Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000443 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000443
Unique NameTCONS_00000443
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1357

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000443 ID=TCONS_00000443|Name=TCONS_00000443|organism=Clytia hemisphaerica|type=transcript|length=1357bp
ttttgataacaGACTTTGTTGGATTTTTGAGTTATATTATCTTTATTGCA
TGTAAGATTAAACAAAACATTGAAATCAAGCTTTAAGAAAAAATGTTGTA
GATGAAAGCGTGGTTGTAAAGAAGGCAGAGAATGTCTAACAATGACAAGA
ATCACACAACCAACCCTCATGATATTGTGATAAGCAAGaaTAATGAGGGA
GGTCTTGAATCACCGTCCGATAAACATGCCCGAATATATTCTTCCGATCA
TTTGAATGAAGTTGTACCACATCAAACAgatgaaataattcttgaaagaG
AGAAGAGCAATACACGACGCCATGTGCACAGAGCTCAATCATTCGACAAG
GAGAATGCACAGAAGGCTTTATTTACACCAGTCTTCATGAAGCAGTGTAT
TGTAATGAGCCTTTGGTTTTTCACCAGCTTTGCCAGTATCGTTTTAAATA
AGTATTTACTATCAACTCTGGATGTCGATGCAAGTCTTTTAGGTGCATGT
CAGATAGTGATGACGACTTTCTTTGGTAGTATTGTAATGTACGTGCCTTA
CATTTGCAACTTGACCAGTAGGAAGAGACATAAAAAGATGGAGAATTTCA
ATCGCTTTCAGTTTTATAAGACCATGTCTATCCTTGGTTGGTTAAGATGT
GGTGCTGTAATATGTTCAGTAATTGGTTTGAAATATGTGGCAGTCTCATT
CTCCGAAACCATCAAATCGTCTGCACCTTTGTTCACTGCTCTATTCGCAT
ATTTCCTTCTAAAGGAGTATTCTGGCATTTATGTCAATTTGTCACTGATG
CCGATCATGTTTGGTCTAGCCATCTCAACGTATACAGAGCTGAGTTTCAA
TATGACTGGCTTCTTAGCTGCTTGTACAAATAATATTTTAGATTGCATTC
AAAATGTGTTTTCCAAGAAGCTGCTATGTGGTGACGATATGAAATTCtca
CCATTAGAGTTACAATTTTACACAAGTGTTGCAGCAACAGTTGTCCAAGT
ACCTTTATGGTTTTTCTTCAttGATTTGACGACAAAGTGGGAGACTACAG
ATTCATACGTAGCATCCATGTTGTTATTCAACGGTGTCGTTTTTTACTTA
CAAAGCCTCTTCGCATATTCATTGATGTCTCTCATCTCTCCTGTCACTTT
TAGTGTATCTAATACAGTTAAACGTGCTGGTTTAATTTGGTTTTCAATCC
TGGTGTTTGGTAACAAAGTCACTCTTTTGAATCTGTTTGGTACAGTGTTG
GTTGTAGCTGGTGTGTTTTTGTATCAACGAGCTCGTATGATGGAACAACA
CAAAAGGGACCAAATGATTGTTGAAGAAAAATTAAACCatggaaataaag
aaaaagg
Run BLAST on NCBI

protein sequence of TCONS_00000443-protein

>TCONS_00000443-protein ID=TCONS_00000443-protein|Name=TCONS_00000443-protein|organism=Clytia hemisphaerica|type=polypeptide|length=408bp
MSNNDKNHTTNPHDIVISKNNEGGLESPSDKHARIYSSDHLNEVVPHQTD
EIILEREKSNTRRHVHRAQSFDKENAQKALFTPVFMKQCIVMSLWFFTSF
ASIVLNKYLLSTLDVDASLLGACQIVMTTFFGSIVMYVPYICNLTSRKRH
KKMENFNRFQFYKTMSILGWLRCGAVICSVIGLKYVAVSFSETIKSSAPL
FTALFAYFLLKEYSGIYVNLSLMPIMFGLAISTYTELSFNMTGFLAACTN
NILDCIQNVFSKKLLCGDDMKFSPLELQFYTSVAATVVQVPLWFFFIDLT
TKWETTDSYVASMLLFNGVVFYLQSLFAYSLMSLISPVTFSVSNTVKRAG
LIWFSILVFGNKVTLLNLFGTVLVVAGVFLYQRARMMEQHKRDQMIVEEK
LNHGNKEK
Run BLAST on NCBI

transcript from alignment at sc0000002:757087..780347+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000443 ID=TCONS_00000443|Name=TCONS_00000443|organism=Clytia hemisphaerica|type=transcript|length=23261bp|location=Sequence derived from alignment at sc0000002:757087..780347+ (Clytia hemisphaerica)
ttttgataacaGACTTTGTTGGATTTTTGAGTTATATTATCTTTATTGCA TGTAAGATTAAACAAAACATTGAAATCAAGCTTTAAGAAAAAATGTTGTA GATGAAAGCGTGGTTGTAAAGAAGGCAGAGAATGTCTAACAATGACAAGA ATCACACAACCAACCCTCATGATATTGTGATAAGCAAGGTATTTATATTT CTTCCTGTATCATTTCGGTTTTGCTAAAAACAGGATTAGCTAATCTGCTC AAGTGCAAATGTATTTTTCTCTAAGCGAAAAAGTTACATGCAATTAGAAT TGTATTTTAGaagtcttatttttttcatcattttcttcttcagaaTAATG AGGGAGGTCTTGAATCACCGTCCGATAAACATGCCCGAATATATTCTTCC GATCATTTGAATGAAGTTGTACCACATCAAACAgatgaaataattcttga aagaGAGAAGAGTAAGAAAATCATTTATATATTGATAAATCTTCTTGACC CGTAAGAAGAATAACTGTTGAGCTCATTTTTTGGTATTAAAACTAATCTC TTAACCCCACCACAACCCACATACATGTGATAAAATATTTGTCCAGCTAT ATTTTTTCAGGAGATTTTGGTgacagagcagcatatgcatttcgtccttt aGGACTCAACATACTGCATACAGCATACTGCatgtatatgtatatttttg tTGTGCTAGTTTTACCTTACAATACTGAAAAAAGTTGGAACTATTTACAT TTTGTCAGTGTCATTTTTATTCCTCCTAGGCAATACACGACGCCATGTGC ACAGAGCTCAATCATTCGACAAGGAGAATGCACAGAAGGCTTTATTTACA CCAGTCTTCATGAAGCAGTGTATTGTAATGAGCCTTTGGTTTTTCACCAG CTTTGCCAGTATCGTTTTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNcgccatttactcgttacttgcacgataatatcgtggaa actttttgattttggaatctacatatactaattcgagagtttccatcgaa aaaagtggaatctaagatgtgtatcacgaaaatcattttctagccacttt tttcgacctcagccgcgcaaCTATAAGAAGAATAACTGTTGAGCTCATTT TTGGTACTAAAACTAATCTCTTAACCCCACCACAACCCACATACATGTGA TAAAATATTTGTACAGCTATAttttttcaggagatttgggtgacagagca gcatatgcatttcgtctttattaggactcgtcaacACTGCATACTGtatg tatatgtatatttttgtTGTGCTGAAAAAAGTTGGAACtatttgtatttt attgtaCGTATTCCTCCTAGGTAATACACGACGTCATGTGCACAGAGCTC AATCATTCGACAAGGAGAATGCACAGAAGGCTTTATTTACACCAGTCTTC ATGAAGCAGTGTATTGTAATGAGCCTTTGGTTTTTCACCAGCTTTGCCAG TATCGTTTTAAATAAGTATTTACTATCAACTCTGGATGTCGATGCAAGTC TTTTAGGTACATTGAACAATGTCTTTTCCTCGTCAAATAAAATAACCCTa ttgttttagtgtttttttggTGACCTCCTATGACATTATTAATTTCACTG ATTGAAATTAAGTTTAAGGCTCCCTAAGGCTAATGTGTGCCTAATCTTAG CCTTTAATCATTTTATAATTAGCCCTTTATGCGTTTGATATGATATAAAG GTAAATTAACAATTATAAGTAAATAAAGATACACATAGATACACTTTTTC TCCCGTAAAATTTCAAAGTCTCaggcaatgttttgttcttcaACTTTTAG GTGCATGTCAGATAGTGATGACGACTTTCTTTGGTAGCATTGTAATGTAC GTGCCTTACATTTGCAACTTGACCAGTAGGAAGAGACATAAAAAGATGGA GAATTTCAATCGCTTTCAGTTTTATAAGACCATGTCTATCCTTGGTTGGT TAAGgtaactttttgattttcttttgaaaNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtcact aaacttcagcccccccaatatgaaaatgcttcctacggcactgctattgt tttagtgtttttttggTGACCTTTTATGACATTATTGATTTCACTGCTTG AAGTTATATTTTAGGTTCCCTAAGGGTCATCTGTGCCTAATCTTAGCCTT TAATCATTTTATCATTAGCCATTCATGCTTTGGATACGATATAAAGGTAA ATTAACAATTATAAGTAAATAGAAATACACATGGTTGATTCTACTTTTTC TCCCGTAAAAAGTCTCaggcaatgttttgttcttcaACTTTCAGGTGCAT GTCAGATAGTGATGACGACTTTCTTTGGTAGTATTGTAATGTACGTGCCT TACATTTGCAACTTGACCAGTAGGAAGAGACATAAAAAGATGGAGAATTT CAATCGCTTTCAGTTTTATAAGACCATGTCTATCCTTGGTTGGTTAAGgt aactttttgattttcttttgaaaccCCAGCTGTTACAAAACGTTTAAAAT ACGTTCAAAATGTTAGCTGGATCATGAAAAAGTTTTTGTGCACTGGGTTA TAAAGCAGTGTTGTACGCCAGCTAGATCATGAAAAGGTATTTGTGCACTG GGTTATAAAGCAGTGTTGTGCGGCAGCTTTATCATCTTTTGACCGTTTTG CAGAGCATTGTAATTTGATAATGTGGTTTTTATAGGCTGTTTCATGTTTT CTTGGTGTGCATCCCAAAATAGGACTTGTTTAGATGGGTGACTTTCGGTA TTCCTCTGCTCCATAGTATGTTATATAAAGGCAAATTGGAAATTTACAAA ATCGTTTCGAGAATATTGGAAGAGAATCAATAAAGATCTGAATTATAAAA GTACATTTTCAGTAACATTATTAAAGCTTGGTACTAATGGCGATAAACGC ACTTAGGCGAAATTCTTTACATAAGTAACTAAATAACCATAACATCAATA