Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000418 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000418
Unique NameTCONS_00000418
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length5364

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000418 ID=TCONS_00000418|Name=TCONS_00000418|organism=Clytia hemisphaerica|type=transcript|length=5364bp
gtggagCCGCCGCTAATGTCGAAAATTATCGGTGGTTCAAACAGCAGCAG
CAGATGAGCACAGCAACAACACAACAACAATATACACAACATTATCAACA
ATATTCTTCAATACCTTCAACACATCACAAGATGGATTCAACAAATCCCA
ATCAACAAACTTCATCCATGAATAATGTACAATGTAGACCATGCCTTAAT
CGGTTCTTAGAATTAAGGAATCAAGCCATCAACAGAATGACAATGGAGTA
TCAAAAGATATGGACTGGCCAAGGAGTACCAGCGATTGATAGCTTAAATC
ATCTCGTCTATCAAAGCTTACGACTCTCAGACCATGAATTAACAGGGACA
GTCAACGGTAAATGTTTATATTGTGATTCACATGTTGAAACGTTAAAAAA
ATCCGCACTGGAGGTTGTTAAAACGCAATTTAATCCGTTTCTGAGGAACA
TGATTCCATATAACAACGACACGAATAATCTTACGGCAGCcgaccaacaa
caacaacaaagcaTGCTGGTTGATCGCAATGTAACGACGCGCGGTGAATC
AACGGATACTTTTAACGGATATCGAGTACCAGGGCTAAACAATACTGTTG
GAGACTCGCgttcaaatgacgtcacacttcATCAATACACTAATCTTCAC
CAACCAGATATGGGCAAATCAACAACCAACCAATCAGCTCCCTCCAATAC
AACTAATCCGACCAATCAGAATTCGACACGATCAGCAATGACATCTCAGT
TCTTCGTTGAGGCAGCGAAGAAATATAATGTCCGAAAGAATcgttcatct
tcatcttcaaaaCACAAGAACAAAGAATCAAGTTCCTTGTTCCCAACCAA
CTTCACTAACATGCTGAAACAATCATCACCATCTAACCCACCCGGTCTTT
TCAAATATATGGGGCGTAGAGTTGATGGCAAGGTCTCTGTCATGTTACGC
GTCCAACCTTCCATCAACGACCAATCAGATAACTCGCTCATCGAAATCGA
TCTTCGTAAAAAACAAATCTCCTTCTTACAACCCAACGCCCCTTCATCAA
CACCCTTAGACGCCAATCAAGCACCACCGCCCTcccaaccaaaatatttt
ggcttCGACAATATTTTTACACCGGAAGAACGACATGATCGAATATCATC
TGGATCTCTATTAGACGTCCTACACGCTGTTATTAACGGTGGCGACGGGG
CTCTAGTCACGTATGGAGGACCGGGAACCGGAAAAACACGGACCATGGTC
GGGCAAGATGGTAGCAGCACAACGGCCGGTATTTTACCATGCGCAATAGC
ATGGTTATACAGTTTAATAGACGATTGTAAACAACGAACGGGCGCCCGGA
TCTCCATACGGGTTTCCGCAGTCGAAGTTGTCGGACGTAACGAAGAGTTG
AAAGACTTATTAGCAGATCAAGCATCTGGGACTGATAGTATAGACAGTCA
TAGTGCGTCACCTGGTATTTATTTACGCGAAGATCCGGTAGGCGGGATAA
ATTTGGAGAATGTGAGTGAACCACAAGCAGCTAACAAAGAAAAAGCGGGC
TTTTATTTGGATGCAGCTCTGGCTTCCAGATCAGCTGAAAAAGACAATCA
AGGAGTGACGCAGAATAGCCATATGATCTTCactttccatatttatcaaT
ATCGCGTGGaaaaaaatgcaagaaaaatCCCGTCAGGTTCAGTACCGCAA
TACTCAGGTGGGCGATCCAGGCTACATTTGATTGATCTCAGTTACGTCAA
CCaaaatttcgaagaaaaaacatcACAGCCTAGTCAAGCACCTAGTCATG
CTGCGTTGGGTCAAATTATGATCACCATGCTTAATGGAAACAAAAAAGTC
ACGTTGTTCAAAGACAGTAAAATCTCACGACTTTTACGTGACTCTATTGG
TAACCAAACGTGCCGAACAACCGTGATAGCTCACGTTTCTGCGGAAGAGA
AAAGCGCACGAAAAACACTTCAAACGCTGAATATCACGCAGAAAATTCAA
CGCAAACGTAGAAAAAGAAATAAGAACTATAGCAGCTCATCAGACCAAAG
CTCGTGTGATGAAGGAGGCAAGCCAAAATTTCGCGTGCAACACCCTCTTA
TCTCAACACGTGCAATCGAAGACACTTACAATTGTTCTGATTACAATACA
TCATCAGCCGGCGAAGATTCCTGTGACACAGTTATCTATATGGGCTCGTC
AGGCGGACACTTAAGTGATCGCGATTTAACGGATAATGAACGCCCACCTT
CGCCGAACacaatgaaaattatgaaattgaaactttcttcttcTGAGGAT
GAGAATACGGATACTGGTAGTGATATTATGCCATGTGCAGATTCTACTGA
AGATTTGAGAATGAGATTAAAAACATTGGAAGAGTGTGAAGAAAAGACTA
GCTCACAGGCTCCACTCTCTCCGCCTCCTTCTTTGTTGATAGCTAAAAAG
CCAATCGCTCCAATCGAAAGAGCTGTAAATGTTGTTGCGCCTCTCGTTGT
CAAAGAAACGCCCATCATTGAAGAAGAGACCACTCCCAAAACGCCCGATA
TGACGAAACCTTTAACGCCCCCGCCACAAACCGCAGAAGAAGTGAAACGT
GAGATCAGTATGACTTTCAACGCCCAAGATACAACGCCCAAACAAGAAGC
CGCCATGGATTTAGAGAGAAACGTTAGTGAAAAAGACTTACGTAACCACG
AGAAAAGAATTGAGAAACTTTTAACAGACTTTAACGCTTTAAGTGATGAT
GAGGAAAATTCAGTCGAAAAACAAAACCGTAGAAATAATTCGTATACACG
CGGTGACGGCTATTTGTCTGATGCTGCTACGTCACTACTTCGTAACTTCC
GTAGAACAACGTCAACGAGTTCCGCTAGAGACGGTTACATTTCTGCACCG
GAATACTCTAAAAAACCGGTTCAGATAGTTCGTGGAATGGTCCGTAAACA
AACGAGCCTCGACGAAGAAGAAGTTattgaaaaacttaaaaaactgAGTA
ATCAAGACGAAACAGAGAAGGAAACTTGTCTCGATGATATTCTAAATAAT
GTCAAAACAAGCACACCAAAATCGGACTTATCGAAGCAACCAACCACGAA
TgatcctttaaaaatacaaccCTTAACTGTCGGTCGTTTTTCGTGTATAC
GGGAAGCATCAAACGGTGAGTCTCCAAAGATTGCTCCACAAAAGGATCTA
TCTGGAATTGCACTTCAAGAGATTGACGAGACAGATTTGTCGAGGGAATG
CCAGCCCAGTACTAGTCGTGTCGAGGAAGAACCGACATTAAACGCCTCTA
CTGATATTGCTGGTCGACTTCAGAACTTAAATCATATAATTACCGTATCC
TCGGTACCAAATTTCTCGGTTGCTAAGAAACCTTCTCTTTCCAATCTTCC
ATCATCACCGACGATGCCTATTCGTCAAAATCTGTCACGTGATTTACTCG
AATCAGTCAATAAGGATCGAATGTTTAGTCCACCCAGTTTCGAACGCTCG
TATTCGCGTGAAGACACAATCAGTGTGGTTTCTGCATATGAGAGTGACGC
CTACGATTCTGACGCCCTTGCAAGTCCCGCCCTTGGTGGAGGGCGATCTG
GGCGTAACCCAACTCGTCTGAGATATCGTTGGTCGACGGTTTATGAGGAA
CCCGAAGATAAAAAATCGGAGAAACACAAATCCCGAAAACCAGTCGTGGA
TGGTGAAGGAAAACCGGCTCGTGTAATCACATCTCcaaaatcttttgcca
aaaaCCAACACCAAAACTCTAAGAACTCACTAACATCTCGATTCACAAAA
TCacctaaaaatgaaaagaaatcatCAGAAACGCCAAAATCgcctaaaaa
attattttcctcgTCATCTTCATCAAAAACAACGGACATGCCGCTATCAC
CGAAATCTGGAAAATCGAAATTCAGCATCTTGTCACCAAAATCGGAACGG
AAAAATAAGAAATCGAACAGCGGAAATAACCATTCGCCGGATAAGCGAAT
GTCCGGATGTAGTGAAGCAAGCAGTGGATTGGATAGTGGTATTCACAGTC
AGACGTCTTCATTGAGAAGTGGCGAAGAAATTAAAGTTGATGATAGCACG
ATTGTTAGGGAAGAAGTTCGATCAACCAAACATAAGTTATGGCCATTTGG
ACGTAGTAAATCACGCAAATCGTCACGAAGTTTATCGGGATACGTCAGTG
ATAGTGTCACGGAATCACGTTCACGAAGATCACGATTCTTCTCACGAAGT
TCAAAATCTTCTTTGAGCAATACAGAAGGATATTGCAGTGGTTACGAAAC
GTCCGTGACCGAAGGAGGCTTGACCAGTTGTACTGAAGACAACTATACCA
CTGATAACGAGTCGGTTACCggcaaaaagaagaagaaaagattcCTCGGT
TTCCGTAGGCGATCGACAAGCGATCTTTCTTCAACGCGCGGCCGAGTGAA
GAAACCATTATGGTTCGATTCCAAACGCGGATGTCAGTCGGATACTGAAG
ATTTGCAATTGAAAGTTTATCAAATAGACGATCCACAGCAAGTCAACAAA
CGAAAAAGCAGTGGCAAAAAGGAATCGCAAAATATGCCTTCGCGACAACA
TCCGCAACAGCAGCAAACATCGAGACATATCGAAGGACTTCGAACACAAA
ACGAACAATTAAAAAaaCCGATTGGTTACATGAAATATCAACCAGCTGCT
GTTCCCTCATACAATCCAAACCACCATCCCCAACAAAGTTACCTTCAGCA
TCAACATCCTCATCCTCCCCATCAACAAATTGCTCAACATTCTTCCTTTA
CTCAGCAACAATTACATCAGCACCagattcaacaacaacaacattttCAA
CGACATCAACAAGCCATGAAAAACCATCATATTCAAGTGGTGACCTGCTT
TGATCGAACTTCACGTAAAGTCACacagatttgaaaaattttgtttctgC
ATCGCtcaatttttctaagaaaatcgaaattcaatcaTGCCAAGATGGTT
ACCAGGCTTTTAAAGATCTTAAAACATTGTCCCTGtctatcccaggcttt
atttatgttACTGATTGACTacagagaatattatctagcgctatcagtaa
gcataaaaaagccgATAATACGCAGGGGACGAAGATGACAATCTCTGATA
AACgtggatttgactgaaattttatggctcaaatttttcgTAAACTAAAG
