Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000411 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000411
Unique NameTCONS_00000411
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length5506

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000411 ID=TCONS_00000411|Name=TCONS_00000411|organism=Clytia hemisphaerica|type=transcript|length=5506bp
AGAATTTCCATTTGCTGAAGAGACAGTACTATTTGGGATATGGCGTCTAC
TATGTTGAGCTTGAATACAAATTTTATGTTGATGTCATGTAAGCACAATG
CATTCTGGGAGAAACACCAATTCTGCAGACTTGGTGATATTGCGCAAGAC
GAGGGTTATCCAGATATGATGGTTGAAACACAACTTGATGATATTATGAG
CACAGCAACAACACAACAACAATATACACAACATTATCAACAATATTCTT
CAATACCTTCAACACATCACAAGATGGATTCAACAAATCCCAATCAACAA
ACTTCATCCATGAATAATGTACAATGTAGACCATGCCTTAATCGGTTCTT
AGAATTAAGGAATCAAGCCATCAACAGAATGACAATGGAGTATCAAAAGA
TATGGACTGGCCAAGGAGTACCAGCGATTGATAGCTTAAATCATCTCGTC
TATCAAAGCTTACGACTCTCAGACCATGAATTAACAGGGACAGTCAACGG
TAAATGTTTATATTGTGATTCACATGTTGAAACGTTAAAAAAATCCGCAC
TGGAGGTTGTTAAAACGCAATTTAATCCGTTTCTGAGGAACATGATTCCA
TATAACAACGACACGAATAATCTTACGGCAGCcgaccaacaacaacaaca
aagcaTGCTGGTTGATCGCAATGTAACGACGCGCGGTGAATCAACGGATA
CTTTTAACGGATATCGAGTACCAGGGCTAAACAATACTGTTGGAGACTCG
CgttcaaatgacgtcacacttcATCAATACACTAATCTTCACCAACCAGA
TATGGGCAAATCAACAACCAACCAATCAGCTCCCTCCAATACAACTAATC
CGACCAATCAGAATTCGACACGATCAGCAATGACATCTCAGTTCTTCGTT
GAGGCAGCGAAGAAATATAATGTCCGAAAGAATcgttcatcttcatcttc
aaaaCACAAGAACAAAGAATCAAGTTCCTTGTTCCCAACCAACTTCACTA
ACATGCTGAAACAATCATCACCATCTAACCCACCCGGTCTTTTCAAATAT
ATGGGGCGTAGAGTTGATGGCAAGGTCTCTGTCATGTTACGCGTCCAACC
TTCCATCAACGACCAATCAGATAACTCGCTCATCGAAATCGATCTTCGTA
AAAAACAAATCTCCTTCTTACAACCCAACGCCCCTTCATCAACACCCTTA
GACGCCAATCAAGCACCACCGCCCTcccaaccaaaatattttggcttCGA
CAATATTTTTACACCGGAAGAACGACATGATCGAATATCATCTGGATCTC
TATTAGACGTCCTACACGCTGTTATTAACGGTGGCGACGGGGCTCTAGTC
ACGTATGGAGGACCGGGAACCGGAAAAACACGGACCATGGTCGGGCAAGA
TGGTAGCAGCACAACGGCCGGTATTTTACCATGCGCAATAGCATGGTTAT
ACAGTTTAATAGACGATTGTAAACAACGAACGGGCGCCCGGATCTCCATA
CGGGTTTCCGCAGTCGAAGTTGTCGGACGTAACGAAGAGTTGAAAGACTT
ATTAGCAGATCAAGCATCTGGGACTGATAGTATAGACAGTCATAGTGCGT
CACCTGGTATTTATTTACGCGAAGATCCGGTAGGCGGGATAAATTTGGAG
AATGTGAGTGAACCACAAGCAGCTAACAAAGAAAAAGCGGGCTTTTATTT
