT
CCGATTGGACGTGCAAAAAATTACATTGACATGGTGATTACAGAACGGTT
TCCTccgataaattttgaaaattgcattttttaagGAAGTGGGACCATAa
tgaaagaataacaaaatttgattggatgTGTTTTCAACTGTCGTTTGGAG
CTGAGAACACGTTCTTCATTTCGCCACCagtataaaaaagaaataatcaT
ATAGGATGGGTCTCCAGGGGTTTCCAGGCTATGCCCGATTGGaagaaaga
aatatttaaacTATAGTGTTTGCATTccttaaaacaatgaaatgttATTG
GTTCGAAAATACATCACGTGACCTTTCCATTTTACTCTTCGTAAgctcaa
aatcgaaatttcaagaatgaggattacacgttttttttataagaacattc
aaaatttttgatgccttctgatgttcttaactttttgggaatca
Run BLAST on NCBI

transcript from alignment at sc0000002:1524677..1533239+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000487 ID=TCONS_00000487|Name=TCONS_00000487|organism=Clytia hemisphaerica|type=transcript|length=8563bp|location=Sequence derived from alignment at sc0000002:1524677..1533239+ (Clytia hemisphaerica)
TTTAGATTGGATACCAATATagatttaaaaagttatttctAGATATCGAA ATGTGAAGAAACAACATTAAGAGTATGGATTTGCCGGACACTCACAACCT GACTTCAATTATCGGACAAATAGATACTTGGGACGAAGAGGGGCATTTGA CGCAACTTTTATTATCGATTTTATCCATTGGAGTGACTATTAGTCCAGAA TGTTGGTTGAAATTCCCTATCATGGTACGAAAGTATTTGATAGATTACAA AAAAGATCGTATATTGTACAAGGAAATAgactgaaattttgaaatgccca aaactttcttttgaagATCAATTGTCCTTGTCGAATTTTTGAATGTCGAG TTTGTTcttgatttgttcttttttttggaaGTGCTTTTACAAAATGGATA AGAAATCACGAAggcattttttagaaaaacgttaacaaattttgaagcct tcgggtgATCTTAGTTTTTTtaggttttaagcctaaaattgttcttaaaa ttgtTCTCAGAAATTACACATTCTAAAGCATGTAAAGCCTTAAACCTTCT AAGAGCGTCATTAACATTGCCCTCGAAGCTCGAAACCTTGTGTTTTTATA AACCTTCTTTTAATAGAAAAATATCATgtatgtttttttcattttcagtg taTAGGCTGCAATTGGCACCAAATCACAGCATCGCTTCGACAAACTGAAT ACCACGAAGTTGTCACCACTATATGTACACTCTGCAATCTTATCAATGGG TGAGCTTTTTGAATAGTCTTTTAACTCGAAGATACATCTTTCTCATTTAT CCATTTATCCATTTATCCAGTTCTGATTTGCTCAGGTTAACCCTTATTTT TTCATCTGTTTATGACAACCCTGTCTCATTCGCTAGACATACCCTTCTCC CTTCTCCCTTCTCCCTTCTCCCTTCTCCCTTCTCCCTTCTCTAAGACGCC TCTTTCCACTTGTTCAAGGTACCAATTAAGTTTTAATATCCTGATGCTCG ACACTATAATACTATAATATTACCCCTCCCCCCCCAATATCTCCAAAGGT TTACCATCTACTTTGGTCGTTGAGCTCCGGCACTTAACCCTCAACTGAAA AGAAACTGAATTTATagataaatagaaaaaaatcaacctggTTCTaaata attccaaaaaatatatggaaATGTAGAAGATAAACGatgaaaaaagaatt aattaaTTTATCCTTTGATTGTTAATATCTATTTTTTGGTAATGAGGAAC TTTGACAcccgggaggggggggggtactacaaTTGCTGACCGACATGAAT GCTCTGCGAAAGGTTCGAAAAATAGAcactacgtgggactcgttttttca aaaattttgccaaaatttgtgaaaaaagttaccctgaatgggactgaaat tgcaaaatgttctcgaattttctactttttccccaaattttccaaaaaag gcaccctacgagagacttatttttctattttggtgtttttgcgaccctac ctgcgACTTgtagaggttaaaaaaggtaccctgaccagcggtgCATCCCC GTAATCAATCTTGCTCTAGTACCCCCCGCCCCGCTTTGACAATCAAGAAT TTGTGTATGCCTAAAATGAATAAGGAATTTAACATCAAACTCGATGACAA TTCTCACCTTTCATAAAGCAATTccaaattttatgaatttctttatagtt