TTTTTAAAGTATTTAGCTAGCTTAAACTACGAAGATTATACCAATTTATG
TTAAACTGAGATATTTTTAAGTTCTTCGGTTTTTCCTCGTTTTATCAGGA
AACTGTAATCAAATTtccgaaaaatcatcaaaaaacaaaatttgctcaaa
tatGATAAGATTTC
Run BLAST on NCBI

transcript from alignment at sc0000002:171654..205617+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000418 ID=TCONS_00000418|Name=TCONS_00000418|organism=Clytia hemisphaerica|type=transcript|length=33964bp|location=Sequence derived from alignment at sc0000002:171654..205617+ (Clytia hemisphaerica)
gtggagCCGCCGCTAATGTCGAAAATTATCGGTGGTTCAAACAGCAGCAG CAGGTATTATTGGATTCAATTTTCATTGGGAATTTCAAATTATAATTTAT TCTGGTTTATCTAAATTATCATTTTCGTTTTTGGATGGCTTCTCGCTTCG TGAGACAGGGGTGGTTTAAGCTTACATTAGGGAATGACTTTATGAAACTG AATAATTTGGGGGCGTACGGGACTTCgtaataccgatataccgatcacTT TTTAGCTCAATTACCGATATTTTGTACCAACATCCATATGGAGATTTTCT AGACTCCCTTTCCCTTGTATCTCTTACAAATTTCAATGATGTATCAATAT CCCCCAAATAATGGTAGTGAAAAAAATCTTCATGCTTCAGAATCGCCATA AAACTTTCCGGAATAACTGAATCATCATGACCTCTGCGTGGATGCTTGTT ACGATCTCAGCATGTGCGCTAGACAATTTTATTGTTGTCTTTCCAATTCA TGATGGTGCCGAAGTACTGTTTTTTTACGAGAACATCAaatgaatgttct taacttttggagttttaagtctaaagatGTTCATAAAATGTTgtaatttt cgccatttttatgagtatttttgtccatttttctcagaaatcgggtgttt tagagcctgcaaagcctttaaatgttcttagcttgtgttcttagtatttt attggccatcgaagccttatattcttataaagtttgttcttataaaaaca cgtTTACAGTAATGAGTATTAAACGCTCCTAGTGGAAATTTGAACAAAGA ACCCATTTTCATGTTCGAATTATTTGTTATTAGTTTGATGTCAtcgtttg ttttttcttaaatagGGAGTTCAATATTTATCAAATAAAGTCTGACCGAC ATCTTTCTACATGTCAGACCATTGTCAAACGTCAAAGTTAATAAAAATTG ACGAATTAAAATGTCGTTTTACGAGGTGCCAAATATTTttgcttggaaat tttgaattatgtATTGGATTTTTTAACACGGAGGGGCTAAATTTTTGAAT GATGACTATATTTTCACGACTGTGTAAGactttgaaacttcaaaatacTA GGTTAAAAGGCTTTAAAATGTTAAGTTTGTAAAAGGAAATATCTCAAGTC CTTTCGACAGAacgaaatttttaaactttaatttATGATAGGGTATATCC TGTTCGAGTGTTTTGATTCCTGTCTAAGGGTCCTCCTTACTTCCTTGATT CAGTTATTTTACCCTTACTTTGCCATAATCTCTGTCAACTTTGTACcatt ttaaaaaggttttgtttttgaacaatagtgatatcgtttgcttactcatc acttttaattcacaaggtttttcacattggattgacacggatgtggagca agattggtcagaaaaaggaaaagaaaaacatttgttttgcttatatcagc acaatatataacaataggcaaacactgtcctggtatgaaatatgtgtctc atatgaaacggaaacaattatgtataaaaataaaacccgggggggggggg gNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNcccggggggggggcagctgggcaaaaggaccgacgggtatctGCGGG TCCTAAGgataccttttccaatatgtttaaaatgcactgtaaaggtcgga aaaactagagatgcactgtaagggtagaaatcttgaccaaaaatgctaga attttgaccattttttgcacgaaagggattgaaaatttgggggaaaatgc actctaagagtattattttcactgatttttgctgcactgtaagggtgtaa ttttaaaagccaatttttggcccgcacataccgtcaggtCCGCAAACCCA TATTATTCAGTCGATTAGAATTAGGGGCTTGCTCATCAAATGTGTGATAC AGGGGTGGTCGTTATGATTCATCAATCATTCGATATTTGTTAACTAATAA TTATTATTGTTAGCAATATGAAAGCAAAAGGGAGGGgatcttaaaacaaa agaattactATCTCTAATTAAATCAAAAAGGATGACATCATTACATGTAA TAATAGTGTATcatattttcaatgtttgtactgtcttattattttctttc atatctgataaaaaaatcagaaaaaaagttatggggATAGTTGAATTTGG AAGTTTTCGTTGCTTATTCAGGGCGTAGTGACAAGTAAGTAAGCTGCTTT CTTGTTTTTTATGGATCAGTTTTGAAATTCATCTGGACTAACGCTAAGTA TATTGCTTTACAGGGCAagcacacattttttataagtgTTCTTAAGTTTG AAGCCATTTAATCTACATTTGTTCTCATTTTTAGTGTTTTCTCGGTAATT TAGTAAAATGTCCTAAAAAAATTGCTtatgtttttgagttttttaacGTC TATCCAAGTTTTGTAACGTTTTTATCTTCTTAGTCTCTGAAGAAGCAATT TCTTGCCTATCCTTTCTCCTTCGAAAAGAAACGTTTTCTACTAAATGAAG TGAAGCTGTCAAGGGAAAATTTACTTTATTCAAAGATTTACAGGGTTCTT CTTTTTgatcaaatatttttatcctGGTCCATTGTCACGTGACAAATATT TTCAAGTATAaacaagaaaattttcaaaatataaaaaatcaaaatattat aaatttcTAAAGTTTTCTTCCTTAATATGtaactatttttttgtttcctt ttaaGCAAGTTTTTATAAACACTAACCACACCCTATTTCAATGCATTCTC AAGTGGAGGGGGACGTAAGATCANTAAgcaagtttttataaaaactaacc ACACCTTATTTCAATGCATTCTCAAGTGGAGGGGGACGTAAGATCAAAGT TTTCAGAACTTCCTTTGCTACCCTATAGGATTACTTGTATGAAGGACAAA AACTTAGTAAAATGTAAATGCAAGCTGTTTAGCCGTTAGAGAGAAGagaa gaacatttttcttataaaaaaagaagcacCAGTCATAAAGTTTTGTTCAC ACTCTCGTGTTACACACTCTACGCGCGATTCACAACGAAATCAAAAGCTC GCGGCCGCCACTCGAAAAAGAGAAATCTCCTTTTTCCCTTGTGGAAAGtc tcaaaagtttttctttcttcCTTTGAGGGAAAAAATCTCATACTTTAGTG TCATATTTGGATTAGAAATTAATTTTCCATGTCCAACAGTATGTTGCCAC TTTTCTTTTAGTCTTTTAGTCATGCgtggtggtacagtcactttcggtcg gggttgtggacggcgaaatatgtcgttttttatgaaatttgtcgttcttt ttgtgtatttttagtaatgcaggattctttagataaaccccctcagGAGA TAATTACNTAAAACAACACAACACGCCACGcagatttttcaacttttttt cgtGTCGCTCTAgaatttttgataaatcttATGAATAAGCTCCTGAAATG AATTGGAATGAGTTCTGTATCGTGTGTCTTCAATTATCCTACTTAAATGt taatcattattttttaattatatacTTTTTGCTATCTTTAATTAGTCTTT TAAGTGTAATTCTTATATTCGAAAAAATTGAGGAAATAGTTGATCTTTAG TCGCTCACGCTGCCatggtttgaaatatttgtttttgttttgtagaAGAT TTTTCGGTAGAATTTGTGGTATACTGATTTTAGAGGATGttatttttgct gaattttagAGAATACCGATCGATTCACACAACGCTGTTTCAACGTTTAC TGTAACTAaaattcacaacgtccatatatatgatattagatgaacgttga aacaacgttatttGCCAGCTGAGAAATTTTGACGGAGAATGTTGAAAAAT CACAAATAAATTTGATCGCTCTCCGATTCCGTTAGCattctttctggttc ttttaACAACCTCCCCCCCCCTTAATAGTTTTTCCTGTTTAGATTTTAGG CCCAAACTGCAAAATTTAGTCAAATAGGAATCTTACAGCCTTTGAAGATT ACAAAATATTGCATTATCTTTGACGAGGACAAAAATTTCATACATTTCAT CAAtcgaaataatttttctatCAATTAACCATTTTAGGACGGTTTCAACC AAAAGTAACAGAAAACAAACATAAAAACACAAATTAagagtaaaaaaaga aaaaaaatcaaactgtgATAAAAGCCGGTAAAGTCGCCGGCGTCTAGGCT AAGGATAGATATTTCAATGCATTTATAGAAACTTGAACTATACCCTAATC CCTAGGTTATTGTTGATTTGGTCCAATGAATTGGTTGTTTGGACTATAGG GACCCAATTTACCCCAATTTTTCCTTGCCGCCGTCTGTTAAGcttgtttg tttatgttttgacTTGGGCGCTATTTCGAAGGACAAGTTGTTTAAAAAAA CCATTCGCTTCCGCGTTTGGCTTGTGTAGAGACTTATAACTTATAACGCA CGGTTGATCTTTCAATGAAGATGCCGGGCCGCTGGTAAAGCTATGTGTAT AAAAGGCTGAATAGTTGACAAGAATAACGTACTTTTTATTCGTTGAAATG TTAGAGACCTGTTTCTGGGGATATAGCATTTTATGGCTCGAATAACGATT AGTTGTTTTGGTGGTTGATGTTTTGAGATTTACCGTATCTGATTCTTGGC GAAATATTGGTacttatcggcgatccaaaaaatatcagcaatctgattgg ttaaaaagagtacaatatatcttgtattttacatgtaaaaatataaatta ttatccatatagcggtcattaagtaagccattaaagattcgaacggcggg cggtattgaaaggttctatgactcaaatagtcatacccgcgctgagaaaa ctaaagcgccaggcttcagagggctgaaatattaTTAACCACCCTGGTTA TAGGGCGATAAcctcatttgcggcccgctcattgaactttattgaagtcg ttgcattgaagcggtgagactaaaccgacgtcagaaaaaaacactttttg