TACAACTTATAAAAGGAGTAATAGAATAAGTCATAACACTTTCAATGAGG TCAGATAAATTGAACGTATCCAAAACAAATAAATTGCAATTGAGGAAGTT TCACAACTCCGGAGCCTATATGTGAAATTCTTCTCTGTAGTCTACACAAA AATTGCTCTTCATTATGCTGTAACTATttataaaaaacctttttctaaaa ataaatattttgtgaCACTTTATAGTTGAATTGTAGGTCTTAATTAAGCA TAGTCATAAGATAAGTGATCAATATATGATTTGGTTTTGGTGTATTTTCT TTGATTGCATAGTTTGTCGATTTTGGATTACATTCTCTTTAATAAGGGAC GCCTCTGTTTGTTTTTATATAGAATGATGTGGTTGCTTTCAAATTCTTAA GAATTTTTATAGGTCTACACTTTAGAAATCCCGAATTTTAAAACTAAGAC ATCAAAGGATTTTGATTTAGGAACCTAGTTAGgcaaaattagatttttgt cGCTAAAACCATgattctctttctttctttttcctaaatttaaaCGAAAG TTGGAAATATAGTTTAGAAAAATGCCATTCCTAGTCTCGGAATATTCAAA CTCACGTAGCACGTTTCTAATTCTTTCGTAAATTCAGTATGACATGAAGC TAGTTCGTCATACCTTTTCTTGCGCAATTTTATGTCAACATTCATGCACC GCGTGACTAAAACAAACTTGATTGCTCAAGATCATTTACAAaggaaaacg ttttttttatccACAGCCAAATAatcaacactttttttatagttttgtaG TCATATCCAAAAGGGTTAAAAGGGTTAAAAACTTCTAGCAACTAGCTAAC AAAGTGTACCGCACGACAACCACTCAAACCAGCACATGGCCAACATTTCT CTACTGTGTAAAGTCCTGAAATGCAATAAAATTATATAATCTTTTAAGGT CATGACTGAGGCTACACGTAGAAGCATTGTTGTGGTTGATCCTGAACACA CATTTCAAAACAACACTAACAAAGCTTTAGGATTgcgtagaaaaatattt ttattcggCTTTAAATACAATTTCGTTAATGAAGCGATTTTTTCATTAAG AAGAGTTTTTTAATGCGAAAGTTTGTGGTTTTTCATTGAAACACTACAAc cattaaaacttaaaaaacgaaagaaaatttattttacttCCGCAGAAAAA CGTTCCGTTAGAAAAACCGATAATAATATATCATGATGGAATGAACACTG AAAACGACAAGGATTGTCTAACCATGATTATCAGAAAATTcgtttaacat tttttgaaagccTGTTCTTAAACCTGCATTCTTAAACTATGTAAAGCTCT TTGGCATCATTCGTAGTGCaataaaaaataagatttaAAGAAGTCAGTCA AGGCGTCAAGGTCTATTTATACTCCTTCtaaactggagtcgtttataatg cgtgtaatacaatagtataggcgttatatgattattgttacgggatttag tttgtataaactaaaactatagactaaaattgttccctccattacttttt gctttatttctatcACCAGTCTTAATTAGTCGTCTGGCTTGCTAGACTAT ATACTCcttctaaatttgaaaagttgatttatcattttcatcttGATTGG TGTAGAAAAGATTCACTTCTCTTTTCCGAATATGGTTATCAAGTTATTTC CATTAATCTTATAATACGGCCAATCGATTGCACAATACCAAACAGTAAAA TCACAACCTACACCCTGTACTTGAACCAACTCGTTGATATGTTTCCTAAT GAAATCTTAGAGGAAAAGCATCCTCAGTGTTGGCAAGCCAAGGTAAAGAA ACACGAAATGTTGCCAAATGCTGTTTAAAGCATTTCCATACTTGAATTAT TaaaatcactttatttttacttttgaatATTCCTTTATATTCTTTTGTAA CGAACCGTAGGTAGAGGTTATGGAGGCGTAAACAGTCTTGCTTACCCACG ATCCATTTTGACTGTGAAATGGTCTATACGAAACGTACTTGACAATTCTC TACTAATGCTCGCTGTAATTAAAGAGATGGATCAAGGGAGAAATTCAAGG ACAGAGAGTGAAGCCCTCCCTtgctaccttcgggtagataacTATCTATA AGAAGATACAAAACTAACACAAAATGTGACACCTACAATCCAAAGATTCC CCATGTTTTTCGGCAAAGTAAGAGTTGTAAGTATCCCCTCTGCTTCCCAA CCAAAAAAACTGGGACTGAAGATTTATAGTTGATGGTTACCTAAACTTTT TCACGTCGTTTCCGAGATAAAGAGACTCAATCGCTTGTGGACACAAAGGC TGTTAGACCTGCTTTACACCACAGCAATCACAGCATTTCCAATCACAAAA GCAAAGTGTGAATCTCAAGACTTCATCTTGCTTCATCATTGCTTTTTGAT GCTCCTTTcattcaaactttgaaaatttcatttatttccTTAAACGACTT TCTGAGATGCGTGCGTGAACATGAATCGAAAACCAATCGAACTTTTCTCT ATTGAATGTAACGTAAAAGTTTTTCGTTTCGTTTCATGGCATGCATTCTT GTATTAAAtgcatatttttatgaaatacacgctttttttttataagaata cactttataagaatgtccatgatgaaaatggccaaaaaattaagaatatc ctaagaatatcaccatcatggaNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaatgctgtaaga atattttaggatgattttcccaaaaaagttaagaatatccatgatgaaat ggatttacaccattcttataaaaaaaaaagcgtgtaacgaACACTCATCG ACCAATTAATAACTATGATTAAGACTGATATAGTTTTTTTGACATGTGAT TTTCCCTCCCTTTTTTTTGAGAAGGAAGCATGAAGCTCGTTTATCCTACC CCTCctattatttcttctttttgagtCGTTACATTTTAAGTTTAATTAGT tagattttgtaattatttttagaCTGTATATTCTAAGACTGTAAACCAAT TTGGGTATGGACTTAATTCCGTTCCTTTGCTTTGTGGTCTtcatttttga tcaattttgtcaatttataATGTTTTTACTCTTCTGTTTTAACGAAAAGA CTCATCTAATATCTGATTGCATATGTTATTAATAGGGCAAATATCTCAAC TGATAAAAAGTATGCGACAAACTCGCGAAATAAAACCTTTTGGCCTCGAA ACGAcacaaattagtattttgaatttaaaattgagCCTTGGCTTCACTTT AGCTTAGTGAtatcatttcaaatatttaaccATTGAGAAAGCAAGTAGAC AGTGTTAGAATTTATCAGGAGAGATAATTGAATTGTCATACTCACAAAAA TACTGACATTTAAACCGTTCAAGGACCGACGTTCGGCCCTGGTAACCTTG TGGCGCAAGGGTTGGATTAGGTGCACAATACTAACCAACTTGGTTTAGTA TGCAGACGGCTAATTCAGACACtgcaaaaaattatcaaaagaaaagacAA ATTTATAGTTTATAAAAACTGATATTACCCTATAACGGTTATCGTATCAT CATATGTGTGTTatatattatcatataacacccatatCACTGTACTACAC GGAATCTAGACGATTACGGTCTATATAACCAACAGTAAAAGATAAAAGTT ATGCAATACTGAACCATTCAACAAGAGTATAACCAACCAAAAACTAATAT GTTGACGTTTGCTGACCATAACCtccttttttttccttttcattcgAAAC AACCCTTTCATTTCCTTCTCTAGAAAAAAACATTCCATGAAAATGAATCA AAAGTAAGCCTTTCCTTCCTTAATCACTCATTGTATGGCAGGATTGCCCA TTCCTTTTCTTCCTTCCAATACAGACATCTCTATTACCCGAGAATCAATT ATCAGTATCAAAAATGTTTGATACAATATCCatataaagaaaatttcaaa agggCAACGCATCGTAtgtttagcttcaaaataattttgtaaGGACTTTC TTCACATAGTATTGTATATTCTCGGTAAAAAAAAGCACTTTTACTTCTTA TTTACTACTTCTAGAAGCTCACATTTGAATATGAAATATCTTCTTCTAAT GGAATTCGCATTGATTGTTTTCAACAAACGGGGGATATTATTGGCACTTA CTCGGCTGATTTAAAGACCCAAATTGTCTTGGCCCAATTAAGCTAGGCAA ACAATGCAATTAAAATTCCTATCCATCTTTTTAAGTAATTTTATTGCTGA CAATTTTGCTTTATAGTTGTCCTATCTgggaaaaatgttttgtttctgAG ACCGAAAATTGAATACTGTGCCAAGATTTCTTTTGTGAAGATATACTTAT TTTAAATGAGTttgtttacacgttttttttttataagaacgtcaaaaatt ttcgaagccttcggatgttcttagttttttggatttgaagcctaaaaatg ttcttaaaatgttcttattttcagcattttttgagcattttgatgtaatt tcttaagaaattgcatgttttaaagtctccaaagccttagtatgttctta gaatgttcttaaatttttgggccttgaagccttatgttcttattatagtt tgttcttataaaaaaaaacgtgtagtgcaAAGGCCAACTTGAAATGACCA ATTTGACTGGCAATTTAAACTCAAACCAATGGTCTGATTCCCTTTGTAAC ATTTTTGTACCTTCTAATCCTCCAAATTTTTTGGTAGAGCTAACTAGCTA ACTTGTCTCTATTAACAGTTGTTTTATGACCTCAGTTGAATGCTAGCAAA GCTAAGTTAATAATAATCTATAAGAACCATGTGGAAATTTCTTGTTTCAA GTGGGGTCCATCTgtggaaatttcaagataaaaaaagtatttAGAGCCAA TAACTATCAACCATTCACTTCAGTTTCAATAAATGAAAATGGTAAATCGA TTGTTGAGATAACAATCTAAATTGTCTTCATTAAAATATTGAATCCGAAA ATTTGATTCGCCTGCGTTGGCAAATAAATTCCCTGTAACACCCACGCTAA AATCATTCGAGGTGGCATTTGACCACTTATATCCggtgtgacgtcatttt gaagTGAATTAGCGCCACTTAAGAATTCTCATTTGTAGTTTAGAAATACC ATTtaaaccctttaactgccgatgtcagcatatgccgacatgggtaCTTT CGATTTATTTGCCaatgtcgggatttgccgacatgggcactttGCATCCC TTTGCCGCAAAATTTAacacttctacaaagattttgtattagatggtttg aaatgaaaaaagataatagttaaaagcttttctatgttgaaaaataacta ttcagCAATCTTCAACTCACaattatagtccttggctgatacttcatata ttattcagaaaatgaagtcaaaatcgcTACCTTTTTCCCATGTCGGTTTa tgccgacatctggcaaataggtcgaaccttctttttttcccgcggcaaat aggtcgaaccttaaaaaatacgaacggCAGTTAAATGGTTAaagcaacga tgtaaaaataatagataaccaacttgccttgattctcaaaaaacatccgt gctacgtttgtaaaaatattaatgacattttgcatcgtaaaaagtgcaat