ttctGATATTTATACTGCCAAAAATTCTAGCAAGTTAAAAATTATCCGGT CAAATGACGCATTATTCAAACAAAagttacaaaatgaaaattacccCAAT GGGAAATCGTGTCATCTAAAAGCAATATTGTTTATATGATGATGACTTCA ACATATTATTaataatatgtttttttttgttttgttaaaacAAGTTACAT GTTTGATTAATTATTTGTTATGAATCGTATGAAATTGTATAATTAATGAA GTCATTAGATTAATAAGTAAGCATCAGGTCTATCGATTACTGTATTTTCA ATATCAAAATCAACTTTATCCTAGGTTTGGGGGACTGCCTTTTAAAGGCC TttccagcggtttgcgtgaatgcgtgaattggctttttcacttgcgtcaT GAAGGTAAATGCGTGAATTAGGGAGGAAAATTAGGGAGGAAGTCTCCCCA GTCATTTCACTTCCGCTGGGACTTAATAAGGTTACTTTTTATCTCTTTGA TTTATACAGATTCATACCAGAGAACATAGAATTCGAAAGAAAAGATTGGT TTGTGTTACAAAAACTTCGAAGATCTGCCCAGTATGAACCCAATTTGAGA CCAAATTTCCCGAAAATATCCGAAACGGTTAACGTTACAATACAACTGGT TACTATCGAAAATTTGGACCTGTCACACTCGGTATGTATGCGGATTCTTT TAAGATGGATTTTTGGGTTTGGTTTTCAGTTTTAAAATGAAGTGACACAT TACTACATTCAAACACACAACATTCGCCTAGAATTGAAAAGATACCCAAT TTTATGTTCAAAGGTATGATTGGTAATCAAAGAATCAGGCTCAAtgatgt gccgctggtcagggtaccttttttccacgtagggtcgcaaaagcaccaaa atagaaaaataagaaattccTCGTTTTGGGGGGATTNTGGTCTCAAAagc accaaaatagaaaaataagaaattccTCGTTTTGGGGGatttggatttca aaaaaacaagTCCCTTGTGCATGTAGGGTCCATTTCTCGGACCTCAGTGG TACACCCCCGTCGATCCGGGGTCACAAGTCCTATCCCAGTCTGTAAATCT CACTTTAGGTACCttcttgattttcttcttctttagaGCTTCAAATTAGA TTTCCTATTACGTCAAGAATGGAACGACCATCGATTACGTCATCACCATC CGGCCGTCTTGGATGGATCCAACCTTCGAATGGGGGTTTGGGTACCAGAT TCGTATTTTGTTCAAGCAAAGCGTGGTGTGTTCAGCCGGGTTGCACATGA TGGGCAGACAATTAAAGTCAAAAGTAATGGAGATGTATCACACGGTGCAA GGTAGTTTGTTTGTCTCGATTTTCCAATTCATATTATTTTCTTACGTGAA GAAGAAGGCAATTCGCCCACCCTCAACTCCAGGCCTTACCTGACCCCCTT ACACTATTGATAATTCTGATGGATGCGTTGACGGGGGATGTAAAGGACTC CTCCAATTTTACGGCACTTACCTCTTTacgtcgcagaatcgtttaatGGC CCTGACTCACGAGGGTGGCAATTCGTCAAGTCAAAAAAAGAGGATGTTTG CGTTGAATTTCAACTTGAATTTCAAGTTTACGGATCTAACCTATACTGAC TGTATAGATGAGATTTGATATTCTTTCTAAAAGGGTtaccattaaaaaaa atttgtagcTCAAGAGTTAGTTTTTACTAAATTTCTTTCATAGAAACTTT GATGTTGACTCAGagtcagaaaaaatcatttctcgGTTATCAAAAGATTT AGTTTCCTCATCGTCGATAACGTCAAAATTCAATCAAGCTTGGCGATCGA AGTGATTATACTTATGATTGTAATCTTGcatgaaatattctttcagaATT ACATTGGAGGTGAGCTGTCCCATCGACTTACGAAACTTTCCAATGGATAT CCAACATTGCAATCTCGACATGGAAAGCTGTAAGTAACAAGAAGAACCTT TCAAAAATCGTCGATGGTTTCAACAATCGAAAAAAAAGCACTCGatattg gcacttaaagggacattacagtacttgcgaaatttgtaaacaaactgtat gcagcagatacaaaatcaaaacaaatgtcacatgtcaaaataaaaaatca aaccaaatacNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNtttacaagtttgttttggacacgtgattttaattgttctct ttaatgacacgtggtttgcgcaatgtttacattttactacttttatgtcc ctttaaagggTTGACCGTCCCCGATTTTGCAGCTGAAAACtacgggttat tccaaatcgcttcagtcactcactgtcctcaaaagtgcaaatacataaac tcgcttatCTCCAAGCGTTTAGCGTAAATGAAAAAGGGGGATAGACTTTG CTCACTAACGGCACTCTTCTTCAGAAAGTCACGTAGTCTAGCATGCTATG