ttcatttgcggcccgctcgcaaggatactcaaaacttgttgaagtcattg cattgaagcgaaaagacatggctgacgctagaaaaaaacgttgtttgaat gtccgatatggataataatagtaatagcgttaagctttcgttcgttgttg tcattaattctgcccttgcagtttgNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNctccgcttcgcgtcgggcc caaatgacactctcgggctaataatcaaactgcgcgggcagaaaataaca acagcgacctcaaactgaacgctattgttatattgacgaaaagatgttgt tgcattgtagcggtagaagcaatctaacgtcactttgctacaaaagtgtc ctccaacacaaaaagtgcattttttgggtcaccggtaaaccagttatcag acattgtccgataactattacatatgtACTATTACAGCGGAGTCTctcta actcgaacctctataactcgattgTCTCCCTAACTAGAACAAGTTTAgta gtcccttcagttaacataAACCTTACTCGatatctcgaaatttccttaat tcgaacaaatttgagCTCCCtgtgtgtgttcgagttatgaagaatgagta cacgttttttttttttttataaggaaccttaactttgctctgaacctgga gttccttatttttacagagaatttcagtctcaaagttccttatcgagttc cttactacataggaaattttgaactttttgNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNtaaattagtcccaataaggtacatt attttcaAATCCACTTATTCTCAccctgagcagttccttaacaattcctt atttctcaaaccattttcagcctcgagttccttataaacatgttccttat aaaaaaaaacaacgtgtagtAAAGTTTATAGTGACCATGATACACTTTAA ATCCTTTACGGTCTTGGATAGAGTTTAAATCTTCATTGGTTTTCAAAATG ATCTCGCATTTTCTGTCGTCAAAAAGTTGACTTAAATTTGACGAGTTGTT GAGTGTTGAAAGAAGAGAATAAACTTCGAAAAAATGTCAACAGTTTGTCA AACTCCTTGAGATATCGTGTCTTTCTAGAGAGAAAAAGTTTCGCTTTAAT TTGCATGTTAAGTTGCCAATGGGCAGTCACATCATTTGAACATTAAACTt gtcaaaaacatcaaaaacccTTTTTGTATTCTTTCGTTTTTGTTCATGAA AAGGAAGTCCAAATGGACAAAATTTGTTGCGATAAATGTTGTGCTAAATG TCAGCAGAAATAAATCATCAGTTCTAAGTATATATCTTCGGCATAGGCCA ACTGCATACTAATTTCGACCTGGGCATCTCGATTTTCTATTATTGTGAAC TGCATACTGTAAATTTAGATTTGTAAATCTGTAAATGTTTCTCCAAACTT TTAgatgattgaaaaatattaacccAACTTGCTCAGAAATTAGCGTGGAT GGGAGACTTTGCGATGTGAGGAAGTTCGAAATGATTATGTTCATAATGCT TTATCTTTTCATttacgttatatggacgttctTACGAACCTTAGatagac gttgaaacaacgttgtatgccagGCAGAATAACTTGATTATTGGACAATT TCCAAATAACAGAgaaaatttattgaataaaccGCCTTTTTCCGTACTAT ATCTTTTGCGGGCACCCATTTAATTCTTTAGTGCCTGACGTGGTTTAGTG AGGGTAcctattcttttaaaaaagaatttaaattttcaataggCGGTACT TTAATATAAATGGGAACTCATTTCTTCAGAGTAATTGCTTTTTCATTAGT TAGCGTAGGTCAACAAATTAGCATGATTACAGTAATTAGAAACTTCTTAT TTTTGATTCTAATACGCTAATAAGCAGCCATGTGCCTTGTGTTTTCTATG ATTTCTTTATGAAGTTTCAaacttcttttataagaaaataggaacaattt ttccaaattattttactttttgctGAAAATGATTCGATGTACGATGGAAC TAAGATTTTAACCTTCTTCCTTCACTTTTTCgattctttatttaaaaaaa atttccttaaaactTCACAATGAATATGTCAACCATGGAAAATAAcgtaa tatttttgttttgatcacgtgaatAAAAAACTAAGTTTGCAACTGTTTAC TAAGACAGATACATGGTAAGCCAAGCTAATCCTTACGtataaaaatgcta ttttcaaAAGGGTTGCACATCTCTTAATCTAGCTCAATTAGAACTTGTTT GCAAACCTAGCCGTCATGTTTTTCAGTTAGATTCACATTCAAATCTCTGT TAAATCTTTCTTAATTCGTTACAAGCTCAGAGAAGCTGGGTAAGGTCTCT AGTTACAATCGTGCAGCTTGTTTTTTTATCAGTGTTTTTTGATCAACCTG TAGTTAAAGTTTGTCTTGATCAAAGATGGCTTCAATGACGGTAAACttat tttttacgattttttaaaTAGTAGTAAGTTAAGAGTTTAGGTTGAGCATC TGTCTACGGCGGCGAGTAAGGTTTTGGGCTCAAACCAAGCCGAGTCATAC TAAATATCGCAAAATGGTGCTTAATACCTCTCAGCTTTATAATCAGCTAC TAAAGAGAAGAATCAAGGGTAAGTGAAGAAATCCAGGGATGGAGTgacac cctcccctaccttcgggtagacagctaaaGAAAAGGGGCGTCTTCGAGTC ACCCTCGACTGTGGTTGCAAATTTACTTGAACGTTCATAAAACGTTAATT GATGGGTGCTGTTTGACATTTTGTGCTTGCGAGCAATAACCTTTGCATTC TCTTATTTCTGTCAGTTTTATATGCTCTTTTAAAGAAATATACTTGAAGA TTTAACAGGGGGGTTTCAGCTTCTTCTTTCATCAATGGTATTGCTTTTAA AAAGTAAACTTCCAATTCCATTCCATAACAGTTTGGTAAAAAACCCGACT TTTTATATACATtctaaagtatttttttgtaataatttctattttctacc ttttccaataattgtggtttttaaaaaaaattgtgtgacgTCATGATGAC ATCACAATAGAGAGATGGGGTgttttatcaaaactttatcaAAGAACAAA AGATGTCGATCCTCTTTGATGTGTTTTGGAGCAAGGGGGTTTTAAGAATG ATGAATTTTTCACTACTGTACGTGTGTTTTACTTCAGTGACTGGCTTTTT TATCTTATCGGAAAATTTCGGTGAAGTTTTTTTATGTGTGTATGAGatat gaaatgtttttttagtTTGGTTTTTTAAGATGTGTGGAAATGTCATTTCA AGAGTTGAGGCTTTTCTTCATAAAACCGTATTTTGGCGTATTTCTTGTTA GCGTTCGTTGGTACACGGTAATGAGTTTTGAAATGTCCGTATATTTATCT GGTACAAATGTAACAGAGGGTATCTGTTACTAGATAGCTTAAAAGCCCGT GAGGTAGCTTTTCGCATAAAGCTGTCAATCATCTTTGAGGTTGGTTTGAA CCCTGCACGTGGACATTACAACTTGAAATGGAAATATGTGCGCAATAAAG CATCATTCACAACCCTGTGTctcagacccgctgggaccccagccccactg gaaaatttggtgaaaatttcgtccccggtggaaaaactCCAAaagcactc caaaaccatccccactggatttttaaccttgaaacaatagaattcctttc cccatttggatttcaataggaatttttatccccactgagggaaaaagttc caccggggctgtgagacaggggcgtGTTTTCAAACCCACAAATGGGATCA AGTAACTGCACTAGCTTTAATGAATATTTAAGCCATCACTTAAAACCTTC CTTTGGATTTTATCAAAAGGAAACGAGCATTTTTGACATATCGAAACTTT TGGctcgagttaaaaaaacaaGAATCATTAAGTATCTGGGTTGGGTAGAA GGTGGTACTAGACAATTGGTATTTTTGGCATTGCTCTCAACTCTCATCAA ACTAaccaaatgaaaataaataagcCTTTGTATTTTTACTGCTAATTTAT GAAATTTCCAGTATCGTTGCCAATTCTACCTTGACAAACGAAAGGATATT ATATTCTAAGCTTTCTATTTTGGAAAGAGTTTTGTGCGACGGTCTGTTTT TGTGTGTCTCGGGTATGTAGTTGTAAGCAtttcaaaatttcgattttctC AATGTCATGGATGTTAtcataacgttagatgaatatTGAAAAAACGTTTT GTACCAACTGAGAAACATTTTGGTGCTCTAAAAATGGATACGGATATTGG CAATTGATTGAAATTTAGTCATGGGTTTACATTGTTTGTGGCTTGGACGG CGGAATTTATATCAAACTTTTGTGATACAAATTCAAAGGGGACGTAAAGT CTAAGTATATGCTTCATTTTTGTCGCTTAGACTAACTAAGTCACTTGGCT CCAATGTTTTACAGAATTATCAAAATGTATTTCCTTTTCAATACATGTAT ATAGGTTTAATGTGCCTACGTTtccttttgacaaaatatgatgaatttta agtcaaatttaaacaaaatataGTCTTTACTAATATAAGTTTGTCATATT TGAtggtattttgaaaattttcataagcTCGCATTCTTAATGCCAGATTT TGAGTCATCTGGTATTTATCAAACTTCAGCATAATTTTTTCCATTATAGC GTATTATAAAGTTTGAGTAAGTTTGACTTGAAATCTAAATTTAGTAACAT TTATGAAAATTAGAAACATTTGAGTCATTTGCGCTTCTTGTTATGTTTTA GGTCCTATAAAATTAgggtaaatatttttgaatatttttaaaaaatattg aaactttgaaaataacaaaaagttacaaactggtttaaaaaaattataag tcTATATTAACTAatgtcaaaatgttaaaaatcttttatgtCATTTCCAG TCCACTTTATAACCTAACACCCTAtatgaacattttttatttcctgTTTT GATAAGCGAATTATTTCCGCCCGCGCGTTCAAAACATGATAAGAGGTGAC ATATTTCATGAGAGTACGTCATTTAAGGTGAACAACTGTTTGTTAGAGTG ACGCGAGATGAGACTTTACACTGTATCTTCTGTATGTTAccgttttatat tttcttataatgatgatcaagaaatcagtcaTTTAGTTATTACTAAGAGT TTAGAGAaggtttataatattttttaagctTGGTGTATCATCCTAGTTAA GTCAGTCAAAGTCTTTATGAACAAATTTTAAAGTGTGTGAGGTGTCTTTG TCTTAGAGTATACCTTAAAACGCAGCTTTAATTCTTTACGACTCATATGT ACACGCACGTACAAACAGAGTTAGAATAACGTTATCAAGCGCATGTATTT