taaataaaaacttgcttcatttggaaaccttctattggacagaatcgatc acgtgatgtacatttttccaaaatttgggttagaaaaagtgtattttcct ataggcagcctcacagaaggaattttttaattagatattactgttctaca gggtgtccctaattaaagtatcgagtttgaacatgcgattgagtagaaaa gtttgtgtgtgttatcgctaaaatataagaacgttctccatcacacNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNagagggagagcttaaaata caattttgtgaacacgcacataaaactttctactcatagttgtgtttcga ctcgatactttaattagggacaccctgtataaacattcatctgtttattt tgtatcatgcaaccttcatgcacttttcatacgtgagatatcgcatttca agTCACACATATATTTTTCAGATAACAGCATTTTATGAGCGTTTATTTAT CCAGATGAagattaagtggtatcaggccgatccgtagtcaatttgtctaa agattggtacctttatcttttgaaaaaaattccaaaatttgcagtaaata ccaatttaaatttttatcaattcagtggatatcaaaaagtgtgtcaaaat ctagctaaaaggATAACACGCACTGCACACAGAGCTTTTTAatagagtgc tcatttcaataggaaaacaatggttgttctcttgggagaagtgccttcta gaggtagttggttatctattatttttacatcgttggttaAAGTCTATTGA GAAGATTTGTAACAGGGCCATGGAAGGAGATTTTGATGTTAATTATAAAA TAGTCTGGTGTAATTTCAGGCGTAAGAAATTAATTTCTGATAAATTCTGT TGCCATGATACCTACAAAGGTTTTACTGAATGGTTCTAAACAGAAATGGA ATAACGCTTCATAAGTATTAATGAAATACAGCAGAGTCTCTTTaaatcga acctctataactcaaatgtctccttaactcaaacagtTAACAATGCCAAA TAAACCATACTCCTTAtctcgaattttttcaaaacttgaacaAATGTGTG TCCCCCTACGTTTATTCTTATAGGAATGAGATCTTTTAGTAATGCCAgtt ttttggctaaaaaaatTGCCAGGCCTTATTCACGGACCCTCTATTAAAAT CCTATCTACCTTCGAACCAATCACATGTGGTTGCGTCTCACGAAAGATGC TACGGATCCAAAGGGATGGACAGGTCCTGTCAATATACTTCAATTGGACC GataaatatctttgaaaatgCGGCGTTAACGTAATAAAAACATAAAGAAC TCATTAAATTCTTCAGTCGAAACCTGCTTGAACCAATTATAAAGCGAACA CAGAGGGGCAAAGATGATCGATAATTACATGTAAAGAATTTTAATGACCG GAACCTTAAATAGCACGTAATATTCTACTCACTATGTGCAAACAATTTCT TCTCAAAAAAACATCTGGAAATCAATTCGTGCAGTTTGACCTTTCTTTGA ATGAACCATATCCAAGGAGAAAAAAACAGGAATGCTTTAATGACAAACAT CACTGTTTGAGCGGAAAATTAATCCATGTTAATGCATTTAATACactttt ctcgagatgcataaattttttgttgtcctcgttttcaaacagatttcatt gctatgaaattatacatttaaaccaatttaaattcccaaaaggcaaacat taactctaaaacaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNcaacacaattatcattgtgaatatgtaa ttttatagtaatgaaatctgtttgaaaacgaggacaacaataaatttatg catctcgagaagagtgtattagcCGTGGAACTTGCCTATAAACATTCTAT ATTTTTTCTTACATTCTGCCAACCATTAACAAAATCGGTCTGAAATAGAG CCATTTTAAGGCATATTAAAGAGGGGATCGAATTTTTTTCCGTCGGTGCC TCTTTAGTCACCATATTTATGGCCCTTCTACTTTCCAGATCCATCATAGT CCCTGTCACAGCAATATTTCTGTGTTTTTATTCATGTATAAAGTATATTC AGATGTTAGCTTTGTGAATGTTTTTTCAACTAACGAATATGGACATGCAA TCTGTGTATTTTTTCCTGCGAGAAATATACGTTGATTACTGTTATTTCAA TGTACacaaggaaaatttttaaacggaaaatttcattgatttataaATTG ACCCACATCGAGtaatgctaccattagggtagcacttttcaaaaaattat gatCAGAAATGGCGATTACAGCTTgcctaatagaccttttcataaattac gtcacgaacatcacttgcctcgttttgaaattattgctatggtgattaac tcccagcggattttaatAAAACTACTTTCTATTTATaaaaaaatcattta atgtctcaagggacataatcaccatggtaattgtttgaatacgaggcaag tgatgttcgtgacgtaatttatgaaaaggtctattgtctcTTTCTAATCT TCTTCCATAGATGTGGTGCTGTAATATGTTCAGTAATTGGTTTGAAATAT GTGGCAGTCTCATTCTCCGAAACCATCAAATCGTCTGCACCTTTGTTCAC TGCTCTATTCGCATATTTCCTTCTAAGTAAGTGATTCAACATATTTCTAC ATTCGTTTCTTANacagatttcattgctatgaaattatacatttaaacca atttaaattcccaaaaggcaaacattaactctaaaacaaaagtacttgaa attcactGTCACNCCGTCtcatcgagacaaaaataccattagatgctaga aatttccaacatgtttcggTCAGGGCCGTTTTCAAGGTGTACTCGTTTCT TAAGTAAATATATTCATCCGGTGGCTGTCGGAAATTCTAAAGTGAGGGTC CACGCTTACTATATATCAGCTCCGAGTTACTtacctagatcagattacct aATCTTAGCTACTCTATTCCGTtggagttggcggtgaccggtgAGCGAAC CAGAAACCCTTTAGATTGCGAGGTAAATGCCTTGCCGATtgaattgttgt tgttttttttgcaaaacccTACCTTTCTTAATTTTGCGTCTTAGAAGAAT CTTGGAATATCCCCANGTTTTCAAGGTGTACTCGTTTCTTAAGTAaatat attcatctggtggctgtcggaaATTCTAAAGTGAGGGTCCACGCTTACTA TAtatcagctcccagtaacttaccacctagatcagattacctaATCTTAG CTACTCCATTCCGTTGAGTTGGTGGTGACCGGTGAGCGAACCAGAAACCC TTTAGATTGCGAGGTAAATGCTTTACCGActaaattgttatttttttcgc AAAACCCTACCTTTCCTAAGTTTGCGTCTTATAAGAACTTTTCGGCTACT ATTTACAAAGTATCCCCCGAGAAAGCATTCGAAGctgaaaagatttaaaa aaattaacgcTGATAGTCTTCAAAgatctatttttcttttactttataTC AGAGGAGTATTCTGGCATTTATGTCAATTTGTCACTGATGCCGATCATGT TTGGTCTAGCCATCTCAACGTATACAGAGCTGAGTTTCAATATGACTGGC TTCTTAGCTGCTTGTACAAATAATATTTTAGATTGGTAAGTCGTTCACAT TAACATTTACGACTATTTTATGTTCAACTACTCTTCTATTATCATACTGA AATTACATTGAGCTTTAACAAGTATTTTCAGCAACGAAGATTTCAAAATC TAAAGCAATTTCGTTACTACATttaagtctccataactcgaaccttgATA AACTGGAATGTTTCCTTAGCTCagagttttcaatttttcaagttatcttT TCCATTCAGGTCACAAACCCTTATAAGTGAAAGACTGTATAACTCGAATT TTTATAACTCGGAAAAACTTTAAGTTCCGCGTGCTCGAATCAATGCAATC TTATCATTTTTATAACTTTTCCGAAATCCAAAAAAAGGAAATGGGTCTCT ATTGAACTACTATAATCAAAGACCTATATCTAGCTTTTTTTGACGCCGCC GGAAAATCGGTAAAAACCACTGTTTGCCATAACATAAAGGTGGTCTGCCC TTAAACAAATTATTTCCTCATCGCTACCAATATGTCTACGTAACGATGTg gaagatgacgtcatttttcaatgCAATGTCACCGCCTTCCGCGTGGAATA AAGTTTTAAGTGTTAACACCAAGACGGAATTGCGACACTTTTTCTTTGTG ATGTCGTAGTCCagatagcctatactagacgtcacggctttttttctacg ctacatttcccggtttttggtgaggtactcGCTATAGTCCAGACAGTTAA TTGAGGTGATTTGAAAGTTGCGATCGCAGGCCTGTTTCTTAGAACTTTTT ACGGAACACAACAAAAGTTTGGCTaaacgattttttttattgtcagCAAT CGAGTACCTACAGAAAACCTTTTAAAGCATTCAGCCATGCCAAGAACTTC TTAGTCTGATTCCCAGACCTCTGAAGACgtacttcctataagaaactttt caaTTTAAGGATGAGCAGAAACCTTAGTCTTTGGATCCGTCAAAAATctt gctttttgaaaatatttcaaatacagTCAGCAATAATTTTTAACACTCGC TTCTGAATAATTTTAAACTTACTTGATTCTTGACATTCTtactgaaaaac ttttttaagagGTTAACATAATTATGTAACGATGCCAAGAAGTCGGCCAT GTTGTTTGGCAACGTACAATAAACAAAACAGCTAATTAATGAGAGAATGC CAAACAATACCACGTAAAATGACTATTCAACTTCATCCCACTCAAAAATT CTCGTGTTGTTTTCCTTATTTGTGTCCACAGAAAATTTTCTTAGAAAGTC ATCAAGGCTTTCCTTAAGAAAATTAATTTCCTTTGAGAGTAATTATTGAT TGCTGACTGAGcaaattttaaactttcttcATGCAACCACttgactagag tctacttctgactgaactttgcttatTGATAATCTTTGATGACGCCGAAT CCAGTGAATTAGGCGTTTGGTGAGGTCGTCATTTCGAAGGAAAAGAAATC gcaaataattaaaaaacaacTTAATGCTGAAAAGTTTACTATATTGTAGA GGCCCACCTTGGGCCTGTGAGCTTGTATACTTCATAAAAATTATAATCCg aaaacttcaaaaatcttaATAATTGTCTCGCTAAAAACACGGATAGTCAC TATTCGGATTGCTTGCTCGATTCCCAAGTAGTTTCCTTTCTTTTTGACCC CCAAAACCTTCCTACCAAGTCTTCGTCCTTTAATTTATCGCTGTCTCTAA TTCTCATTCTTTATAGCATTCAAAATGTGTTTTCCAAGAAGCTGCTATGT GGTGACGATATGAAATTCtcgtaagatttttttttttcacttcccTTTCT TCTCTTCatggtttttttattttgggtATCAGATAAGTTTTGGTCATAAA TTAACTTCATAGGGAGTTCGGTTGACCAGAATTAAAAATGTTCCGTATTA GACAAATTTCTCTCTCAGTGAAGTATATTTTAAAGAGTCTCAAAATTCTG