GGATGCAGCTCTGGCTTCCAGATCAGCTGAAAAAGACAATCAAGGAGTGA
CGCAGAATAGCCATATGATCTTCactttccatatttatcaaTATCGCGTG
GaaaaaaatgcaagaaaaatCCCGTCAGGTTCAGTACCGCAATACTCAGG
TGGGCGATCCAGGCTACATTTGATTGATCTCAGTTACGTCAACCaaaatt
tcgaagaaaaaacatcACAGCCTAGTCAAGCACCTAGTCATGCTGCGTTG
GGTCAAATTATGATCACCATGCTTAATGGAAACAAAAAAGTCACGTTGTT
CAAAGACAGTAAAATCTCACGACTTTTACGTGACTCTATTGGTAACCAAA
CGTGCCGAACAACCGTGATAGCTCACGTTTCTGCGGAAGAGAAAAGCGCA
CGAAAAACACTTCAAACGCTGAATATCACGCAGAAAATTCAACGCAAACG
TAGAAAAAGAAATAAGAACTATAGCAGCTCATCAGACCAAAGCTCGTGTG
ATGAAGGAGGCAAGCCAAAATTTCGCGTGCAACACCCTCTTATCTCAACA
CGTGCAATCGAAGACACTTACAATTGTTCTGATTACAATACATCATCAGC
CGGCGAAGATTCCTGTGACACAGTTATCTATATGGGCTCGTCAGGCGGAC
ACTTAAGTGATCGCGATTTAACGGATAATGAACGCCCACCTTCGCCGAAC
acaatgaaaattatgaaattgaaactttcttcttcTGAGGATGAGAATAC
GGATACTGGTAGTGATATTATGCCATGTGCAGATTCTACTGAAGATTTGA
GAATGAGATTAAAAACATTGGAAGAGTGTGAAGAAAAGACTAGCTCACAG
GCTCCACTCTCTCCGCCTCCTTCTTTGTTGATAGCTAAAAAGCCAATCGC
TCCAATCGAAAGAGCTGTAAATGTTGTTGCGCCTCTCGTTGTCAAAGAAA
CGCCCATCATTGAAGAAGAGACCACTCCCAAAACGCCCGATATGACGAAA
CCTTTAACGCCCCCGCCACAAACCGCAGAAGAAGTGAAACGTGAGATCAG
TATGACTTTCAACGCCCAAGATACAACGCCCAAACAAGAAGCCGCCATGG
ATTTAGAGAGAAACGTTAGTGAAAAAGACTTACGTAACCACGAGAAAAGA
ATTGAGAAACTTTTAACAGACTTTAACGCTTTAAGTGATGATGAGGAAAA
TTCAGTCGAAAAACAAAACCGTAGAAATAATTCGTATACACGCGGTGACG
GCTATTTGTCTGATGCTGCTACGTCACTACTTCGTAACTTCCGTAGAACA
ACGTCAACGAGTTCCGCTAGAGACGGTTACATTTCTGCACCGGAATACTC
TAAAAAACCGGTTCAGATAGTTCGTGGAATGGTCCGTAAACAAACGAGCC
TCGACGAAGAAGAAGTTattgaaaaacttaaaaaactgAGTAATCAAGAC
GAAACAGAGAAGGAAACTTGTCTCGATGATATTCTAAATAATGTCAAAAC
AAGCACACCAAAATCGGACTTATCGAAGCAACCAACCACGAATgatcctt
taaaaatacaaccCTTAACTGTCGGTCGTTTTTCGTGTATACGGGAAGCA
TCAAACGGTGAGTCTCCAAAGATTGCTCCACAAAAGGATCTATCTGGAAT
TGCACTTCAAGAGATTGACGAGACAGATTTGTCGAGGGAATGCCAGCCCA
GTACTAGTCGTGTCGAGGAAGAACCGACATTAAACGCCTCTACTGATATT
GCTGGTCGACTTCAGAACTTAAATCATATAATTACCGTATCCTCGGTACC
AAATTTCTCGGTTGCTAAGAAACCTTCTCTTTCCAATCTTCCATCATCAC
CGACGATGCCTATTCGTCAAAATCTGTCACGTGATTTACTCGAATCAGTC
AATAAGGATCGAATGTTTAGTCCACCCAGTTTCGAACGCTCGTATTCGCG
TGAAGACACAATCAGTGTGGTTTCTGCATATGAGAGTGACGCCTACGATT
CTGACGCCCTTGCAAGTCCCGCCCTTGGTGGAGGGCGATCTGGGCGTAAC
CCAACTCGTCTGAGATATCGTTGGTCGACGGTTTATGAGGAACCCGAAGA