TGACTCTGGCATAGAGAAATCTTCTGGGTAGCAAAGCGGTATGGCAGTAT CAATTTGAAGTTGAAAAACACTTGGATTTGATCATGTAGGGcacctttaa aatttttccatGTTTGAGAGAGACATTAGTGAAAATAGAGTCACGGGCTG TGATGTAACGTTTTGTAACTATCGCAGCTCATTTATCTATGTACCCATAA AGTTAGAAGTGTCGTGATATTAGTGTATTGTTTTGTTGTGTCCTTGCCTG CAAACAGACTTGTTGTTTACTGTTTGTCTggcgtttttgtttttgttaaa aatggaGTCAGTCTCCATTTTCCATGTATCAAGTTTAAAACTAGTCTCTT GTGTTGGCTTGCTCTGTTTATTTAAGTAAACAGTCTTGATACTTTATATA TAGTCTGTTTGTTGGCCCTCTTGGATTACTTTTTTGGTTGCCTGGCTTTT TATACGAAGCAGTCGTTTTATACTGAGATAGAATCAGAATTTTGCTATGA AATAAGAATTTATTGGTTATTATAGATACAGCGGAGTCACTTTAACTCga aactctataactcgaatgtctattctaacttgaacaagttttcttgCCTC TTCAGTTAAAAATACCCTATTACCCNAAGTCATTTAGTTATTACTAAGAG TTTAAAGAAggtttataacattttttaagctTGGTGTATCATCCTAGTTA AGTCAGTCAAAGTCTTTATGAACAAATTTTAAAGTGTGTGAGGAGCCTTT GTCTTAAAGTATACCTTAAAACGCAGCTTTAATTCTTTACGACTTATACG CACACGCACGTACAAAAGAGTTAGAATAACGTTATCAAGTGCATGTATTT TGACTGTGGCATAGAGAAATCTTCTGGATAGCAAAGCGGTATGGCAGTAT TAATCTTTGTGAAGTTTGCTAAAATTCGTACTTGAAAAACTGTTGGATTT GATCATGTAGGTcacctttaaaaaattttcatgtttGAGAGAGACATTTG TGAAAATAGAGTCACGGGCTGTGATGTAACGTTTTGTAACTATCACAGCT CATTTATCTATGTACCGATAAAGTTAGAAGTGTCATAGTACTGTACTGTT TTGTTGTGTCCTTGCCTGCAAACAGACTTGTTGTTTACTGTTTGTCTGgc gtttttgttttgttaaaaaTGGAGTCAGTCTCCATATTGCATGCATCAAG TTTAACTAGTCTCTTGTGTTGGCTTGCTCTGTTTATTAAAGTAAACAGTC TTGACTTTATATATAGTCTGTTTGTTGGCTTTTTTAGATTACTTTTTTGG CTGCCTGACTTTTTATACGAAGTAGTCGTTTTATACTGAGATAGAATCAG AATTTTGCTATGAAATAAGGATTTATTGGTTAATATAGATTCAGTAGAGT CTTTATTACTCGAACCTCTCTAACTTGAATTTCTCTTTAACCCGAACAAG TTTTCCTGTCTCTTCAGTTAAAAATACCCTATAACTGTTACTCcatattt ctaaatttccttaactcgaacaaatctgTGTTCCCCATGCTTGCTCGAGT TACAGAGGCTCCACTGTACTTTCAATACTGTATTTTTTTGTCTCTCTGAC TATATGTCACGACTCAGTTTGGGTTTAAACAACGATAGCAACGACCACCA TTAATCTTTCAACATTTTGATTTCGTTTCAGATGAGCACAGCAACAACAC AACAACAATATACACAACATTATCAACAATATTCTTCAATACCTTCAACA CATCACAAGATGGATTCAACAAATCCCAATCAACAAACTTCATCCATGAA TAATGTACAATGTAGACCATGCCTTAATCGGTTCTTAGAATTAAGGAATC AAGCCATCAACAGAATGACAATGGAGTATCAAAAGATATGGACTGGCCAA GGAGTACCAGCGGtaagatttatttatttatcctTCATTTACCTAGCTGg aacaaaacgttgtttcaacgttcgttTAACTTTGTATGATTCCTATGGGC GTTAGATGGGCGTGAGTTTGATGATTTACGCAAGTATGTTCCTTTGTTAT AGGTTTCAGTTGAAAATTGGTTCTAGATTAAGGAATTTTTTGTGGTTTTG ACAGTGTTGAAAATAAATAGACTCTTTTCTCTCGCTACCCCAATTTCTAC AAAGGGCTCTAAATTATGGTTCCTTAAAATTAAGTGGGATGTACGTTCCA GTTTAGTATGGCAAGATTCGGATATGTTTTTGTAGAGAATTCGAACTGAA AGAGATTTATTTATTATGTAGTCCTTGTAATTCACTATAGTAATTGTTTG GTTTTAGTCTGGATTGTGATAGTGCAAAGTCGATTTTTGGTTTCACATTC TAGCTATAGAAATTGATAGTTACAGAGAATTCTCTatataactcgaatat ctccttaactcaaacaagttttaagaccctttcagttaacaatgccctaT AAACCTCCATATCTCGAAATTCCCTTAACAAATTTGTCTTCCCCGTGcct gttcgagttatggaggctcCATTGTAGTTATTAAATAAGGTCACGAGCCG TTTTGACGTTAAACAAGTGCAAGAGagaaaaaaacgaagaaaaaccTTTG ATAGTTTTGTGTtacttttataatattttttggcAGGATTTGTTCTATCT TGTTTGAAGTAGTGTTTCAAAAATCCTAAGTAGAGTTTACCCTAAAAAGT GTCACTGCTGATTGAAAGAAAATATCTGTTTCAAGTTCTTATCCTCAAGC CTGTTGTAATGAAAGCATTTTTTAAGATGAAACCAAAATTCAGTTTCAGT CCTTTATAAACTGCAACTCTTGCAGAggacgcaattttttttttcgaatt atggAGTACTTGAGACCCCATGGAGTAGTAGAAAGTAATAGGTTTGTGGC TTGAGGAGTTagtaagcccgggggggggtactagggttggcgaatgaggg gtatgtgcggatgggacctccgaaaaccgacccttaaagagactgatctt tgctgaaaaggtgacccttagagagactttttgaaattttttttaaaaag tcataccctggaaattaaaaaatttcctaaaaatcctgaattttccgacc ctcagagagactaatttaaaactttctgatttttcggacccttagagaga ctttgaaaggtgaaaaaaccgacccttaccgtctgcacatacccatcatc catttttgcctaagtacccccccccctggggtaAGAGACCGTGCTCGGTT TACGAAGTGATTCGAACTATAGAGAATCTGTTGTATTCGGGTTAACGCCA ATAAAAGTAAAGCTCttccaacctcgtccccgtgtattccaggctttata tACGTTACTGATAGACGCCAGACAATGCCAATGTATTATCTGGCGCTATC AATaggcatcaaaaagctgatgatACACAGGGAACGGGGTTGAAGCTCTC CttcaaacaaatcaaattggATAATACCTAATATGGTTTAATAATTTTAT TAACCGTTACAGGTCTATTTTCTCAAAGATTCTGTCACTTCTTTCCTTAA TTCTTTGaggtttactttttttaaacattttttacaaaacgGTGATTTTT AACCAGACTATCCTTCCCGTCTGACCACTGAAGATTAACATTTTTCATAG CCATTATAAAGATTTAAAGAATGAAATTCTGAAATTCTGATCTTAAGATC GCATATAAATGTTGGGATGAAAGTTTCGTTTGCAGATTGAAGGTTAATTA ATCATTGACTATGTTTATTTGGCTCTACCATAAATCTTTAGGCTCAGATT AAAACTATTATTTAACTCAAATCCACGAGTGTGTTGATCTTTTCAGCCAA GGAATAACTATTTATGTCTACTTTTAGACTAAAAGGAGATTGACTGCTTT AATCAAGTAATATGTAGTAGTCTTTAGTCACAAGGATTATAACAGACACA GTGTGTACCAAGCCTTATTTGTTTTTAACGCTTCATTTACATTAGGATCT TTAATTTAGGATTCTGTTTACATGTTAAATGAAAGTTTATATCtatgaga tttttttattttctcaggGACTACTTTTTATTGTTTCACGTCTGTAGTTT TGTTTTAAACGATTGAtagatcaatttttttgttctaaATGTAGAAAATA TATGAAAACAGAAAAGTATTAAATAGAGGGACATCATGCTGGGTCAAAGG AGACTTTGGCGTCGTAAAGGCTAAAGTATCAAGTTTGATTCGCTGTAAGG AGTATCTGTGAATCAAATCTCTCAAAAGTATATAGAGCGTATTTTGATGA GAAGGAAGGAAATTTTTCTCTAgagacgaaaaaaaattacaaaattcgTT TTATAACCGTCATATTTCTATCGGAGTTGAGTATAAATTCGGCGCGCAAC GACAAGGACTTCCATGTATTTTTTACGGTTTTCGAATGTTGCAGGAAATT GACAGGAATGACAAATTTGTTCTGGCTATAGAGAGGTTTATTAAAAAGAG TTTTGTGAGCTTAAAACGGGAGATTTGAGTTTTGCTAGGACGAGTAAGTG TAAAGTACTTTCATTTTTGGCGGCTTATATTAGTGGGGCGTACGTGATTG TTAACCcgaaacaccgaaacaccgaacAAGAAAAAGGGCtaataccgtca caccgtcaaacCGGCATGCTCCTCTTAATACCCGGTTCCGTCTGGAATCC AAAGTGTTGTTGAAATTTTGTGTCAGCTGTGAGGTATTTTTCTGAgtggt acacgctttttttgaataagaatacactttataagaaaatggccaaaaaa tcaagataatgctaagaatatcaccatcatggaatttggctactcaagct aagaataccatttttagagcattttcgattataaattgccaattacccca aAGTAAGGCTCACTACTTTCACGAacatgccattttatgcttgagacgta tgtactaaatgataaatctagtctgaattaggatcctaacctaagaatgt tgtaagaatattttatgatgattttccctaaaaagctaagaatattcatg atgaaatggatttacaccattcttatgcAAAAAAGCGTGTAGGTAACCTG TCACAGACAATGGACATGGTGTATGGAATGGTTATCAGTGTGGCGTATCA GGCACTAAGAGTAGAAAGATTGACCTTTTCACACTCTTGCTACTAATTTT AGACCATAGGATAGACTTGAGTTTATTTTGAATGGGATAGCCATGCGGTA AAACACAACTCAAAgaccaaatcaaaacattccaaaaGTGAACATATTTG TGTGTAGAGTATAGAGAGCCCCTATTTTTCTCCTTTGACAACGCTCTCTC TCTCTCCCTCTTGTATTTTATTTCATCGCGACAGTTACGTGTTTATGTTA AAAGAATTTCGTTTAGTGTTGGACTGGAGTTTGTTGTCATTTTTGAGTGT TCTGTTAGTTTCTTACAGGTTGGCCGAACTAACTTTACAACCATTAGAAG AAAATTTCGTTTCGTTTTTCATAGGCTAGAAGAGTCGTTCATTATTCATG