CTAAATAGttcaccaaaattttttaaagaataatttgtgttaatttgctg tgtaaaatgCTTTTTCTGTCTCAGACGAATAACTTTACTTTCACTACTGG GTAATGCTTTTGATCAAATAGGAATACGAACCCTTTGAAGAGAACTTATg gccattttttcttttgtttttcagaCCATTAGAGTTACAATTTTACACAA GTGTTGCAGCAACAGTTGTCCAAGTACCTTTATGGTTTTTCTTCAttgta agttttatttattttaattgTTGACTGAATCAATTGAACAGATTCACTCA ATCCCAGATCGTGAAGAATTGCATCTTGTAAGGAATNTGAACAGATTCAC TCAATCCCAGATCGTGAAGAGTTACATCTTGTAAGGAAACTCCTTACATT TTGTCGCAAGATCCGATATTGTTCCTTTAGTTTTCTTTAGTACGGTCTCT AAATTTATTACCATCAccattaaaaagttttaaatgaaaaaagtttcatt GGATATTATAACTCAACTTACATCCAATTAACAAAATACAGATGAAAATA ATAGTTACCTTTATCACAAAAAGaacgaccaagaaaattttgcaaagaaA GACAATTTGCTGACTTGCAACAATTACTCCATTCAATTTTTAAGCCGTTG TATTCTATTATTTGGAACGTTAGACTCCTCTATTATTTATGTCCAGATCT GGTCATCAAAAAACCTAGCCACCCAATTAAAATCGGTGATACCGTTAATT ACATACCCGTTGTCCATTCGTTTACACTTTCAAAAACTCAATCAGGAAAT CTTAAGTATTATTTAATTAACCCACAAAATGTAATTTGATGTCTTCGCTC AAACCCATTGcctcagaaaaaaatgaatgcatagaGTTTTTTTATGTTGC AGTAACGTAGATAGAAAGCAATTGAAGGAGAGCGCTCAATACCATATAAG GAATTATGAAAACTACAATACTCTTAACCGTAGAATTTCCTTTCTCCTCG TATTCCATTTTTCCGTTTTCAAAGCGAGATTATGTTTCTTCTCCCAACGG GCAAATGATTTCCGGAAAATTCATTAACAAACTCACTTTTTCTGTTACAA TGTTTTTTCAGCAAATGCACTTAAAATTGAACTTTCTGCTTTGCATACCA GCAAATCCTATATCATATGAGGGGATTTAGCTTGCTTCTTTTGAAGGAAC ATTCCGTCTTATTTAACCATGACTTTTAGGCCCCCAGCGGTAATCACGAT ATcgcgcaaatttttgtcttcaatcacgatcatgtaaaacagcaaaaaaa ttggaTAATCACGCATTCCTTTGAAAAAGACCAAATCACACATCACggtt caaaaatctttcaaatcacgatcacgttttgacctctgatcacaCAATCg cgaaataaaaatttccaaatcacgtaatcacgctagaaaaaagtccctat cGCGCCATTACGAAAACCGCTTGGGGAGGGGGCTCCTTTAGATATTTGAA ATTCCCGATGATAGACAAAATGCAAACTTCAAGTATCGAATTGTTTATGT ATGTTTGGACGACTAAAGTTTAAATTAGTGCTTATGTGgacatttttgaa catttcTTTTTGAACATTGTGTAACGCTtgtaaatatctttccaacaatg gCAAAAATAGTCTGTTCCGTTACATCTGGATTTCTTTAAAGACTTTCGAA TACAAACCTTttctacacccccttctcacggaCCCGCTGGGAATTTTTAA GCTagtggggtaaaaataacggaccgaAACTCGAcgggattgatattcct atgttttttatggctggagattAGAATTATATTGTTTTCGAGCTGgaaaa ttcagtgaggatgCAAATTTTTAGTAAGGATTTGCTCATCTAATTACTta cagtggggacaaaaattagagtataattttccactggggacgatattttg atcaatttttccagtgggaagggatccgagtgggtctgtgagaagggggt gttttcttTTCActatcaaaacaatgaaaaatagaGTGCTTGTAAAACGC TACTAAAATCCAAATGAAACTAGATGGACTACAGATTAAAATCATTATTT GCGAGAGATGAGAAAtggaataattatttttcatctACTATCATGGAAGA GTAGAAGGAAGAAGGAACTGACTCAGGGGGATTACATTTTTCGCTGACTT CCTTAATGCGACTTAATATCTTCCTTGTTCGATGTCGAAATTTGTACAAA AATATACACAAATATTGGCGCCTAGAGAAAATTCAAAGACATGAAATTAC TGTTTGGACCCTTAGGGGACTTTGATTATGATATTTTGATGTTGTTAGAA ACGATTATATTGATACCGATATTTCAAACAACTATTTTCCCAGACGATTA TACATGTATCATTTGAATTTAAAAGCATATCCAAGATCAAAGCTTGTAAA AATCAAAGCCAATCCTGAACTACAcgtttttgttataagaacataaggct ttgatggctaaaatgttaagaacaagttaagagcataTTAAAGCTTTGCA GTCTCTAGAACAtcgaatttcataggaaaatggacaaaaatactcaaaaa atggcgaaaataagaacatgttaagaacatttttaggcttcagactcaaa aagttaagaacatcccaaggaaTCAAAGATATTGcctgttctcataaaaa aacgtttaatcTCATAACAAAACATTCATTCATTCTACTAGCACAACACT CTACTCTAAAGGTTTGCTGATTATAAGACCTGACaagcttttttaaccaa aatatttaaaaccaaATTGGATCATGTCTGAAaatgaaagcgaaagcgac tcAACGAATTTCAaagaataaatcaaaaaatggtCGTCTTTTTGCCTCCT GATATTATATTATATGTTAATCATTTTATAAGCataattattcttaactt caatcatgcacgtttttttctaataaaaaactatatagaaacataaggct tcgatggccaaaatcttaagaacaagttaagaaaattttaaggctttaat acccaatttctcaggaaaatactcacaaaatggtgaaattaagagcatgt taagaacatttttaagcttaaactcaaaaagttaagaacattcgaatgct taaaaaatcagatgtttttatagaaaacgtGTATTACAGTGTCTAGAAAT GTTATTCATTTAGGCTTCAGTCCAGTACACCAATTATCGTTAGATTCTGA TCAGGAAGACGTTTGAGCCTTCGTCACCAAGATGGACTTAATTGAAATGC TTAGAAACGGATAGCATTGAATgagtttattttgaaaattaatggGCAAC TATTTTTGTAAAGAATAGATCAAGtccgttaattttttctttttgtcttt gatTTGAAGGAAATAAATTAATCGTTAAGCTGCTCTTGGAAACCTAATTG CCAACAAGGCCATTAACTCTTCCTTAAACCATTATAAACCAGACTAAAAT TGTGCATgattatttgaaaattataaCAAATCTTTCGGCTTCAATAAAGG TGTTACTGGGTGGGATGTACCGATTGTCTATTTCAAAGTCAAACTTTTTA CGATTGTTTTTAGACCTAGTACCCCCAATCTTGGGTTAGTCATTTAATTC TATCATTCCTTTGGGTTTATGCATTGCCTACCTAATAACAGTACTACTAC CATTTGAAATTTGATgatcccaaattgaaatattcgattaaattaaagag agaATTCTCAatatacacgttgtttttttttagaaacacacttttaagaa acatgaggctcagaatgtctaaaatctaagaaacatctaagaaacatgat gaggctgagaatgagaaaataacatttttttaattcgttttttaaagagc cttccaatccagccttccatgaggctgaatacgtcaaaaagtttagaaac atgtaagaaacatttaaggctcaaaaggccgatttcttaagaaacattga ggctgcttggtaaaactagtttcttaaaaaaaaacacgagtatttcgacc atgattgtatccTGATAGTTTGAAATCTTGTCGAAACCTTAGTTATATAT AACCTTGAAATATACCAATGTAAGTGATACTTTAATTGTGAACTAGGact gtacagggtgtccggaaagaaagttcttgtgtgttttaacactaaatttg caatgtttatcaaagtttctatctgtgtcatattaattgtcatgagacat cttttatgaataacttttacaaaaaacaagcctcaataactttaacgtca tgaaaattgtaaagaaagttaactctttttaatcataatgacttttggaa aaaaattattttgttggtatatattttcttacattttgttaaacacaagc aacaaccttctacttagaatcatgttcgaactcgatatttttttcggaca ccctTTTTTCTACGAAGTCCTAACAATGTATGAATAAAGGTGATTTCTCA GTTATCCTGTGTCGTGTCTAATGTTATCAACAAAGTTAAGTTGTCAAGAA AAACTGGCATTAATTGGGCTGGCAATGTTCCATTCAAAGTTAAAATCCCA TGACACAAATGGCTATTTATTTTGatggtttcaaattattttaaaaacac tttAGAGTAATTTATGATGATGGACAGCGTAGGAGTGGGTAGACCCATAA ATTGAACATTCCTCTTTTGTAACAACcggttaaaatcaaattatatgTAT CTTGATTTTAAACACTCATAAATCACAGTTTTTAAAAGATCGATTATCGT GGTTTAATTGATCATTTTAATGAGGTTCCAGAGAAATCACTGCTCACACA AATTGccaaagtttcaaaaagatAATGACATTAAATACCTAATgtaaggg aagaaatttcggTGCAATTTGGccgaatttattttggcgatttaataaaa tttctaaattttgcgagtagaaattttggcgaatgacccatttttgttca atattttagctgaaaaaagagAGAAGAAAAGGGGTTTTAGGAGAAATACa gactaaattgaaagaaaattaaatttgacgagaatttattttggcaagTT ACCTATAGATTTCAATTTGGCGGAAAGagattttggcgaatttggcgaaa ttTTTAGGCAAATATTCTTTAAACGATGGTGTAAGAATAACGTTAAACTC TAACTCgtttcatttttataagaacaatttgataaGAACAATGAACCTCA TGGATGCCAAAAATAAGACGCACcgtaatcacgacgacggattGTTTcca gcggttcctttgttttagaGGACTAcaacttttgaaatctagcgatagat tttagtttcaatccggcgtttgtgtaaaaactacgcgcgggcgttctgga tgggaaataggtGGTTTCATTTCatatccaggagtctcgcctctagccct ttgggcttgaaactcaatggtcggTACCCGCAAACAAGCCATTGTAGtat tgtagtgtttgaaactttacCTAACCGACAAACGGCGCTATATCATTAGT GTACAAGCGaaactagatctagcgctctctccgcgggtaccaattccaaa aaaactccgatcataatattttgctcggccggcattgagtaacttggtcc aggggtCAAAGGTCAGTgggtttgatcaattagggggggggggtccaatA