TAAAAAATCGGAGAAACACAAATCCCGAAAACCAGTCGTGGATGGTGAAG
GAAAACCGGCTCGTGTAATCACATCTCcaaaatcttttgccaaaaaCCAA
CACCAAAACTCTAAGAACTCACTAACATCTCGATTCACAAAATCacctaa
aaatgaaaagaaatcatCAGAAACGCCAAAATCgcctaaaaaattatttt
cctcgTCATCTTCATCAAAAACAACGGACATGCCGCTATCACCGAAATCT
GGAAAATCGAAATTCAGCATCTTGTCACCAAAATCGGAACGGAAAAATAA
GAAATCGAACAGCGGAAATAACCATTCGCCGGATAAGCGAATGTCCGGAT
GTAGTGAAGCAAGCAGTGGATTGGATAGTGGTATTCACAGTCAGACGTCT
TCATTGAGAAGTGGCGAAGAAATTAAAGTTGATGATAGCACGATTGTTAG
GGAAGAAGTTCGATCAACCAAACATAAGTTATGGCCATTTGGACGTAGTA
AATCACGCAAATCGTCACGAAGTTTATCGGGATACGTCAGTGATAGTGTC
ACGGAATCACGTTCACGAAGATCACGATTCTTCTCACGAAGTTCAAAATC
TTCTTTGAGCAATACAGAAGGATATTGCAGTGGTTACGAAACGTCCGTGA
CCGAAGGAGGCTTGACCAGTTGTACTGAAGACAACTATACCACTGATAAC
GAGTCGGTTACCggcaaaaagaagaagaaaagattcCTCGGTTTCCGTAG
GCGATCGACAAGCGATCTTTCTTCAACGCGCGGCCGAGTGAAGAAACCAT
TATGGTTCGATTCCAAACGCGGATGTCAGTCGGATACTGAAGATTTGCAA
TTGAAAGTTTATCAAATAGACGATCCACAGCAAGTCAACAAACGAAAAAG
CAGTGGCAAAAAGGAATCGCAAAATATGCCTTCGCGACAACATCCGCAAC
AGCAGCAAACATCGAGACATATCGAAGGACTTCGAACACAAAACGAACAA
TTAAAAAaaCCGATTGGTTACATGAAATATCAACCAGCTGCTGTTCCCTC
ATACAATCCAAACCACCATCCCCAACAAAGTTACCTTCAGCATCAACATC
CTCATCCTCCCCATCAACAAATTGCTCAACATTCTTCCTTTACTCAGCAA
CAATTACATCAGCACCagattcaacaacaacaacattttCAACGACATCA
ACAAGCCATGAAAAACCATCATATTCAAGTGGTGACCTGCTTTGATCGAA
CTTCACGTAAAGTCACacagatttgaaaaattttgtttctgCATCGCtca
atttttctaagaaaatcgaaattcaatcaTGCCAAGATGGTTACCAGGCT
TTTAAAGATCTTAAAACATTGTCCCTGtctatcccaggctttatttatgt
tACTGATTGACTacagagaatattatctagcgctatcagtaagcataaaa
aagccgATAATACGCAGGGGACGAAGATGACAATCTCTGATAAACgtgga
tttgactgaaattttatggctcaaatttttcgTAAACTAAAGTTTTTAAA
GTATTTAGCTAGCTTAAACTACGAAGATTATACCAATTTATGTTAAACTG
AGATATTTTTAAGTTCTTCGGTTTTTCCTCGTTTTATCAGGAAACTGTAA
TCAAATTtccgaaaaatcatcaaaaaacaaaatttgctcaaatatGATAA
GATTTC
Run BLAST on NCBI

transcript from alignment at sc0000002:142447..205617+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000411 ID=TCONS_00000411|Name=TCONS_00000411|organism=Clytia hemisphaerica|type=transcript|length=63171bp|location=Sequence derived from alignment at sc0000002:142447..205617+ (Clytia hemisphaerica)