TGAAATAATCCAAACATAgtgaaaaataagcaaaaaatagatcttatttt tctaaaaaacgatacattgtgggattgtttcgggggtattacaatagaaa tctcttaggaattcctcgagagaattctattgtaacacccaatgaagtat aagcccgaagggctagaagtcaatctccttggtaggatttgaagccaaca aatcctaccaaagttgcgcggccttgagcggctcNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNtatcaatcgtaaacaaaagaattgctagattcaatctgtcgtcaa aaatacagcgcattttttaaggcttcactttttcttgcctgagaaaggtt agagattgaactctagcccttcgggctttaaactcaatggtaacaccccc gaaacaatcccacaatgcatcgcttttttagaaaaatcaaaagctcTGAT TAGGTCTATTATGGAAGAGACAAAATTGTAATTTATGCAAACTGACATTA TCCCGTATTATCCCGTATTATCATATATAACACCCATATCACTGTATATT ATGTATTATAAACGAAACCATATCCTTCTTTACATTTCAGACGCATACAG CACAGAAGAAATAACATATAATTGGTCACCTCACGAAGTCATCATGAAGA ATATCaaagaaacatcaaaatcactttCACAATACACGCTGGAACCAATC AAAACCGGCAAAGGATCTTCGGAATATGTGCTCGGTAAAGCGACTACATC ATTTTTGACATCCCTGATTAGTCACACAGCGTTTTTATAGACGTTATTTA GGCCTTAGGCACGTAAAGTGAACGAGTTTTCCGCCTTATTTGTCTTTGTC ATGAATCATAGAAAATTTTATACGATAATTCTTAAATGAACATATTTTGT GTAAAATTATTTGCTGAcgttttaaacaaaagaacaacCCTCTCCGAGAT CTTCttcaaattaatgaaaaattcgaataacgGAGGGGATTTGTAAGATG AAAGGACCAATGATtatgttcgaattacagaaaactCGAATAAGAGgaaa tttgatattattttgcTTAAGACAGCATAAGAAGCGCTTCATTTCTATGt cataaaaaataatatcttCAATAGGGCCAAACAGGAAACTAAGATTCGCA CAAAATAcactaaaattgacattctatGATTTGGTCTAAGTTAAAATAta gggaattttattttcaggtaaTTGGTCCAAACTACAAATTGAATTCAAGT TTGTTCGGAACAGTATCATATTTATACCAGCAATGTATTTCCCATGTGCC ATGGTCGTCTTCATTACTTGGATCACATTCTTAATGGACTCGGCCCAGTA CCCTGCCCGTACTTACTTATGTGTGACGTCACTGTTGACTATCGTTACCC TACAGACGGCAATGAATGCTTCGTTACCTAAGGTAGAATcttaattcttg atattcatgatgtattGTCGGAGACACCACGAACATATATAAACGACTGA ACGTCTATCTTCTTTTGTGTCTTTGAagcaataaaaaacaaaaacggaat aaaaaatccgacttaattccgtcataattttatttatttggattacTTCt ctaaaaggattgatagagcttgaacattactagCAATTCACAAAAAATTT GTCCTCCTATTCTTTTATAAATTTGCTatattttaaaagcatttttcaac GCTAAagtgcagaatttcaactgcgtgtatacttttgaatctctTTTATC GCTGGAATAAATTGTTCTATGGCTTAAAAAAAATGGCATGTTAAAGTTCA GAGCCTGTGCTATAAGAATATCCTTATGTGAATCccatactctctaaaat tattccatactttcaaaatattaccCGGAGTTTTAACAAGTTGACGGAGT ATTTTGCCTCTCTTACCTTCCTCATAATGTAAATTAAAGAGTTGTAAAGA GTTGGACCATTGAGgtttttgtcgaagttttgacgtagTTAGCAAAGTAT TCATCtgaggtatatcatcaaaatttattgtttcatttcatgattttaac gaggcggcaacgaagctagcagtgttatcttcaaaaatacaaaggagatg gatgttcAGTCGTTTATTCTTGGGCACGgaaagtcacgtgactttgaGAA ATCGTACCGCTGTgaaagtctaccattttgaattggTTGTTAACAAACGC GAGCAAAAGCTGCAGTAATCTAGTAATCTAATTTACTTTCAACTTTAGAA CACGTTTGATCACCATTAGAAGCCATCTTTTTACTGTTTAACATGAGAAT GCTGTGATTTGTTTTCAACCAATTCAAGATGGTAGACTTTTTTAGCGGGA ATTACATAATCTTGTGATTATGTTCATGGAGACACTCAAAAAACACCGGG CAACTACCTTAATTTTTATTGCTCTAAATTtaaaactggtggcaaacgcc