TAATACAGTATAGTGTATgtgtgttatatgataatacgataattgttgCT GGATAATATCAGTTTAAATTAACTATAGTCTACAATTATTTTCTGCTTAT TCTATGTATAACTTAATCGTCTAGCATGCACTACGGCAGCATACTAAATG AATACATAGGGTTCAATTCTGAGACTGTTTTTTAAAGAATTCAATGGTTT TGTTTAAAGGTGCAGTTTATTTTCGAAATCTTCTCTCAAAATTTTAGTAC GCTCTGGTAGATAGGAAGGTTTTTAAAATCTGATCTTGAGATTGTCATTA TATGTACCTACAAACCGTCTAGATTTATTTTAAAGGATCTAAGCTTGACT CACACTATTGACTATGAAACAAGTTGTAATAGTGGGACGGTACCTAGGAA ATGCATTAGCTTCCGATATTATGGTTTAATAAATAAATGACTTGCTTCaa cttgcattttttttttgatNCAGACgcagtaggattttttcaagccagtt gggataaaaataacggactgaaactcgatggggattggtattccaatatt ttttatggctggggatttcaattcttttgtttccaagtcagaaaattcag tagggatggGAAAGATAGCATAATATCTATATCTTGTAGTGAAGTTTGgt tcatttgattattttcggtggagacaaaaattggagaataattttctacg ggggacgatattttggccaattcttTTAGTGGGAAGTGTTAagtgagtct gtgagaaggggtgttttTAGCTGTACTATCAATGACTACAGTACTTTCAT AATCACTGGAGCTCGTATaaaacgtcataaaaatgttcatataatgttag atgaaTTTGGAAACAACCTTGATTGTTAATTGGGAGCTTTGCAGAAAGCG AAACATCTCCATAACGCTAAAAGTTGGCTTTGCTATGGACACTTTTGCAA GCTATTGACTAGATTATGGAGAATTTGACATCATAAGCTGACAGTATTTA CCAAACTTGATGGAGTTATCGCCAAACTTTGAAATCATGCTGTCATTAAA GTTTACTGTTTGCATTTAAATGTACAATAGTGAAAAGAATAgtaaaaatc tggtaaaataaATATGTTTTAGGCctagaagttttttttataagagcatc caaatttttccaaagccttgggatgttcttaaccttttgagttttttgtc taaaaatgttcttaaaacgattttgtgagtgtttctgtgcaatttcctaa aaaattggTTGCCATAGATTCCAGtaatatgttcttaacttgttcttaat attttggtcatcgatgcagtgtgttcttatatagcttgttcttataaaga aacgttcttataaagaaacgttcttataaagaaacgtgtAGTAGATAACC TCAGAGAAAGCCAACAGTTCCAAACAAATCAGCAACAAACACATAATAGG AGGGGCTGAATTGAATAATAGAGAAAAGCTAATAAGGTAACAAGCATAAC ATATAACATTATGACAAGATAATAGGGAATTTNATTTCGTTTttcataga ctggagtcgtttatttTTCGTAGTAATACAGTGGTGTATTGGTGTTAttt gataatacgataattgttgCTGGATAATATCAGTTTAAATTAACTATAGT CTACAATTATTTTCTGCTTATTCTATGTATCGTCTAGCATGCACTACGGC AGCATACTAAATGAATACATAGGGCTCAATTCTGAGACTGTTTTTTAAAG AATTCAATGGTTTTGTTTAAAGGTGCAGTTTATTTTCGAAATCTTCTCTC AAAATTTTAGTACGCTCTGGTAGATAGGAAGGTTTTTAAAATCTGATCTA GAGATTGTCATTATTTGTACCTACAAACCGTCTAGATTTATTTTAAAGGA TCTAAGCTTGACTATTGACTATGAAACAAGTTGTAATAGTGGGACGGTAC CTAGGAAATGCATTAGCTTCCGATATTATGGTTTCATAAATTGACATTTC ATGACTTGCTTCAACTTGCATTTTTTGATGAATTGGATTCAATGCCCTGG TAAATGTAGATAATGTTGCAACATTAAGTGTCCCTATATTTTTGGTACGG AAAAGGTTCTTGTCTGGTCTACTAATAAAGCAGAGCTAGCTTATCATTTT AAGTTTATTTACTTATGAGAGGGAGTTTGTGAGAGTAGCTAGCTGGCAAA AAATATCGCTTCAATTTTAAAATAGTTTTATATGGACGTTGGAttggccc cggggggggggggNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNAAAAAAAGCTTTTTAGTGTTTACTTGT TGACATTTACTCAGTTAAATAGTGAAGTACTCACAGCGAGAGAGATGTGG TACTAAATGTGAAAGAggatttcttgattttcttgatttcttcATATACG ACTTATGCATATAACTCacgcaaaaaaagatttttctctttttattttgG CTTGGAGAGGACTTGCATGTTCGCTGATCCTCGaagattaatttttttgt gttttttaatttttgaaccTGTCACTGTTCTTGCATTTAGTTATTAGTTG TAGTTAGTCATGCAAAAAAGTTAATCTTGCTGATATAGTGTCTTGAGGTG CAGGCTGGTTTAGGCAGTTgtattgaagtttttacaagatgctcacataa ttggttaaagtttttgtttgaatagttaacgaccaatcctatgacaaaaa ttcttgtaaaatgttcaacttgacccGATTTAGGCTACAAAagccaaaaa aaagtttgttccATCCAGATGTTTATTTTTGGTCTTTGGTGGAATTTGTG TGTAGATAGAACTTCACTAACGTATGCAATGCTGCAACCTACAAATCTTT TCCCTTTTGCTTAGTTTTCTTAAGCTTTTGGAAATAGCTGGGTGTCTCAG CTCTATTTACTCTTGTTATATCTTTATCAAGTAATTACCTTGGGATCATT TACAtagacactttgttttgaacTTGTTTAATATGCCTAGCAGACTTGTG TATGTCTGTAAAGCCttttggtctttttttttaattaaaggtACACTTGA CTTTATGTCATATTGCTAAATTTGGTCTCTGAGATCGATTGAGAGACTAA AGgggttaaaataaaaaaaggatttttcttTCCCCCTTTTTTGTTGTATG TTTGTTTGTGAATGTTTTGTAGTTTGAAGGACATTAGTATAGGTATGTGA TTTTTTATCATATTGTTTTTTGGAAGTCagttcattttgtttttgttgtt tgacGAATGTTCATACTAATTGTGGAAGTTTGAAGTGCCATTATTTATTg caattttataaaaagactGGATTCAAATTTGTGCAAGATTGATTTTGGTT CGGCGTGTCTTTTTTAAATACAATGGATTCTCCATAACTCTAACATGCCC GGGAATCACAAATTTGTTTAAGTTGACGAGATTTCGATTTACGGAGTAAG GTTTACAAGCCATTGTAAACTGAAGGATACTTGTTCGAGATAAGGAGTTG TGAgtaatagaagttcgagttaaagagactccactgtattttaTTATGTC CGACTGATGTTTTTGAAATatccaaatttgaaaattgatgcaatttcact tttatctaTGTTAATCTGGTAACGTTGCTCATCAAAACAATTGCATCATT CAAATTTTAGGAGTTCGATGCCAAATACCAAGTATAAACCATGCAACTCT TTACTGTGACGGACACACTCCATGTAATATATTTCCCCTTTCTCTCTTAT CTTTTTAGATTGATAGCTTAAATCATCTCGTCTATCAAAGCTTACGACTC TCAGACCATGAATTAACAGGGACAGTCAACGGTAAATGTTTATATTGTGA TTCACATGTTGAAACGTTAAAAAAATCCGCACTGGAGGTTGTTAAAACGC AATTTAATCCGTTTCTGAGGAACATGATTCCATATAACAACGACACGAAT AATCTTACGGCAGCcgaccaacaacaacaacaaagcaTGCTGGTTGATCG CAATGTAACGACGCGCGGTGAATCAACGGATACTTTTAACGGATATCGAG TACCAGGTAAGGAGGTTTCGTATTATTTTCGTAATATTTTGTATCTTTTG AACCTTGCTCTTGACCTTACTCAATACACGCCTTTTGCAGGAATTTCGTA TTTAATAAGTCCGATATTTACCcaagtttttatgaaaaaacaatttacGT TTCAATCTCTAGGGCTAAACAATACTGTTGGAGACTCGCgttcaaatgac gtcacacttcATCAATACACTAATCTTCACCAACCAGATATGGGCAAATC AACAACCAACCAATCAGCTCCCTCCAATACAACTAATCCGACCAATCAGA ATTCGACACGATCAGCAATGACATCTCAGTTCTTCGTTGAGTAAGTGTAT GAGCATTATCATTTCTTAGTGAATCTATTTCAGATTATCTGTTTATCCAA TAAAAGTGCTCAATGCTAACAATGATAACAGAGCTGTATGCTTTCACTGA ATTTCACTGAAGGTTACCATCTGTATGGCCTGAACCTTTATGATATTTAC TTAACTCGTTTCCATTACTCAAACTAGTATCTTGCAACCAAAAACCAACT CATAGGTTACTGGTATATTTTAACTAACCCTAATTCCTTTAATACCTTTT GTAAGGGGGACGACTCAAAGACACTTTTCAACTTGATCTTCTTTGATCTA CATTTAGAATTGTAGGAATAAGTCTTAAGACCGCAGTCGGAGGTAACCCG AAGACCCCAATTTCAATAGTCttctacctgaaggtaggggaggaTGCCAC CCTTTcttcctggattgctccacCTTTCCTTGTTCATTCTCTTTAACTGC TGAACACTAATCGTAGATgaatcaagtaccattttgctGAGTCCGGGTGG gagttgaacccacaaccttgcgcaccttagctgaatgctctaccactgca ctactgTACCTGATATCAAAAGACTTACGATTTATTTATTCCGTTCTCTT TTATTATCACAGGGCAGCGAAGAAATATAATGTCCGAAAGAATcgttcat cttcatcttcaaaaCACAAGAACAAAGAATCAAGTTCCTTGTTCCCAACC AACTTCACTAACATGCTGAAACAATCATCACCATCTAACCCACCCGGTCT TTTCAAATATATGGGGCGTAGAGTTGATGGCAAGGTTTGTAGATTAAAAA TATCGAACCTAGATGCGTACTAGTAGATAAAGGGCAGTTTTTTCAATCTT AGTTCATCATTTGGGCTGTCTTGAATCTGAAATGAGATTGCACTTCATTT AAACACCAGCTGTTCAAAAAATACCAAGCTAATAAAAATATCCATATtat ttaaatttgtatttttaacCGTTTTTACCTTCTTCGTTTCCAGGTCTCTG TCATGTTACGCGTCCAACCTTCCATCAACGACCAATCAGATAACTCGCTC ATCGAAATCGATCTTCGTAAAAAACAAATCTCCTTCTTACAACCCAACGC