AGAATTTCCATTTGCTGAAGAGACAGTACTATTTGGGATATGGCGTCTAC TATGTTGAGCTTGAATACAAATTTTATGTTGATGTCATGTAAGCACAATG CATTCTGGGAGAAACACCAATTCTGCAGACTTGGTGATATTGCGCAAGAC GAGGGTTATCCAGATATGATGGTTGAAACACAACTTGATGATATTGTAAG TTGTGGTTTATAAAATAGTAATATGTTCTAAGATAATTGATGTTTTCTTG ACCAATAGTTGATCGCAAATCGAGCGTTGTTTCGGTGTCCAGAGATATTG TCAAAGGCTATACTATTGCGAGCGCGAAACATTTTCGACAACTACTGtcc ttttttattaaaaagcaaAGAGGGGAAAGGCAAGTGTCACCAAATTTGTT AACTGATGAGAGACGGCACTAGTGACGGTTTTCTTGGGCTTATTAGCTTC TTGGCGTCCCCGCGCAGTCAAGTTAAACACTACTATCTAGTAAGAACCCT TAGGATCCGTAGCGTCTTTCGTGGGAGGGAACCGCATGTAATTGGTTCAA ATATAGATattattagttacacggtcttaTCGAGGTGGGATACaggatat acagggtcagtaaaaatCGTATTGGTGACAACAAGTGCTActgtagccta tactagacgtcacggcGTTTCTTCTACgcagtaacgtctattccacttag CGAGCCCGGGTcttcgggctccaaacattcgattatttgacgtcatttta aacttttgaagctcctgcagtagggaaaaattaaatttgcgTCAGAACAC TTAAAAGGAttctttttttcaggaaatcgtCAAACTGGAACTCAAAAGAG AGGAGATGAAAAATCTCGGTTTTTGGTGAGGGGCTCGCTAGTGCTACTGC TGCATATCCAAATCTGATCTATATCCAATGTCGACCTTTTTTTCGTACTC ACATGTATACTATTTCTCTTTTGCATTtatttaaagagaaatcaaCAAGT TTATTGCTACTGACCTCAACTCCGCCTCTTGCACTTAAGATTTCAGACTA TTCTAACTGATTGTTATTCAAGCTCTTATTAACACGTGGTCAGACTAGTC AAACATGTGGTTGATCTTATGTAAACTATTCACGAAATTCCACCACAACG TTTTTTTGTAACGCGAGTGCTTATTGCAAATATACCTAGTAGGATTTTAT GGCATATTAGAAGTTTATTGTCAACTCCTTGTTGACTCTGTTTTATTGTA AACCTATGGATGGTCGCTTTAGAAACGCTCTGTGATTaggaatttttcta aaaagttaGATTTGTAGATGGATCGAATTTAGCCCAGAATTTCTACACTC TGTTGATTTTCGTCCAGATTACCGACGCTCAATTTAGTTTCAGTTGCATT TGGCGATCGAATTTGAATTGATTATGTTCGATTTGGTTCCATTAAGTTCG GATGACAACATCAGAAAGGTTGATACCTCAAACGTACCGCACTAACATTA GCTGAAATTTCGGTTAAATTCGTGACAATCTAAATTGAATTGTTGTCTGT AATTCGAAATTGAATAGACCTTTgatatcggagttttttatttttctaaa acaacaatgcattgtgggattgtttcggagGTATTACAATACatttccct cgaggaattcctaagagatattctatagaaaaatcaaaaactccgataag gtctattgatcAGTtatgttcgatttggttcgattcaTATCCGATATTCA ATTCAGTTCGATTGATAACGTCAGAACGGTTGATACCTCAAAAGTACTGC ACTATCTAAACAGTAGCTGAAATTTCGGCTGCATTCGACaatcaaatttg atttgaacgattatgttcgatttgATTCGATTCATATCCGATATTCGATT CAGTTTAGATCGACAACGTCAGAAAAGTTGATACCTCAAAAGTACCGCAC TATCTAAACAGTAGCTGAAATTTCGGCTGCACTCGACaatcaaatttgat ttgaacgattatgttcgatttgATTCGATTCATATCCGATATTCGATTCA GTTTAGATCGACAACGTCAGAAAAGTTGATACCTCAAAAGTACCGCACAC TAACAATAGTTGAAATTTCGGTTACATTCGACAATTGAATTTGATTTgat