cagtatttttcaggttttccgtatgaattttttacaaaaggCGTGTTTGT ACGTTTTTCTAGGTCAGCTACGTTAAAGCAATCGATAAATACATTGTTGG TTGCATTTTGTTTGTGGCTGGTGCATTCTTGGAGTATGCGGTAGTTCTGC TAATCAATATCAAGAAGAATAGTGTTCTGATGGAAAATTCGTCCCTGGTG AGCAATAACCATGACAATGTATGATTTTGCtaattttccttgtttttcaa CTTTGGCAATCgcattacttttttcttttatctgcTTATTTActctttca agttttttttttgtctcgTGTTAGCCCATGAGCTAGACACTTTTTGGGGC TCACTCGACGGAGGAAGCCTCACTATGATTTTCGGAAGCCTTAACTacta tattttaagaaaaatcagggTGCTTTTTTCAAACTCACAGCTTTTGAccg aaattttcaacttttttaaggGGTGGTAAAcgcgaaatttttatttttgc ttggaTTCCCTTAGGAAATGAAATTACCATGTCATCTTTAAAATAGTATT GCAGTATTTGCAGTTCTCAGCGAAGAAGGCGTTATCTGTAACAAATACAG ATACAGGAAACTTCTTAGATTTCTGAAGCTCTATGACTGGATGGTGGTTC AGCATTGCTGAAATCCTAAGATCCTTCAACTTcctcgattttttttttct tcttctagaTTTTCAATAACTTTTCGTACGCTCTTCAACCCAGAAGTGAA AAGTCTAAATCCTCTCTAAAGAAGAAATTACGACGTCGCAAAATCACTTT CTTACGATCCCGATTAACGAGCCCAAAGGAGTTCCACGACGATCAGACGT CATCGGTGAATGACCAACAAATTGTATTAACAAAATTCGGAGCTATTTTT CATTTCTATCTGAGCGATGCGTGGCCCAAGAAGCTGGATGTTATTTCAAG AGTTTTCTTCCCGTCCCTGTTTTTAACTTTCAATTTGTTTTACTGGATAA CTCATGTTGACGATCAGTATTGAGTCACACCAAAGCTGTATAGACGTGCT ATATTGATttcatctgttttttttttcttttgcatgAAGACTGTTCGTTA CCTTCTTGTAAACTGGAATCTGGTTTTTAATACAGTTGACCCTATTGTTT TTTCGAGCTCGAATGGCATGTCCAATTGTTTAAATTGCAGAAAGATTAAT ATTAGCGTGAGTCTAACGTCCGATTGGACGTGCAAAAAATTACATTGACA TGGTGATTACAGAACGGTTTCCTccgataaattttgaaaattgcattttt taagGAAGTGGGACCATAatgaaagaataacaaaatttgattggatgTGT TTTCAACTGTCGTTTGGAGCTGAGAACACGTTCTTCATTTCGCCACCagt ataaaaaagaaataatcaTATAGGATGGGTCTCCAGGGGTTTCCAGGCTA TGCCCGATTGGaagaaagaaatatttaaacTATAGTGTTTGCATTcctta aaacaatgaaatgttATTGGTTCGAAAATACATCACGTGACCTTTCCATT TTACTCTTCGTAAgctcaaaatcgaaatttcaagaatgaggattacacgt tttttttataagaacattcaaaatttttgatgccttctgatgttcttaac tttttgggaatca
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000306XLOC_000306Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000487-exon-sc0000002-1491911889:1524677..1524900TCONS_00000487-exon-sc0000002-1491911889:1524677..1524900Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1510915933:1524677..1524900TCONS_00000487-exon-sc0000002-1510915933:1524677..1524900Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1575043694:1524677..1524900TCONS_00000487-exon-sc0000002-1575043694:1524677..1524900Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1491911889:1525325..1525425TCONS_00000487-exon-sc0000002-1491911889:1525325..1525425Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1510915933:1525325..1525425TCONS_00000487-exon-sc0000002-1510915933:1525325..1525425Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