CCCTTCATCAACACCCTTAGACGCCAATCAAGCACCACCGCCCTcccaac caaaatattttggcttCGACAATATTTTTACACCGGAAGAACGACATGAT CGAATATCATCTGGATCTCTATTAGACGTCCTACACGCTGTTATTAACGG TGGCGACGGGGCTCTAGTCACGTATGGAGGACCGGGAACCGGAAAAACAC GGACCATGGTCGGGCAAGATGGTAGCAGCACAACGGCCGGTATTTTACCA TGCGCAATAGCATGGTTATACAGTTTAATAGACGATTGTAAACAACGAAC GGGCGCCCGGATCTCCATACGGGTTTCCGCAGTCGAAGTTGTCGGACGTA ACGAAGAGTTGAAAGACTTATTAGCAGATCAAGCATCTGGGACTGATAGT ATAGACAGTCATAGTGCGTCACCTGGTATTTATTTACGCGAAGATCCGGT AGGCGGGATAAATTTGGAGAATGTGAGTGAACCACAAGCAGCTAACAAAG AAAAAGCGGGCTTTTATTTGGATGCAGCTCTGGCTTCCAGATCAGCTGGT AAGTTCATTGGATAACTTCTGACgtgaaacaaaatttttatcaaCGTCGA TCATATAACGTTGGATAAACGTTTCTAGGGTGTGATTCTCCCCTAGGGAG ATGACGGAATTTCTAATGGGGGATTTCTAATAATAGGAAGCAAATCATTG AGATCTGTAGTATCTTTCATATATTATATGTGTGATTGGTTCGAGATTAT TATTAGTGTTGAAATTCCTTATTGATGCTGGGAGGAGTTTCAACCATCTT CAAGTTATTACTATTCATCTGATTCTAATTTTCGTTTTATTTATATAGAA AAAGACAATCAAGGAGTGACGCAGAATAGCCATATGATCTTCactttcca tatttatcaaTATCGCGTGGaaaaaaatgcaagaaaaatCCCGTCAGGTA AGTTGTTTCGTTTGGTATTTTGTCCTGctttttgattggttgattttccT TAGAATGAAAGGTTTAAAGTTTGCCtttccaatttctttttcactatCGG GCTCGTAATATTGACAAACACGTATTGAATTTTGGTCCCGATTAATTTTA CTTGTTACTTTTCCTCAACGTATATTACAAATTCAAACGTACATTTCAAA AGTACATATTATAAAGAAACTAGGTCATCAGCGTTGCTCGTGGACCATAA TCCCTGTAATCCCAAAGTGAATTTAGAATATAATTGGTTAAGTAGTAGAC GACAGACGTCTTGAAACAAACTTGTAACCTTAACTTTCATTCAAGTGCCt ctttaaagattaaagaaaaATACGCGAAAATATCGCGCGCTTAAGCTCTT GAAATTACAAGTGTTTTTCTAAACTAAGAAATTTGCGTTCACTATTTGTG TTTATTTGAGTCATTGACAAACTTTTTGGCTGTGTTTATTGAAAGTAGTC ACTAACTGACATGTCACTATTTCCTTTCATAAAGAACATGAACAAATAAA GTCCCCTTGTTTTTGACCAGCACACCAAACATAGTGAATGTCAGTCAACC CTTCTTGAATGTTTGTTAAAACGATAACTTTAAACATCCTGTTGTGTGTC CGTTAGCCATGTTACTTTCTATCACTTTCTCTCTCCGTCATTTTGAATTT GGTATCCTAGCTAGCACCATATTTGTACGTAAATATCTCTTCTGCGTGAA TACAAAACGAGCGCTGTATTAATCTTTACCCTCCAACTCCTAAGTTTGTT TAACGTAAATTTGATTTTGGCATTATAGTAATCAGGATGATCAGGGGTAA CgaaaaaacaaattgtaaacgATCAGAGCCTCCGATTTCaaatatcgcaa aaaaaaatgaatgttATAATTATTCTATGTCcttcagtaaagaaaaataa ttgagAATATCATGAGAATAGTTATAGCCTGAAAATCAAGAATACCGAAA AATAACAACTGCACCAAACCAGTTTGGATTCTATAATCGCTTATACTCAC TCACACTTTTTAGTTTTTCACTCATATCCTAAATTGACTTCAATCCTAAC AATTCCACATTCTTTTTTCATTAGGTTCAGTACCGCAATACTCAGGTGGG CGATCCAGGCTACATTTGATTGATCTCAGTTACGTCAACCaaaatttcga agaaaaaacatcACAGCCTAGTCAAGCACCTAGTCATGCTGCGTTGGGTC AAATTATGATCACCATGCTTAATGGAAACAAAAAAGTCACGTTGTTCAAA GACAGTAAAATCTCACGACTTTTACGTGACTCTATTGGTAACCAAACGTG CCGAACAACCGTGATAGCTCACGTTTCTGCGGAAGAGAAAAGCGCACGAA AAACACTTCAAACGCTGAATATCACGCAGAAAATTCAACGCAAACGTAGA AAAAGAAATAAGGTACGTAATGACGTAGTAGCGTAAGTACGTGGATAATC TTCAATCATCAAGGGAGACCCTTTAACTGAACTTAGTACAAtaaagtctc tataactcgataGCCCAcaagaaacacaaatttgttcgagttatatgGAA GTTTAAAGTAAAACAAACAGGTTTTATAAGGAATGCGGTATGTTTACCTA AAGGGNGCCTGAAAATCAAGAATACCGAAAAATAACAACTGCACCAAACC AGTTTGGATTCTATAATCGCTTATACTCACTCACGCTTTTTTGTTTTCCA CTCATATCCAAAATTGACTTTAGTCCTAACCATTCCACAATATTTATTTC ACTAGGTTCAGTACCGCAATACTCAGGTGGGCGATCCAGGCTACATTTGA TTGATCTCAGTTACGTCAACCaaaatttcgaagaaaaaacatcACAGCCT AGTCAAGCACCTAGTCATGCTGCGTTGGGTCAAATTATGATCACCATGCT TAATGGAAACAAAAAAGTCACGTTGTTCAAAGACAGTAAAATCTCACGAC TTTTACGTGACTCTATTGGTAACCAAACGTGCCGAACAACCGTGATAGCT CACGTTTCTGCGGAAGAGAAAAGCGCACGAAAAACACTTCAAACGCTGAA TATCACGCAGAAAATTCAACGCAAACGTAGAAAAAGAAATAAGGTACGTA ATGACGTAGTAGCGTAAGTACGTGGATAATCTTCAATCATCAAGGGAGAC CCTTTAACTGAACTTAGTACAAtaaagtctctataactcgataGCCCAca agaaacacaaatttgttcgagttatatgGAAGTTTAAAGTAAAACAAACA GGTTTTATAAGGAATGCGGTATGTTTACCTAAAGGGATCAAGTCTATCag caaacttgttcgagttaaggagatattacaatctaccttaaaggaagaaa tttgggcgggaatttaatttggcggatggccaaaaaagttttttcagagg gaatttaatttggcggatggacgaaaaaagtaaatttggcgggaatttaa tttggcggtcgcttaaaaatttaaccttaagatggcgtcaaaacagcgaa aaaatagcaaaaacaccttaaaagagaNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNagcgggaatttaa tttggcggatggcggaaaaaagaaattttggcgggaacttaatttggcgg atttcagtcaaatccgccaaatccgccaaattttctttccgccaaaattt cttcctttaaggtagtgcTGATTTGGAAATCTTTTTGCTGATTCGTTTTT TTGTCTCAGTCATTTTGGTTTCTATTGCGTTTTTAAACGGAAATAAGGTG CTTAGCATGTATTCCCTTTTATGAGGTATTTTTGCGGACATTACCATGGT AACTAAAATAAACACTTGCATGTTTCAGGAAAATCCGGGAAATCCGGAAA AATATGAAATGCAAACAAACTTACACATATTTCAGAAAGTTTAAAATTCC AACCAACTGAAAAAAAGATGATTGACTTTGGGATGTTAATTAATCATAAA TATGGCTTCCTTATAATACTGTTTTATTTTTCGTCCCATAGAACTATAGC AGCTCATCAGACCAAAGCTCGTGTGATGAAGGAGGCAAGCCAAAATTTCG CGTGCAACACCCTCTTATCTCAACACGTGCAATCGAAGACACTTACAATT GTTCTGATTACAATACATCATCAGCCGGCGAAGATTCCTGTGACACAGTT ATCTATATGGGCTCGTCAGGCGGACACTTAAGTGATCGCGATTTAACGGA TAATGAACGCCCACCTTCGCCGAACacaatgaaaattatgaaattgaaac tttcttcttcTGAGGATGAGAATACGGATACTGGTAGTGATATTATGCCA TGTGCAGATTCTACTGAAGATTTGAGAATGAGATTAAAAACATTGGAAGA GTGTGAAGAAAAGACTAGCTCACAGGCTCCACTCTCTCCGCCTCCTTCTT TGTTGATAGCTAAAAAGCCAATCGCTCCAATCGAAAGAGCTGTAAATGTT GTTGCGCCTCTCGTTGTCAAAGAAACGCCCATCATTGAAGAAGAGACCAC TCCCAAAACGCCCGATATGACGAAACCTTTAACGCCCCCGCCACAAACCG CAGAAGAAGTGAAACGTGAGATCAGTATGACTTTCAACGCCCAAGATACA ACGCCCAAACAAGAAGCCGCCATGGATTTAGAGAGAAACGTTAGTGAAAA AGACTTACGTAACCACGAGAAAAGAATTGAGAAACTTTTAACAGACTTTA ACGCTTTAAGTGATGATGAGGAAAATTCAGTCGAAAAACAAAACCGTAGA AATAATTCGTATACACGCGGTGACGGCTATTTGTCTGATGCTGCTACGTC ACTACTTCGTAACTTCCGTAGAACAACGTCAACGAGTTCCGCTAGAGACG GTTACATTTCTGCACCGGAATACTCTAAAAAACCGGTTCAGATAGTTCGT GGAATGGTCCGTAAACAAACGAGCCTCGACGAAGAAGAAGTTattgaaaa acttaaaaaactgAGTAATCAAGACGAAACAGAGAAGGAAACTTGTCTCG ATGATATTCTAAATAATGTCAAAACAAGCACACCAAAATCGGACTTATCG AAGCAACCAACCACGAATgatcctttaaaaatacaaccCTTAACTGTCGG TCGTTTTTCGTGTATACGGGAAGCATCAAACGGTGAGTCTCCAAAGATTG CTCCACAAAAGGATCTATCTGGAATTGCACTTCAAGAGATTGACGAGACA GATTTGTCGAGGGAATGCCAGCCCAGTACTAGTCGTGTCGAGGAAGAACC GACATTAAACGCCTCTACTGATATTGCTGGTCGACTTCAGAACTTAAATC ATATAATTACCGTATCCTCGGTACCAAATTTCTCGGTTGCTAAGAAACCT TCTCTTTCCAATCTTCCATCATCACCGACGATGCCTATTCGTCAAAATCT GTCACGTGATTTACTCGAATCAGTCAATAAGGATCGAATGTTTAGTCCAC CCAGTTTCGAACGCTCGTATTCGCGTGAAGACACAATCAGTGTGGTTTCT