cgattatgttcgatgtgGTTCGATTCATATCCGATATTCGATTTACTTCG ATTGATAACGTCAGAAAGGTCGATACCTCAAAAGTACCGCACTGTCAGTA TTTGAAATGAATTCATTCATGAATGAAAATAGTATTTAATGTGTTTACAC CCGGTCAAAGGAGAGTTACTCACTACAATTCAGTGTCTCTCATTCATCga ttttttctttgattaaCAAACATACCGGTCCCGGTACTTTTTGAGGTATT ACACTCTTCAAACCACAAACGATGACGTCGTAAAGATTAAACCGTTTACA ATTATTATAATCATTTTTACTGTATCATTTTGTGATTATCTGTCTGATGt ttattttaggaaaatttttacTCGAAACTATTGCCCCCTTTTGTTTTGAG GGTAGTGCGGCATATATTTGATATTGAAACTTTGCATTGATGATTCATTt taatatcatcaaaaacaacGTTCGAATAAGTAGATAGGAATCAGATTTCG TCATCTTTTAGATAATTTTAGCCCCATGGCttcgtgtattttttattttt ctttgattgaCCTCAGGCAGGgtagtagactggagtcgtttataatgcgt gtgatacagtagtataggcgttatatgataatacgattattgttacggga tttagtttgtatgaagtaaaatttgttccctccattactttttgctttat ttctactatgtcggaattagtcgtctagcttgctagactagtagGGTAGT TCCCTCATGGGCTGACGGTATATATGCTCCAGCCCAACCCTAAGTggtga tttttattttgaatttttttatgggaaCTAATTCCTTACTAATTCGCACC TATAGTTTGAATAATTCTGTATTTTGAACTAATACATCGGGATGAGAAGC CTTACAatatactctctgtaattccgAATTTTAGTCTAGTTCGACGGTTA TGGTATTATTAACTGAAGGGATcgtaaaacttgttcgagttacggagaca ttcgagttattgAAAATCCACTGAATTGCGTATAAATGACCCAGGATATT CTTGCCCCTCAAAGACTTGTCTGAGGGCTCAATTACGGACTTGATAAGTG TTTATCTTTCAAATATTAGTTCATTACTTTGATTAACCTCTACCAATACT TTTCAACTCTTAGAACTGAATAAAAGCACAAAAACGTTTAATTGAATGTG TCAACTTTAAGGTATATATTGACTTGAAAATTTAGGTGTTAATTTGACTG ATTGTGACCTTAAAATGTTAGTTTATCAACTTTATACTGTAAGAATCTTA GATTGTTCGAGAAACGAAGGATTTAAGTAATATGGAGTTGAAATAGCCTA TGATTTTTTCGAGGGACAGGAAAGTTTGATTACTAAgtacaagttaagaa cattttaaggctttgcagactctaaaatcACCGAATTTCTTAGAATATTG CTCAAAAATAtacacaaaatggtgaaaataagaacatatttttaaggcct tatactcaagaaattaagaatatccaataagtttaaaaattttggatgtt cttatataaaaaaactgttcttattttcaccatttagtgagcatttttgt ccattttcttaagaaattggccatTTTAGCCATCAAAGCctctcatgttc ttatatatagtttgttcttattaaaaagcgTGTACTCGAAAGTATATGTC AAATAAAAGATGGCGTCAACACGATCTCTTTGCGTAGGTATGCTAACAGC TCACATTTCATATTGTCTTAGATACGTAGCCTCGTGTACATGCTATAAGG CCAAGAAAATAGAACAATAATAATGAACGAATGAATTGATATATTAGATT ACTTATTATACTATTTATGAAGTAAATATGCATTGTAATCCGTATCTGAT TTCACTCATCGACGATTTTGAGTccttcacgtttttttataagaacatcc aaattttcgaagtcttcggatgttcttaactttttgagttttttttaagg ctaaaaatattcttaacatgttcttaatttcaacattttttagcattttt