AAGATGTGAGGTAATaatattttgatcaaaacatCTATCATATTTCACGC GTTTagataatctttttttttttaacaaaatatgTCCATGTTAatagcaa aattttaaaatttggaaaataggGATTGTGCTATAAATAGGGGTTCAAAC CACTCTGGGCGCGCTCCAAGTGCCCAAAAGTAAGAACAGAttcttttaaa ataataatGGGTCAtcccattaaatttccatacccCTGTATgagtggacg aaccttttcgaGTCAAAAACATCTCTTGGATATGTGTGGATTCGcctgga aaatgtcaaaatttacaaaaaaaaacttggaaaatttcttcccttttctt aaagtgacggtggacgaactaaaatcagtcttttaccccctgaaaattgT AAGATaatttttacccccccccccggagaaATGAAAGGAACACTCCCTTA GACCACCTTGAATTATTCGTCCACCCAATGTATGGANNNNNNNNNNNNNN ttttccccccccccccccctggagaAATGAAAGGAACACTCCcttagacc ccctggaattATTCGTCCACCcaatgtatggatataaaatggaatggccc aatagcAGTGAACTAAACTTGAAAAAAGAATTATactcttcatttaattt tttgtagGATTTGACGACAAAGTGGGAGACTACAGATTCATACGTAGCAT CCATGTTGTTATTCAACGGTGTCGTTTTTTACTTACAAAGCCTCTTCGCA TATTCATTGATGTCTCTCATCTCTCCTGTCACTTTTAGGTAAGTCATTGT GTTTCTATTTTACTACACGCCTTTTTCACAGACTCGGTGGACcccctccc actggaaaaaaattgtccccaatggaaaattatactccgaGTTTtgtccc gctgaaaataatcaaaaaaacaattccTCACTGCAAAACACCGTGCaata ttttctataaaaaaacatgataTTCAAATCTCTAGCTATAAAACACGGGA ATGTCAATCCCAATAGAGTTTCAGGCATTTATTTTTACCatgactggctg aaaaatcctaccgggtctctGAGAAGGGGTGTTTTAGTGCACGCCTTTTT TATCGGAACAATATTTATAAGAAAGCTGGGTTGAAAGGTAGATACATTTT ACTTGGTTTCGTTATTAGAACATTATTTATTAGAACAGAAATATAAATTT AGAATAAGTTGCTAATAGAATGCTGATTTTTAGgccctttgggctttttt ctttattttaattatttaagTAGAACCCTTGAAGAGcttgaaaatcattt tgaaagaattcagGGACGATCAATCGTCCAATCAGAGGTTCTAGACTTTT TGAATATCTTGTAAGTTATGTCTTTATAGtgtcatattttttaatatttt tactttcGGGTTCATTCAGGTCATCCACATTCTTCTAAAATGGTTGATTA GTTGTAGATCGAATTCTTGATGATTTCTCAAATAGTTTTGATAAATCGGC TagccaaatttgaaattcaattcaaACAAGTAGTAGTAAATCACATCAGT TATAAAGTTCAAAACAAAGTAGAGAATGTGTGCTCTCGGACCAGATATTG TGTTCGAGGTACAGAAATTTTCCTAGATTGTCCACAACTTTTCATAGGGC CAAAAAAGGTTTTCAAAATAGATGTGCTGGTCGCGTAGTTTGACTAGAGA TTCACATCGTAAAACCTTAAACAAACGATCAAATCGCTTATCTTGCTTCA AACCACCTGATAGATATAAATAATCCTGTAtttcagtttttcaaatttct attcAAAACAACGTAAGAAGTACGTGAGATTATAAGCATCACGGCAACAG CAACCAAATGGAGTGagagaaaatcaaagaattgAAAAGAAGAGCGGGCA AGACGAACAAAGTTCGAAAAACGCAAAGTCAAGTGTAGGCTGctcgcatc ccctctgatatgcaATAAACTGTATCTTAGAAAATACTTTAGAGTTTAGA GGCCCATGTgagtttgtaatttttttgtgaTACTAATATTTGATAGTTGT TATAGTTCATAGAGATTTGTATGTACCATAGATGTCTTTAACAAAATGTG ATTGAAACAGAAAACTTGTTTCAAAGAATGCGAGTTACACAAGTGTCTTA ACAGAGGGGTCAGAAAGACATCCCGAGTTAAGTAGAATTCGAGTTAAAGG TGCGAGTTAAAGATTCCGCTGTAAAGACTTCGTGTTACAAAAGTGTTTTA ACAAAGGGGCCAGAAAGATATTCCGAGTTAAGAAGAATTCGAGTTAAAGG TGTGAGTTAAAGATTCcgtaaaatatcttttcacttTTCACTTGTCATTA TTTTTAGTGTATCTAATACAGTTAAACGTGCTGGTTTAATTTGGTTTTCA ATCCTGGTGTTTGGTAACAAAGTCACTCTTTTGAATCTGTTTGGTACAGT GTTGGTTGTAGCTGGTGTGTTTTTGTATCAACGAGCTCGTATGATGGAAC AACACAAAAGGGACCAAATGATTGTTGAAGAAAAATTAAACCatggaaat aaagaaaaagg

Coding sequence (CDS) from alignment at sc0000002:757087..780347+

>TCONS_00000443 ID=TCONS_00000443|Name=TCONS_00000443|organism=Clytia hemisphaerica|type=CDS|length=13464bp|location=Sequence derived from alignment at sc0000002:757087..780347+ (Clytia hemisphaerica)
ATGTCTAACAATGACAAGAATCACACAACCAACCCTCATGATATTGTGAT
AAGCAAGaaTAATGAGGGAGGTCTTGAATCACCGTCCGATAAACATGCCC
GAATATATTCTTCCGATCATTTGAATGAAGTTGTACCACATCAAACAgat
gaaataattcttgaaagaGAGAAGAGCAATACACGACGCCATGTGCACAG
AGCTCAATCATTCGACAAGGAGAATGCACAGAAGGCTTTATTTACACCAG
TCTTCATGAAGCAGTGTATTGTAATGAGCCTTTGGTTTTTCACCAGCTTT
GCCAGTATCGTTTTAAATAAGTATTTACTATCAACTCTGGATGTCGATGC
AAGTCTTTTAGGTGCATGTCAGATAGTGATGACGACTTTCTTTGGTAGTA
TTGTAATGTACGTGCCTTACATTTGCAACTTGACCAGTAGGAAGAGACAT
AAAAAGATGGAGAATTTCAATCGCTTTCAGTTTTATAAGACCATGTCTAT
CCTTGGTTGGTTAAGATGTGGTGCTGTAATATGTTCAGTAATTGGTTTGA
AATATGTGGCAGTCTCATTCTCCGAAACCATCAAATCGTCTGCACCTTTG
TTCACTGCTCTATTCGCATATTTCCTTCTAAAGGAGTATTCTGGCATTTA
TGTCAATTTGTCACTGATGCCGATCATGTTTGGTCTAGCCATCTCAACGT
ATACAGAGCTGAGTTTCAATATGACTGGCTTCTTAGCTGCTTGTACAAAT
AATATTTTAGATTGCATTCAAAATGTGTTTTCCAAGAAGCTGCTATGTGG
TGACGATATGAAATTCtcaCCATTAGAGTTACAATTTTACACAAGTGTTG
CAGCAACAGTTGTCCAAGTACCTTTATGGTTTTTCTTCAttGATTTGACG
ACAAAGTGGGAGACTACAGATTCATACGTAGCATCCATGTTGTTATTCAA
CGGTGTCGTTTTTTACTTACAAAGCCTCTTCGCATATTCATTGATGTCTC
TCATCTCTCCTGTCACTTTTAGTGTATCTAATACAGTTAAACGTGCTGGT
TTAATTTGGTTTTCAATCCTGGTGTTTGGTAACAAAGTCACTCTTTTGAA
TCTGTTTGGTACAGTGTTGGTTGTAGCTGGTGTGTTTTTGTATCAACGAG
CTCGTATGATGGAACAACACAAAAGGGACCAAATGATTGTTGAAGAAAAA
TTAAACCatggaaataaagaaaaaATGTCTAACAATGACAAGAATCACAC
AACCAACCCTCATGATATTGTGATAAGCAAGaaTAATGAGGGAGGTCTTG
AATCACCGTCCGATAAACATGCCCGAATATATTCTTCCGATCATTTGAAT
GAAGTTGTACCACATCAAACAgatgaaataattcttgaaagaGAGAAGAG
CAATACACGACGCCATGTGCACAGAGCTCAATCATTCGACAAGGAGAATG
CACAGAAGGCTTTATTTACACCAGTCTTCATGAAGCAGTGTATTGTAATG
AGCCTTTGGTTTTTCACCAGCTTTGCCAGTATCGTTTTAAATAAGTATTT
ACTATCAACTCTGGATGTCGATGCAAGTCTTTTAGGTGCATGTCAGATAG
TGATGACGACTTTCTTTGGTAGTATTGTAATGTACGTGCCTTACATTTGC
AACTTGACCAGTAGGAAGAGACATAAAAAGATGGAGAATTTCAATCGCTT
TCAGTTTTATAAGACCATGTCTATCCTTGGTTGGTTAAGATGTGGTGCTG
TAATATGTTCAGTAATTGGTTTGAAATATGTGGCAGTCTCATTCTCCGAA
ACCATCAAATCGTCTGCACCTTTGTTCACTGCTCTATTCGCATATTTCCT
TCTAAAGGAGTATTCTGGCATTTATGTCAATTTGTCACTGATGCCGATCA
TGTTTGGTCTAGCCATCTCAACGTATACAGAGCTGAGTTTCAATATGACT
GGCTTCTTAGCTGCTTGTACAAATAATATTTTAGATTGCATTCAAAATGT
GTTTTCCAAGAAGCTGCTATGTGGTGACGATATGAAATTCtcaCCATTAG
AGTTACAATTTTACACAAGTGTTGCAGCAACAGTTGTCCAAGTACCTTTA
TGGTTTTTCTTCAttGATTTGACGACAAAGTGGGAGACTACAGATTCATA
CGTAGCATCCATGTTGTTATTCAACGGTGTCGTTTTTTACTTACAAAGCC
TCTTCGCATATTCATTGATGTCTCTCATCTCTCCTGTCACTTTTAGTGTA
TCTAATACAGTTAAACGTGCTGGTTTAATTTGGTTTTCAATCCTGGTGTT
TGGTAACAAAGTCACTCTTTTGAATCTGTTTGGTACAGTGTTGGTTGTAG
CTGGTGTGTTTTTGTATCAACGAGCTCGTATGATGGAACAACACAAAAGG
GACCAAATGATTGTTGAAGAAAAATTAAACCatggaaataaagaaaaaAT
GTCTAACAATGACAAGAATCACACAACCAACCCTCATGATATTGTGATAA
GCAAGaaTAATGAGGGAGGTCTTGAATCACCGTCCGATAAACATGCCCGA
ATATATTCTTCCGATCATTTGAATGAAGTTGTACCACATCAAACAgatga
aataattcttgaaagaGAGAAGAGCAATACACGACGCCATGTGCACAGAG
CTCAATCATTCGACAAGGAGAATGCACAGAAGGCTTTATTTACACCAGTC
TTCATGAAGCAGTGTATTGTAATGAGCCTTTGGTTTTTCACCAGCTTTGC
CAGTATCGTTTTAAATAAGTATTTACTATCAACTCTGGATGTCGATGCAA
GTCTTTTAGGTGCATGTCAGATAGTGATGACGACTTTCTTTGGTAGTATT