GCATATGAGAGTGACGCCTACGATTCTGACGCCCTTGCAAGTCCCGCCCT TGGTGGAGGGCGATCTGGGCGTAACCCAACTCGTCTGAGATATCGTTGGT CGACGGTTTATGAGGAACCCGAAGATAAAAAATCGGAGAAACACAAATCC CGAAAACCAGTCGTGGATGGTGAAGGAAAACCGGCTCGTGTAATCACATC TCcaaaatcttttgccaaaaaCCAACACCAAAACTCTAAGAACTCACTAA CATCTCGATTCACAAAATCacctaaaaatgaaaagaaatcatCAGAAACG CCAAAATCgcctaaaaaattattttcctcgTCATCTTCATCAAAAACAAC GGACATGCCGCTATCACCGAAATCTGGAAAATCGAAATTCAGCATCTTGT CACCAAAATCGGAACGGAAAAATAAGAAATCGAACAGCGGAAATAACCAT TCGCCGGATAAGCGAATGTCCGGATGTAGTGAAGCAAGCAGTGGATTGGA TAGTGGTATTCACAGTCAGACGTCTTCATTGAGAAGTGGCGAAGAAATTA AAGTTGATGATAGCACGATTGTTAGGGAAGAAGTTCGATCAACCAAACAT AAGTTATGGCCATTTGGGTAAGTGAATTTTACAGTCCAATGTTGCAACTT TTCCATAATGCGGAAATCCGACTAGCTAAGAGACAAATACATCATTTTCG TCTAGCCAGTAAGAGGGTTTTTGACTCAAACGACAATCCTAAGATTTCCG TCCATGCTCACAAATACGCGGTTGCAATACTGTActgtcaactctctcta attcgatacacgttttttttataagaacgtcaaaaattttcgaagccttc ggatgttcttagttttttggatttgaagcttcttattttcagcatttttt gagcattatgatgtaattttttaagaaattgcatgtttttaagtctccaa agccttagtatgttcttagaatgttcttaaatttttgggcctcgaagctt tatgttcttatatagtttgttcttataaaaaaaacgtgtagcttttATTA TTCGAACACCTGTGTAGTTCGAACTAAAGCATTAGTGTGCTCAActggaa aattgtataaaaTACTATGCATAGTACGAATATTTATataatttaaaaga aattcttgaccccttgaagatcgatttAGAAAGAGTAAACTATTTTagat tttctggaaattttgTAAATGGGTTTTGTAAAGAAATTTACTATTAAGCC GAATCTTGAAAGAGCTCTGATAAAGTTTCAAATCTTTAATAAATTATTGT ACTGACAAACTTTGTTCAACATGAAAGTTAATCAGCTCAGATTACCAAAT GTTTTATTAGACTCTTCAAGCCAATGAATTCATCTTTCAAAGACTTTTAC CCTCTTTCTACCTTATTTTCAGACGTAGTAAATCACGCAAATCGTCACGA AGTTTATCGGGATACGTCAGTGATAGTGTCACGGAATCACGTTCACGAAG ATCACGATTCTTCTCACGAAGTTCAAGTAAGTACATTTCTTGTACTCTCT TTTGCATATCTTTCATTATTCAAAACACTTTAAAGCATTAATGTCTTGCT CATGAACGGCTGGAGAGCTTTTTGACCAATAACAATATCAATCAAAAGCT CTTTTAATGATATTTACAagtatacagtggagtctctataagtCGAACGT GTATGGGGAATTGAAATatcttcgagttatggaaacttcgagttatggaa atttcgagttatggagactgaTTTACAAGGCTTTTTCACTGACGTGACGA GAAACTTGTTTGAATTAAGGACATTCGGGTAATAGAGCTTCGAGCACTGG AGACTCCAGTGTATCATCGTTTGCGAACCCGGTTAACAATCACCatcttt tctttcttctatAGAATCTTCTTTGAGCAATACAGAAGGATATTGCAGTG GTTACGAAACGTCCGTGACCGAAGGAGGCTTGACCAGTTGTACTGAAGAC AACTATACCACTGATAACGAGTCGGTTACCggcaaaaagaagaagaaaag attcCTCGGTTTCCGTAGGCGATCGACAAGCGATCTTTCTTCAACGCGCG GCCGAGTGAAGAAACCATTATGGTTCGATTCCAAACGCGGATGTCAGTCG GATACTGAAGATTTGCAATTGAAAGTTTATCAAATAGACGATCCACAGCA AGTCAACAAACGAAAAAGCAGTGGCAAAAAGGAATCGCAAAATATGGTAC ATataatttgattaattttaaaTTCATAGTCCGATGTTATTTGTTTAGAG TTGCactgtatttttttcaattagaattcttttatagaaaagccAAAGCC GGGGGCAAAGACCAACAAGGCTGAAATTCATTCGATTATTGATTCTCTGA AATTTCAGAACCCTTTAAAGTAAAACATGTATCCTTCTTTCTCACTTGCA GCCTTCGCGACAACATCCGCAACAGCAGCAAACATCGAGACATATCGAAG GACTTCGAACACAAAACGAACAATTAAAAAGTGAGAGTTTTTCTTTAGTT TCAATGATGTTACATCAAGAAACTAATATTGAGGATTTATGCTCATGCAT ATGGGAAGTTTTAGTAACATGCTccaatttttccccgataacGTATGCTG GAAGTAGGCTCgctgttttgaatttttatctcAGGCTCTTTTATATTTCC TCTTGTTTTGATTGCTTAGTAGACTAGATTCAGCTTCTAACTGAACGAGT CCAGTTAACTAAGACTGGGTATCCAGTCTATAAGAAGTCCCCAGGTTACT TGCTTAGGGATTGACTTTTTAGAAAACAGAATATTAATAATAAATGCTGt tcatttctttttcagaaCCGATTGGTTACATGAAATATCAACCAGCTGCT GTTCCCTCATACAATCCAAACCACCATCCCCAACAAAGTTACCTTCAGCA TCAACATCCTCATCCTCCCCATCAACAAATTGCTCAACATTCTTCCTTTA CTCAGCAACAATTACATCAGCACCagattcaacaacaacaacattttCAA CGACATCAACAAGCCATGAAAAACCATCATATTCAAGTGGTGACCTGCTT TGATCGAACTTCACGTAAAGTCACacagatttgaaaaattttgtttctgC ATCGCtcaatttttctaagaaaatcgaaattcaatcaTGCCAAGATGGTT ACCAGGCTTTTAAAGATCTTAAAACATTGTCCCTGtctatcccaggcttt atttatgttACTGATTGACTacagagaatattatctagcgctatcagtaa gcataaaaaagccgATAATACGCAGGGGACGAAGATGACAATCTCTGATA AACgtggatttgactgaaattttatggctcaaatttttcgTAAACTAAAG TTTTTAAAGTATTTAGCTAGCTTAAACTACGAAGATTATACCAATTTATG TTAAACTGAGATATTTTTAAGTTCTTCGGTTTTTCCTCGTTTTATCAGGA AACTGTAATCAAATTtccgaaaaatcatcaaaaaacaaaatttgctcaaa tatGATAAGATTTC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000272XLOC_000272Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000418-exon-sc0000002-1491911889:171654..171706TCONS_00000418-exon-sc0000002-1491911889:171654..171706Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1510915933:171654..171706TCONS_00000418-exon-sc0000002-1510915933:171654..171706Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1575043694:171654..171706TCONS_00000418-exon-sc0000002-1575043694:171654..171706Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1491911889:184135..184365TCONS_00000418-exon-sc0000002-1491911889:184135..184365Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1510915933:184135..184365TCONS_00000418-exon-sc0000002-1510915933:184135..184365Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1575043694:184135..184365TCONS_00000418-exon-sc0000002-1575043694:184135..184365Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1491911889:194762..195059TCONS_00000418-exon-sc0000002-1491911889:194762..195059Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1510915933:194762..195059TCONS_00000418-exon-sc0000002-1510915933:194762..195059Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1575043694:194762..195059TCONS_00000418-exon-sc0000002-1575043694:194762..195059Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1491911889:195216..195393TCONS_00000418-exon-sc0000002-1491911889:195216..195393Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1510915933:195216..195393TCONS_00000418-exon-sc0000002-1510915933:195216..195393Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1575043694:195216..195393TCONS_00000418-exon-sc0000002-1575043694:195216..195393Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1491911889:196016..196187TCONS_00000418-exon-sc0000002-1491911889:196016..196187Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1510915933:196016..196187TCONS_00000418-exon-sc0000002-1510915933:196016..196187Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1575043694:196016..196187