1575043694:1525325..1525425TCONS_00000487-exon-sc0000002-1575043694:1525325..1525425Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1491911889:1526886..1527057TCONS_00000487-exon-sc0000002-1491911889:1526886..1527057Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1510915933:1526886..1527057TCONS_00000487-exon-sc0000002-1510915933:1526886..1527057Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1575043694:1526886..1527057TCONS_00000487-exon-sc0000002-1575043694:1526886..1527057Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1491911889:1527513..1527727TCONS_00000487-exon-sc0000002-1491911889:1527513..1527727Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1510915933:1527513..1527727TCONS_00000487-exon-sc0000002-1510915933:1527513..1527727Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1575043694:1527513..1527727TCONS_00000487-exon-sc0000002-1575043694:1527513..1527727Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1491911889:1528273..1528355TCONS_00000487-exon-sc0000002-1491911889:1528273..1528355Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1510915933:1528273..1528355TCONS_00000487-exon-sc0000002-1510915933:1528273..1528355Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1575043694:1528273..1528355TCONS_00000487-exon-sc0000002-1575043694:1528273..1528355Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1491911889:1529717..1529860TCONS_00000487-exon-sc0000002-1491911889:1529717..1529860Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1510915933:1529717..1529860TCONS_00000487-exon-sc0000002-1510915933:1529717..1529860Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1575043694:1529717..1529860TCONS_00000487-exon-sc0000002-1575043694:1529717..1529860Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1491911889:1530344..1530558TCONS_00000487-exon-sc0000002-1491911889:1530344..1530558Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1510915933:1530344..1530558TCONS_00000487-exon-sc0000002-1510915933:1530344..1530558Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1575043694:1530344..1530558TCONS_00000487-exon-sc0000002-1575043694:1530344..1530558Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1491911889:1531639..1531773TCONS_00000487-exon-sc0000002-1491911889:1531639..1531773Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1510915933:1531639..1531773TCONS_00000487-exon-sc0000002-1510915933:1531639..1531773Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1575043694:1531639..1531773TCONS_00000487-exon-sc0000002-1575043694:1531639..1531773Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1491911889:1532285..1533239TCONS_00000487-exon-sc0000002-1491911889:1532285..1533239Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1510915933:1532285..1533239TCONS_00000487-exon-sc0000002-1510915933:1532285..1533239Clytia hemisphaericaexon