GTAATGTACGTGCCTTACATTTGCAACTTGACCAGTAGGAAGAGACATAA
AAAGATGGAGAATTTCAATCGCTTTCAGTTTTATAAGACCATGTCTATCC
TTGGTTGGTTAAGATGTGGTGCTGTAATATGTTCAGTAATTGGTTTGAAA
TATGTGGCAGTCTCATTCTCCGAAACCATCAAATCGTCTGCACCTTTGTT
CACTGCTCTATTCGCATATTTCCTTCTAAAGGAGTATTCTGGCATTTATG
TCAATTTGTCACTGATGCCGATCATGTTTGGTCTAGCCATCTCAACGTAT
ACAGAGCTGAGTTTCAATATGACTGGCTTCTTAGCTGCTTGTACAAATAA
TATTTTAGATTGCATTCAAAATGTGTTTTCCAAGAAGCTGCTATGTGGTG
ACGATATGAAATTCtcaCCATTAGAGTTACAATTTTACACAAGTGTTGCA
GCAACAGTTGTCCAAGTACCTTTATGGTTTTTCTTCAttGATTTGACGAC
AAAGTGGGAGACTACAGATTCATACGTAGCATCCATGTTGTTATTCAACG
GTGTCGTTTTTTACTTACAAAGCCTCTTCGCATATTCATTGATGTCTCTC
ATCTCTCCTGTCACTTTTAGTGTATCTAATACAGTTAAACGTGCTGGTTT
AATTTGGTTTTCAATCCTGGTGTTTGGTAACAAAGTCACTCTTTTGAATC
TGTTTGGTACAGTGTTGGTTGTAGCTGGTGTGTTTTTGTATCAACGAGCT
CGTATGATGGAACAACACAAAAGGGACCAAATGATTGTTGAAGAAAAATT
AAACCatggaaataaagaaaaaATGTCTAACAATGACAAGAATCACACAA
CCAACCCTCATGATATTGTGATAAGCAAGaaTAATGAGGGAGGTCTTGAA
TCACCGTCCGATAAACATGCCCGAATATATTCTTCCGATCATTTGAATGA
AGTTGTACCACATCAAACAgatgaaataattcttgaaagaGAGAAGAGCA
ATACACGACGCCATGTGCACAGAGCTCAATCATTCGACAAGGAGAATGCA
CAGAAGGCTTTATTTACACCAGTCTTCATGAAGCAGTGTATTGTAATGAG
CCTTTGGTTTTTCACCAGCTTTGCCAGTATCGTTTTAAATAAGTATTTAC
TATCAACTCTGGATGTCGATGCAAGTCTTTTAGGTGCATGTCAGATAGTG
ATGACGACTTTCTTTGGTAGTATTGTAATGTACGTGCCTTACATTTGCAA
CTTGACCAGTAGGAAGAGACATAAAAAGATGGAGAATTTCAATCGCTTTC
AGTTTTATAAGACCATGTCTATCCTTGGTTGGTTAAGATGTGGTGCTGTA
ATATGTTCAGTAATTGGTTTGAAATATGTGGCAGTCTCATTCTCCGAAAC
CATCAAATCGTCTGCACCTTTGTTCACTGCTCTATTCGCATATTTCCTTC
TAAAGGAGTATTCTGGCATTTATGTCAATTTGTCACTGATGCCGATCATG
TTTGGTCTAGCCATCTCAACGTATACAGAGCTGAGTTTCAATATGACTGG
CTTCTTAGCTGCTTGTACAAATAATATTTTAGATTGCATTCAAAATGTGT
TTTCCAAGAAGCTGCTATGTGGTGACGATATGAAATTCtcaCCATTAGAG
TTACAATTTTACACAAGTGTTGCAGCAACAGTTGTCCAAGTACCTTTATG
GTTTTTCTTCAttGATTTGACGACAAAGTGGGAGACTACAGATTCATACG
TAGCATCCATGTTGTTATTCAACGGTGTCGTTTTTTACTTACAAAGCCTC
TTCGCATATTCATTGATGTCTCTCATCTCTCCTGTCACTTTTAGTGTATC
TAATACAGTTAAACGTGCTGGTTTAATTTGGTTTTCAATCCTGGTGTTTG
GTAACAAAGTCACTCTTTTGAATCTGTTTGGTACAGTGTTGGTTGTAGCT
GGTGTGTTTTTGTATCAACGAGCTCGTATGATGGAACAACACAAAAGGGA
CCAAATGATTGTTGAAGAAAAATTAAACCatggaaataaagaaaaaATGT
CTAACAATGACAAGAATCACACAACCAACCCTCATGATATTGTGATAAGC
AAGaaTAATGAGGGAGGTCTTGAATCACCGTCCGATAAACATGCCCGAAT
ATATTCTTCCGATCATTTGAATGAAGTTGTACCACATCAAACAgatgaaa
taattcttgaaagaGAGAAGAGCAATACACGACGCCATGTGCACAGAGCT
CAATCATTCGACAAGGAGAATGCACAGAAGGCTTTATTTACACCAGTCTT
CATGAAGCAGTGTATTGTAATGAGCCTTTGGTTTTTCACCAGCTTTGCCA
GTATCGTTTTAAATAAGTATTTACTATCAACTCTGGATGTCGATGCAAGT
CTTTTAGGTGCATGTCAGATAGTGATGACGACTTTCTTTGGTAGTATTGT
AATGTACGTGCCTTACATTTGCAACTTGACCAGTAGGAAGAGACATAAAA
AGATGGAGAATTTCAATCGCTTTCAGTTTTATAAGACCATGTCTATCCTT
GGTTGGTTAAGATGTGGTGCTGTAATATGTTCAGTAATTGGTTTGAAATA
TGTGGCAGTCTCATTCTCCGAAACCATCAAATCGTCTGCACCTTTGTTCA
CTGCTCTATTCGCATATTTCCTTCTAAAGGAGTATTCTGGCATTTATGTC
AATTTGTCACTGATGCCGATCATGTTTGGTCTAGCCATCTCAACGTATAC
AGAGCTGAGTTTCAATATGACTGGCTTCTTAGCTGCTTGTACAAATAATA
TTTTAGATTGCATTCAAAATGTGTTTTCCAAGAAGCTGCTATGTGGTGAC
GATATGAAATTCtcaCCATTAGAGTTACAATTTTACACAAGTGTTGCAGC
AACAGTTGTCCAAGTACCTTTATGGTTTTTCTTCAttGATTTGACGACAA
AGTGGGAGACTACAGATTCATACGTAGCATCCATGTTGTTATTCAACGGT
GTCGTTTTTTACTTACAAAGCCTCTTCGCATATTCATTGATGTCTCTCAT
CTCTCCTGTCACTTTTAGTGTATCTAATACAGTTAAACGTGCTGGTTTAA
TTTGGTTTTCAATCCTGGTGTTTGGTAACAAAGTCACTCTTTTGAATCTG
TTTGGTACAGTGTTGGTTGTAGCTGGTGTGTTTTTGTATCAACGAGCTCG
TATGATGGAACAACACAAAAGGGACCAAATGATTGTTGAAGAAAAATTAA
ACCatggaaataaagaaaaaATGTCTAACAATGACAAGAATCACACAACC
AACCCTCATGATATTGTGATAAGCAAGaaTAATGAGGGAGGTCTTGAATC
ACCGTCCGATAAACATGCCCGAATATATTCTTCCGATCATTTGAATGAAG
TTGTACCACATCAAACAgatgaaataattcttgaaagaGAGAAGAGCAAT
ACACGACGCCATGTGCACAGAGCTCAATCATTCGACAAGGAGAATGCACA
GAAGGCTTTATTTACACCAGTCTTCATGAAGCAGTGTATTGTAATGAGCC
TTTGGTTTTTCACCAGCTTTGCCAGTATCGTTTTAAATAAGTATTTACTA
TCAACTCTGGATGTCGATGCAAGTCTTTTAGGTGCATGTCAGATAGTGAT
GACGACTTTCTTTGGTAGTATTGTAATGTACGTGCCTTACATTTGCAACT
TGACCAGTAGGAAGAGACATAAAAAGATGGAGAATTTCAATCGCTTTCAG
TTTTATAAGACCATGTCTATCCTTGGTTGGTTAAGATGTGGTGCTGTAAT
ATGTTCAGTAATTGGTTTGAAATATGTGGCAGTCTCATTCTCCGAAACCA
TCAAATCGTCTGCACCTTTGTTCACTGCTCTATTCGCATATTTCCTTCTA
AAGGAGTATTCTGGCATTTATGTCAATTTGTCACTGATGCCGATCATGTT
TGGTCTAGCCATCTCAACGTATACAGAGCTGAGTTTCAATATGACTGGCT
TCTTAGCTGCTTGTACAAATAATATTTTAGATTGCATTCAAAATGTGTTT
TCCAAGAAGCTGCTATGTGGTGACGATATGAAATTCtcaCCATTAGAGTT
ACAATTTTACACAAGTGTTGCAGCAACAGTTGTCCAAGTACCTTTATGGT
TTTTCTTCAttGATTTGACGACAAAGTGGGAGACTACAGATTCATACGTA
GCATCCATGTTGTTATTCAACGGTGTCGTTTTTTACTTACAAAGCCTCTT
CGCATATTCATTGATGTCTCTCATCTCTCCTGTCACTTTTAGTGTATCTA
ATACAGTTAAACGTGCTGGTTTAATTTGGTTTTCAATCCTGGTGTTTGGT
AACAAAGTCACTCTTTTGAATCTGTTTGGTACAGTGTTGGTTGTAGCTGG
TGTGTTTTTGTATCAACGAGCTCGTATGATGGAACAACACAAAAGGGACC
AAATGATTGTTGAAGAAAAATTAAACCatggaaataaagaaaaaATGTCT
AACAATGACAAGAATCACACAACCAACCCTCATGATATTGTGATAAGCAA
GaaTAATGAGGGAGGTCTTGAATCACCGTCCGATAAACATGCCCGAATAT
ATTCTTCCGATCATTTGAATGAAGTTGTACCACATCAAACAgatgaaata
attcttgaaagaGAGAAGAGCAATACACGACGCCATGTGCACAGAGCTCA
ATCATTCGACAAGGAGAATGCACAGAAGGCTTTATTTACACCAGTCTTCA
TGAAGCAGTGTATTGTAATGAGCCTTTGGTTTTTCACCAGCTTTGCCAGT
ATCGTTTTAAATAAGTATTTACTATCAACTCTGGATGTCGATGCAAGTCT
TTTAGGTGCATGTCAGATAGTGATGACGACTTTCTTTGGTAGTATTGTAA
TGTACGTGCCTTACATTTGCAACTTGACCAGTAGGAAGAGACATAAAAAG
ATGGAGAATTTCAATCGCTTTCAGTTTTATAAGACCATGTCTATCCTTGG
TTGGTTAAGATGTGGTGCTGTAATATGTTCAGTAATTGGTTTGAAATATG
TGGCAGTCTCATTCTCCGAAACCATCAAATCGTCTGCACCTTTGTTCACT
GCTCTATTCGCATATTTCCTTCTAAAGGAGTATTCTGGCATTTATGTCAA
TTTGTCACTGATGCCGATCATGTTTGGTCTAGCCATCTCAACGTATACAG
AGCTGAGTTTCAATATGACTGGCTTCTTAGCTGCTTGTACAAATAATATT
TTAGATTGCATTCAAAATGTGTTTTCCAAGAAGCTGCTATGTGGTGACGA
TATGAAATTCtcaCCATTAGAGTTACAATTTTACACAAGTGTTGCAGCAA
CAGTTGTCCAAGTACCTTTATGGTTTTTCTTCAttGATTTGACGACAAAG
TGGGAGACTACAGATTCATACGTAGCATCCATGTTGTTATTCAACGGTGT
CGTTTTTTACTTACAAAGCCTCTTCGCATATTCATTGATGTCTCTCATCT
CTCCTGTCACTTTTAGTGTATCTAATACAGTTAAACGTGCTGGTTTAATT
TGGTTTTCAATCCTGGTGTTTGGTAACAAAGTCACTCTTTTGAATCTGTT
TGGTACAGTGTTGGTTGTAGCTGGTGTGTTTTTGTATCAACGAGCTCGTA
TGATGGAACAACACAAAAGGGACCAAATGATTGTTGAAGAAAAATTAAAC