TCONS_00000418-exon-sc0000002-1575043694:196016..196187Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1491911889:196397..197051TCONS_00000418-exon-sc0000002-1491911889:196397..197051Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1510915933:196397..197051TCONS_00000418-exon-sc0000002-1510915933:196397..197051Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1575043694:196397..197051TCONS_00000418-exon-sc0000002-1575043694:196397..197051Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1491911889:197352..197450TCONS_00000418-exon-sc0000002-1491911889:197352..197450Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1510915933:197352..197450TCONS_00000418-exon-sc0000002-1510915933:197352..197450Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1575043694:197352..197450TCONS_00000418-exon-sc0000002-1575043694:197352..197450Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1491911889:198578..198915TCONS_00000418-exon-sc0000002-1491911889:198578..198915Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1510915933:198578..198915TCONS_00000418-exon-sc0000002-1510915933:198578..198915Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1575043694:198578..198915TCONS_00000418-exon-sc0000002-1575043694:198578..198915Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1491911889:200545..202670TCONS_00000418-exon-sc0000002-1491911889:200545..202670Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1510915933:200545..202670TCONS_00000418-exon-sc0000002-1510915933:200545..202670Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1575043694:200545..202670TCONS_00000418-exon-sc0000002-1575043694:200545..202670Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1491911889:203476..203579TCONS_00000418-exon-sc0000002-1491911889:203476..203579Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1510915933:203476..203579TCONS_00000418-exon-sc0000002-1510915933:203476..203579Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1575043694:203476..203579TCONS_00000418-exon-sc0000002-1575043694:203476..203579Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1491911889:203968..204299TCONS_00000418-exon-sc0000002-1491911889:203968..204299Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1510915933:203968..204299TCONS_00000418-exon-sc0000002-1510915933:203968..204299Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1575043694:203968..204299TCONS_00000418-exon-sc0000002-1575043694:203968..204299Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1491911889:204505..204583TCONS_00000418-exon-sc0000002-1491911889:204505..204583Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1510915933:204505..204583TCONS_00000418-exon-sc0000002-1510915933:204505..204583Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1575043694:204505..204583TCONS_00000418-exon-sc0000002-1575043694:204505..204583Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1491911889:204919..205617TCONS_00000418-exon-sc0000002-1491911889:204919..205617Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1510915933:204919..205617TCONS_00000418-exon-sc0000002-1510915933:204919..205617Clytia hemisphaericaexon
TCONS_00000418-exon-sc0000002-1575043694:204919..205617TCONS_00000418-exon-sc0000002-1575043694:204919..205617Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:171654..205617 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
9.14975e-05 6.20026e-05 0 0 1.77896 0.426408 0.116716 0.499703 0.24993 0.00118627 0.00959651 7.54881e-05 0.0411251 0.000224122 1.26235 3.03549 3.38097 0.0500198 1.20795 0.0049114 4.33125 2.04096 0.000441034 1.43247 0.110983 0.221492 0.0204149 0.0127016 0.000528325 0.00864463
Blast
BLAST of TCONS_00000418 vs. Swiss-Prot (Human)
Match: KI26A (Kinesin-like protein KIF26A OS=Homo sapiens GN=KIF26A PE=1 SV=3)

HSP 1 Score: 317.775 bits (813), Expect = 2.021e-87
Identity = 205/489 (41.92%), Postives = 285/489 (58.28%), Query Frame = 3
Query:  840 FPTNFTNMLKQSSPSNPPGLFKYMGRRVD-----GKVSVMLRVQPSINDQSDN---SLIEIDLRKKQISFLQPNAPSSTPLDANQAPPPSQPKYFGFDNIFTPEERHDRISSGSLLDVLHAVINGGDGALVTYGGPGTGKTRTMVGQDGSSTTAGILPCAIAWLYSLIDDCKQRTGARISIRVSAVEVVGRNEELKDLLADQASGTDSIDSHSASPGIYLREDPVGGINLENVSEPQAANKEKAGFYLDAALASRSAEKDNQG--VTQNSHMIFTFHIYQYRVEKNARKIPSGSVPQYSGGRSRLHLIDLSYVNQNFEEKTSQPSQAP---SHAALGQIMITMLNGNKKVTLFKDSKISRLLRDSIGNQTCRTTVIAHVSAEEKSARKTLQTLNITQKIQXXXXXXXXXXXXXXXXXXCDEGGK----PKFRVQHPLISTRAIEDTYNC--SDYNTSSAGEDSCDTVIYMGSSGGHLSDRDLTDNERPP 2249
            +PT+F+ +L+   P  PP L +   +  D     GKV VMLR+ P+   Q      S +++D RKKQ+    P A         +A   + PK F FD +F  +     + SG++ DVL +V++G DG + ++G    GK+ TM+G+D S  + GI+PCAI+WL+ LI++ ++RTG R S+RVSAVEV GR++ L+DLLA+ A G+      + SPG+YLREDPV G  L+N SE +A   EKA FYLDAALA+RS  +   G    ++SHM+FT H+YQYR+EK  R          SGGRSRLHLIDL              +  P   S +ALG +++ ++NG K V  ++D +++ LLR+S+    CRTT+IAHVS       +TL T+ +  +I R RRK+ K  SSSS   S  E G+    P  R  HP       + T  C   D + SS+ E SCDTVIY+G  G  LSDR+LTDNE PP
Sbjct:  336 YPTDFSGVLQLWPPPAPPCLLRAASKTKDNPGSIGKVKVMLRIWPAQGAQRSAEAMSFLKVDPRKKQVILYDPAAGPPGSAGPRRAATAAVPKMFAFDAVFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWLFRLIEERRERTGTRFSVRVSAVEVCGRDQSLRDLLAEVAPGS---LQDTQSPGVYLREDPVCGAQLQNQSELRAPTAEKAAFYLDAALAARSTSRAGCGEDARRSSHMLFTLHVYQYRMEKCGRG-------GMSGGRSRLHLIDLGSCEAAAGRAGEA-AGGPLCLSLSALGSVILALVNGAKHVP-YRDHRLTMLLRESLATAGCRTTMIAHVSDAPAQHAETLSTVQLAARIHRLRRKKAKYASSSSGGESSCEEGRARRPPHLRPFHPRTVALDPDRTPPCLPGDPDYSSSSEQSCDTVIYVGPGGAALSDRELTDNEGPP 812          
The following BLAST results are available for this feature:
BLAST of TCONS_00000418 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KI26A2.021e-8741.92Kinesin-like protein KIF26A OS=Homo sapiens GN=KIF... [more]
back to top