TCONS_00000487-exon-sc0000002-1575043694:1532285..1533239TCONS_00000487-exon-sc0000002-1575043694:1532285..1533239Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1524677..1533239 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0174338 0 0.0789576 0 0.747731 3.04601 3.05305e-10 2.77868e-10 2.16494 2.86601 0 3.16879 0.267689 2.23151 0.336582 0 1.87151 0 1.24167 0 0 0 0.479741 0.690578 0.915419 1.53836 0.0717155 0.102049 0 0.0394292
Blast
BLAST of TCONS_00000487 vs. Swiss-Prot (Human)
Match: GLRA3 (Glycine receptor subunit alpha-3 OS=Homo sapiens GN=GLRA3 PE=1 SV=2)

HSP 1 Score: 194.512 bits (493), Expect = 6.207e-54
Identity = 123/421 (29.22%), Postives = 219/421 (52.02%), Query Frame = 3
Query:  366 FVLQKLRRSAQYEPNLRPNF--PKISETVNVTIQLVTIENLDLSHSSFKLDFLLRQEWNDHRLRHHH---------PAVLDGSNLRMGVWVPDSYFVQAKRGVFSRVAHDGQTIKVKSNGDVSHGARITLEVSCPIDLRNFPMDIQHCNLDMESYAYSTEEITYNWSPHEVIMKNIKETSKSLSQYTLEPIKTGK-GSSEYVLGNWSKLQIEFKFVRNSIIFIPAMYFPCAMVVFITWITFLMDSAQYPARTYLCVTSLLTIVTLQTAMNASLPKVSYVKAIDKYIVGCILFVAGAFLEYAVVLLINIKKNSVLMENSSLIFNNFSYALQPXXXXXXXXXXXXXXXXXITFLRSRLTSPKEFHDDQTSSVNDQ--QIVLTKFGAIFHFYLSDAWPKKLDVISRVFFPSLFLTFNLFYWITH 1586
            F+ + + R++ Y+  +RPNF  P ++ T N+ I   +  ++  +   ++++  LRQ+WND RL +           P++LD       +W PD +F   K   F  V  D + +++  NG+V +  R+TL +SCP+DL+NFPMD+Q C + +ES+ Y+  ++ + W     +   + E   +L Q+ L+  K  +  +  Y  G ++ +++ F   R    ++  MY P  ++V ++W++F ++    PAR  L +T++LT+ T  +   ASLPKVSYVKAID ++  C+LFV  A LEYA V  ++ +   +L           ++AL+       S +  ++R  + +F    +    +  D  T    +   Q++      +   ++  A  KK+D ISR  FP  FL FN+FYW+ +
Sbjct:   46 FLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFIN--SFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDS------IWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPV--QVAE-GLTLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEAFALE--KFYRFSDMDDEVRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKVFIDRA--KKIDTISRACFPLAFLIFNIFYWVIY 451          
The following BLAST results are available for this feature:
BLAST of TCONS_00000487 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GLRA36.207e-5429.22Glycine receptor subunit alpha-3 OS=Homo sapiens G... [more]
back to top