CatggaaataaagaaaaaATGTCTAACAATGACAAGAATCACACAACCAA
CCCTCATGATATTGTGATAAGCAAGaaTAATGAGGGAGGTCTTGAATCAC
CGTCCGATAAACATGCCCGAATATATTCTTCCGATCATTTGAATGAAGTT
GTACCACATCAAACAgatgaaataattcttgaaagaGAGAAGAGCAATAC
ACGACGCCATGTGCACAGAGCTCAATCATTCGACAAGGAGAATGCACAGA
AGGCTTTATTTACACCAGTCTTCATGAAGCAGTGTATTGTAATGAGCCTT
TGGTTTTTCACCAGCTTTGCCAGTATCGTTTTAAATAAGTATTTACTATC
AACTCTGGATGTCGATGCAAGTCTTTTAGGTGCATGTCAGATAGTGATGA
CGACTTTCTTTGGTAGTATTGTAATGTACGTGCCTTACATTTGCAACTTG
ACCAGTAGGAAGAGACATAAAAAGATGGAGAATTTCAATCGCTTTCAGTT
TTATAAGACCATGTCTATCCTTGGTTGGTTAAGATGTGGTGCTGTAATAT
GTTCAGTAATTGGTTTGAAATATGTGGCAGTCTCATTCTCCGAAACCATC
AAATCGTCTGCACCTTTGTTCACTGCTCTATTCGCATATTTCCTTCTAAA
GGAGTATTCTGGCATTTATGTCAATTTGTCACTGATGCCGATCATGTTTG
GTCTAGCCATCTCAACGTATACAGAGCTGAGTTTCAATATGACTGGCTTC
TTAGCTGCTTGTACAAATAATATTTTAGATTGCATTCAAAATGTGTTTTC
CAAGAAGCTGCTATGTGGTGACGATATGAAATTCtcaCCATTAGAGTTAC
AATTTTACACAAGTGTTGCAGCAACAGTTGTCCAAGTACCTTTATGGTTT
TTCTTCAttGATTTGACGACAAAGTGGGAGACTACAGATTCATACGTAGC
ATCCATGTTGTTATTCAACGGTGTCGTTTTTTACTTACAAAGCCTCTTCG
CATATTCATTGATGTCTCTCATCTCTCCTGTCACTTTTAGTGTATCTAAT
ACAGTTAAACGTGCTGGTTTAATTTGGTTTTCAATCCTGGTGTTTGGTAA
CAAAGTCACTCTTTTGAATCTGTTTGGTACAGTGTTGGTTGTAGCTGGTG
TGTTTTTGTATCAACGAGCTCGTATGATGGAACAACACAAAAGGGACCAA
ATGATTGTTGAAGAAAAATTAAACCatggaaataaagaaaaaATGTCTAA
CAATGACAAGAATCACACAACCAACCCTCATGATATTGTGATAAGCAAGa
aTAATGAGGGAGGTCTTGAATCACCGTCCGATAAACATGCCCGAATATAT
TCTTCCGATCATTTGAATGAAGTTGTACCACATCAAACAgatgaaataat
tcttgaaagaGAGAAGAGCAATACACGACGCCATGTGCACAGAGCTCAAT
CATTCGACAAGGAGAATGCACAGAAGGCTTTATTTACACCAGTCTTCATG
AAGCAGTGTATTGTAATGAGCCTTTGGTTTTTCACCAGCTTTGCCAGTAT
CGTTTTAAATAAGTATTTACTATCAACTCTGGATGTCGATGCAAGTCTTT
TAGGTGCATGTCAGATAGTGATGACGACTTTCTTTGGTAGTATTGTAATG
TACGTGCCTTACATTTGCAACTTGACCAGTAGGAAGAGACATAAAAAGAT
GGAGAATTTCAATCGCTTTCAGTTTTATAAGACCATGTCTATCCTTGGTT
GGTTAAGATGTGGTGCTGTAATATGTTCAGTAATTGGTTTGAAATATGTG
GCAGTCTCATTCTCCGAAACCATCAAATCGTCTGCACCTTTGTTCACTGC
TCTATTCGCATATTTCCTTCTAAAGGAGTATTCTGGCATTTATGTCAATT
TGTCACTGATGCCGATCATGTTTGGTCTAGCCATCTCAACGTATACAGAG
CTGAGTTTCAATATGACTGGCTTCTTAGCTGCTTGTACAAATAATATTTT
AGATTGCATTCAAAATGTGTTTTCCAAGAAGCTGCTATGTGGTGACGATA
TGAAATTCtcaCCATTAGAGTTACAATTTTACACAAGTGTTGCAGCAACA
GTTGTCCAAGTACCTTTATGGTTTTTCTTCAttGATTTGACGACAAAGTG
GGAGACTACAGATTCATACGTAGCATCCATGTTGTTATTCAACGGTGTCG
TTTTTTACTTACAAAGCCTCTTCGCATATTCATTGATGTCTCTCATCTCT
CCTGTCACTTTTAGTGTATCTAATACAGTTAAACGTGCTGGTTTAATTTG
GTTTTCAATCCTGGTGTTTGGTAACAAAGTCACTCTTTTGAATCTGTTTG
GTACAGTGTTGGTTGTAGCTGGTGTGTTTTTGTATCAACGAGCTCGTATG
ATGGAACAACACAAAAGGGACCAAATGATTGTTGAAGAAAAATTAAACCa
tggaaataaagaaaaaATGTCTAACAATGACAAGAATCACACAACCAACC
CTCATGATATTGTGATAAGCAAGaaTAATGAGGGAGGTCTTGAATCACCG
TCCGATAAACATGCCCGAATATATTCTTCCGATCATTTGAATGAAGTTGT
ACCACATCAAACAgatgaaataattcttgaaagaGAGAAGAGCAATACAC
GACGCCATGTGCACAGAGCTCAATCATTCGACAAGGAGAATGCACAGAAG
GCTTTATTTACACCAGTCTTCATGAAGCAGTGTATTGTAATGAGCCTTTG
GTTTTTCACCAGCTTTGCCAGTATCGTTTTAAATAAGTATTTACTATCAA
CTCTGGATGTCGATGCAAGTCTTTTAGGTGCATGTCAGATAGTGATGACG
ACTTTCTTTGGTAGTATTGTAATGTACGTGCCTTACATTTGCAACTTGAC
CAGTAGGAAGAGACATAAAAAGATGGAGAATTTCAATCGCTTTCAGTTTT
ATAAGACCATGTCTATCCTTGGTTGGTTAAGATGTGGTGCTGTAATATGT
TCAGTAATTGGTTTGAAATATGTGGCAGTCTCATTCTCCGAAACCATCAA
ATCGTCTGCACCTTTGTTCACTGCTCTATTCGCATATTTCCTTCTAAAGG
AGTATTCTGGCATTTATGTCAATTTGTCACTGATGCCGATCATGTTTGGT
CTAGCCATCTCAACGTATACAGAGCTGAGTTTCAATATGACTGGCTTCTT
AGCTGCTTGTACAAATAATATTTTAGATTGCATTCAAAATGTGTTTTCCA
AGAAGCTGCTATGTGGTGACGATATGAAATTCtcaCCATTAGAGTTACAA
TTTTACACAAGTGTTGCAGCAACAGTTGTCCAAGTACCTTTATGGTTTTT
CTTCAttGATTTGACGACAAAGTGGGAGACTACAGATTCATACGTAGCAT
CCATGTTGTTATTCAACGGTGTCGTTTTTTACTTACAAAGCCTCTTCGCA
TATTCATTGATGTCTCTCATCTCTCCTGTCACTTTTAGTGTATCTAATAC
AGTTAAACGTGCTGGTTTAATTTGGTTTTCAATCCTGGTGTTTGGTAACA
AAGTCACTCTTTTGAATCTGTTTGGTACAGTGTTGGTTGTAGCTGGTGTG
TTTTTGTATCAACGAGCTCGTATGATGGAACAACACAAAAGGGACCAAAT
GATTGTTGAAGAAAAATTAAACCatggaaataaagaaaaaATGTCTAACA
ATGACAAGAATCACACAACCAACCCTCATGATATTGTGATAAGCAAGaaT
AATGAGGGAGGTCTTGAATCACCGTCCGATAAACATGCCCGAATATATTC
TTCCGATCATTTGAATGAAGTTGTACCACATCAAACAgatgaaataattc
ttgaaagaGAGAAGAGCAATACACGACGCCATGTGCACAGAGCTCAATCA
TTCGACAAGGAGAATGCACAGAAGGCTTTATTTACACCAGTCTTCATGAA
GCAGTGTATTGTAATGAGCCTTTGGTTTTTCACCAGCTTTGCCAGTATCG
TTTTAAATAAGTATTTACTATCAACTCTGGATGTCGATGCAAGTCTTTTA
GGTGCATGTCAGATAGTGATGACGACTTTCTTTGGTAGTATTGTAATGTA
CGTGCCTTACATTTGCAACTTGACCAGTAGGAAGAGACATAAAAAGATGG
AGAATTTCAATCGCTTTCAGTTTTATAAGACCATGTCTATCCTTGGTTGG
TTAAGATGTGGTGCTGTAATATGTTCAGTAATTGGTTTGAAATATGTGGC
AGTCTCATTCTCCGAAACCATCAAATCGTCTGCACCTTTGTTCACTGCTC
TATTCGCATATTTCCTTCTAAAGGAGTATTCTGGCATTTATGTCAATTTG
TCACTGATGCCGATCATGTTTGGTCTAGCCATCTCAACGTATACAGAGCT
GAGTTTCAATATGACTGGCTTCTTAGCTGCTTGTACAAATAATATTTTAG
ATTGCATTCAAAATGTGTTTTCCAAGAAGCTGCTATGTGGTGACGATATG
AAATTCtcaCCATTAGAGTTACAATTTTACACAAGTGTTGCAGCAACAGT
TGTCCAAGTACCTTTATGGTTTTTCTTCAttGATTTGACGACAAAGTGGG
AGACTACAGATTCATACGTAGCATCCATGTTGTTATTCAACGGTGTCGTT
TTTTACTTACAAAGCCTCTTCGCATATTCATTGATGTCTCTCATCTCTCC
TGTCACTTTTAGTGTATCTAATACAGTTAAACGTGCTGGTTTAATTTGGT
TTTCAATCCTGGTGTTTGGTAACAAAGTCACTCTTTTGAATCTGTTTGGT
ACAGTGTTGGTTGTAGCTGGTGTGTTTTTGTATCAACGAGCTCGTATGAT
GGAACAACACAAAAGGGACCAAATGATTGTTGAAGAAAAATTAAACCatg
gaaataaagaaaaa
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000283XLOC_000283Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000443-proteinTCONS_00000443-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000443-exon-sc0000002-1491911889:757087..757274TCONS_00000443-exon-sc0000002-1491911889:757087..757274Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1510915933:757087..757274TCONS_00000443-exon-sc0000002-1510915933:757087..757274Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1575043694:757087..757274TCONS_00000443-exon-sc0000002-1575043694:757087..757274Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1491911889:757430..757547TCONS_00000443-exon-sc0000002-1491911889:757430..757547Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1510915933:757430..757547TCONS_00000443-exon-sc0000002-1510915933:757430..757547Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1575043694:757430..757547TCONS_00000443-exon-sc0000002-1575043694:757430..757547Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1491911889:757866..757924TCONS_00000443-exon-sc0000002-1491911889:757866..757924Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1510915933:757866..757924TCONS_00000443-exon-sc0000002-1510915933:757866..757924Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1575043694:757866..757924TCONS_00000443-exon-sc0000002-1575043694:757866..757924Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1491911889:758616..758742TCONS_00000443-exon-sc0000002-1491911889:758616..758742Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1510915933:758616..758742TCONS_00000443-exon-sc0000002-1510915933:758616..758742Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1575043694:758616..758742TCONS_00000443-exon-sc0000002-1575043694:758616..758742Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1491911889:759581..759734TCONS_00000443-exon-sc0000002-1491911889:759581..759734Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1510915933:759581..759734TCONS_00000443-exon-sc0000002-1510915933:759581..759734Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1575043694:759581..759734TCONS_00000443-exon-sc0000002-1575043694:759581..759734Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1491911889:768997..769112TCONS_00000443-exon-sc0000002-1491911889:768997..769112Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1510915933:768997..769112TCONS_00000443-exon-sc0000002-1510915933:768997..769112Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1575043694:768997..769112TCONS_00000443-exon-sc0000002-1575043694:768997..769112Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1491911889:769989..770121TCONS_00000443-exon-sc0000002-1491911889:769989..770121Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1510915933:769989..770121TCONS_00000443-exon-sc0000002-1510915933:769989..770121Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1575043694:769989..770121TCONS_00000443-exon-sc0000002-1575043694:769989..770121Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1491911889:771853..771906TCONS_00000443-exon-sc0000002-1491911889:771853..771906Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1510915933:771853..771906TCONS_00000443-exon-sc0000002-1510915933:771853..771906Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1575043694:771853..771906TCONS_00000443-exon-sc0000002-1575043694:771853..771906Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1491911889:772261..772333TCONS_00000443-exon-sc0000002-1491911889:772261..772333Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1510915933:772261..772333TCONS_00000443-exon-sc0000002-1510915933:772261..772333Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1575043694:772261..772333TCONS_00000443-exon-sc0000002-1575043694:772261..772333Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1491911889:778444..778574TCONS_00000443-exon-sc0000002-1491911889:778444..778574Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1510915933:778444..778574TCONS_00000443-exon-sc0000002-1510915933:778444..778574Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1575043694:778444..778574TCONS_00000443-exon-sc0000002-1575043694:778444..778574Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1491911889:780144..780347TCONS_00000443-exon-sc0000002-1491911889:780144..780347Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1510915933:780144..780347TCONS_00000443-exon-sc0000002-1510915933:780144..780347Clytia hemisphaericaexon
TCONS_00000443-exon-sc0000002-1575043694:780144..780347TCONS_00000443-exon-sc0000002-1575043694:780144..780347Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:757087..780347 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
8.45342 7.85781 4.51179 4.91348 7.38598 5.88476 7.12729 7.62052 7.86433 9.67723 8.16143 4.44921 7.10975 6.18464 2.92142 5.81909 2.95266 2.65046 1.28688 4.87914 2.86836 1.74058 6.56015 6.20838 3.67447 4.54623 1.81155 1.85419 4.84198 2.98891
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR004853Sugar_P_trans_dom
Blast
BLAST of TCONS_00000443 vs. Swiss-Prot (Human)
Match: S352B (Solute carrier family 35 member E2B OS=Homo sapiens GN=SLC35E2B PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 7.375e-88
Identity = 158/355 (44.51%), Postives = 227/355 (63.94%), Query Frame = 3
Query:  270 HQTDEIILEREKSNTRRHVHRAQSFDKENAQKALFTPVFMKQCIV-MSLWFFTSFASIVLNKYLLSTLDVDASLLGACQIVMTTFFGSIVMYVPYICNLTSRKRHKKMENFNRFQFYKTMSILGWLRCGAVICSVIGLKYVAVSFSETIKSSAPLFTALFAYFLLKEYSGIYVNLSLMPIMFGLAISTYTELSFNMTGFLAACTNNILDCIQNVFSKKLLCGDDMKFSPLELQFYTSVAATVVQVPLWFFFIDLTTKWETTDSY-----VASMLLFNGVVFYLQSLFAYSLMSLISPVTFSVSNTVKRAGLIWFSILVFGNKVTLLNLFGTVLVVAGVFLYQRARMMEQHKRDQM 1316
            H++++I+  +    T  +V      +    +  L   V+  + ++ ++LWFF SF ++ LNKY+LS L  + S+LGA Q++ TT  G +   VP  C L    +HK   ++    F  TM  +G +R   V+  ++ LK VAVSF+ET+KSSAP+FT + +  +L EY+G+ VNLSL+P+M GLA+ T TE+SFN+ GF AA + NI+DC+QNVFSKKLL GD  +FS  ELQFYTS AA  + VP   FF D+     +  S+     V  +LL +GV+F+LQS+ AY+LM  ISPVTFSV++TVK A  IW S++VFGNK+T L+  GT LV  GV LY +AR   QH+++ +
Sbjct:   35 HRSEKIVFAKSDGGTDENVLTVTITETTVIESDLG--VWSSRALLYLTLWFFFSFCTLFLNKYILSLLGGEPSMLGAVQMLSTTVIGCVKTLVP--CCL---YQHKARLSYPP-NFLMTMLFVGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGLLVNLSLIPVMGGLALCTATEISFNVLGFSAALSTNIMDCLQNVFSKKLLSGDKYRFSAPELQFYTSAAAVAMLVPARVFFTDVPVIGRSGKSFSYNQDVVLLLLTDGVLFHLQSVTAYALMGKISPVTFSVASTVKHALSIWLSVIVFGNKITSLSAVGTALVTVGVLLYNKAR---QHQQEAL 378          
The following BLAST results are available for this feature:
BLAST of TCONS_00000443 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
S352B7.375e-8844.51Solute carrier family 35 member E2B OS=Homo sapien... [more]
back to top