gccaattctcctaagaaatcgggtgttttagaacTACGGAATggctttaa atgttcttaacttgttcttaacattttagccatcggtgccttatgttctt atatagtttgttcaatataaaaaaaaagtgtatactTCTAAAATTTGAGC GCTAGGATAAATGGCTACCTTTTTATTACGCTCATATAACTACTCAAATT ATTAACGTGAATTGGTAACCCTCGCGTTAATTACAACTGTTTAAGTCTGA GCCTTTCGCTTTATATTATTAATACATTGCCGCACTAACTTTTCCGCATT AAACACTGACGGGGTGTTTTTTTAGttgaagagtttggtacaggctttAT GTATTGGCGGATGAAATGGTTTTTCGTATCCTTCGCCGGAAGAACTCGTT AATATGGAATATTAAAATTTCCAACTTATTTGattaaatttcatcatgga ATAAAATCCGACGAATAAGAGAGTGTGAACAAAATGTATCAATGAACAGA CCCAAAAAAGGCTTTCAATAATCAAAGATTTTATCTCTGCTAATCTTCCC ATATTATCTGACTTTAAACTTATTTATGCCGGTTCATTTAGTTTCTTGTG AGTCGGCCGCTTTTCTTCTGTGAATTTCCAAAAGCAAAATTCTTATTCTT CTGAAAGGACGCCATTTTATTTTGAGTAGTCTTCGAATCTCTCATTTCAA TTTTAGTACTTTGAACCTATTCTTTGGCACTGTACACTTATTACACTTAT AAGACATTTTGCTTATCTacctgtctgtctgtctgtctgtctataTTTCT ATAATCAATTTAATAACAACACGAGAACCAGTTTCGGCCTAAACCTaaga aaatatttctgaaaCTAACTTTATATTCACGAGTCCTTAAGCCTGCAGAC TTATAGTAGTGTAATAATGTTGAAACAGATGGAGACATATTGGAAGCTAG AGTAAACGCTATTATACCTTCCCATCCCCTCCTTGTCCGACCGTTGTATG TCCAACTGTCCGGATCGACTTAGTCTCTCTTTAAAGATGATGGATGATGA TAAGCTTCAAACCACCTGTTTTGTATCTTTGGGCAGATGAGAAGGTTATC TGATACTCtaatggcgtattggcggccgcccacgctaataCTCTAAANTT TGAGCAGATGAGAAGGTTATCTGATACTCtaatggcgtattggcggccgc ccacgctaataCTCTAAAATAGTGGGCCAAGATACTTAAATCTGCCCAAC CTTCAGTGCAAAGCATGGCATAGCAGATAAATGAAAGAGCTAAGTTCGAC CAAATCAGGTTTTTCAACCCTGCTTGATCAGCAGCTGAAATTTACTTTGA GTGACATTGAATTCCAAAAAATGATTATAACATATGCAGATTTTAAACCA CACAcgtaaaacacaaacaaaagaAACTATTAAAGTCTCTTAAGAGTGAA AGAGGTAGGAGGGTTTTAGAATTTTAATGGTTCTCAAGCTTTGTTGACAG TTAGATGAATTGTTAAAACCTTATAAATAAgtgtaaacaaaaacaaacat acaTTAGTGTATCACaaaacattgttttttttcgtACCTAATCTTCAAGG TATTTTAAATGGTATATCCTAAAATTTGATGGAACAATTTTAAATGGTAA TTTGATTTGTCCGTTTTTCATCTACTTTAATACTTCATATAACATGATAG TGTAAATTGAAAATGGCTGACACTGGTTGTCTTGACACGAAGGTTATATG AGATTAGAATTGTGTCTAGGAGGTTGTGAAAATGAGATTTATTATACATT GGCATGTAATTGGTATTTTAACATGGTAAAACTTTGTTCAAATAATAATG AGCTCGAATAATTGCTTTTTATAGTGAGTTGTAGAAGTTTGCTGCAATAC CCTGGCTATGACCGATGGCTCTATGTTCTTTTGGCTGGTTTTTTCTCTTT GGTATTCAGATATTCCAGATAGAACGGTGCACTTTTTTTTGcaagaacaa actgtataagaacaaaCAAGAACATGCTTTGTAAGGCGCACACCACCTAG AGGCCAGGGGGTCATgaccccccacttttttgcaaagtacAAATCTTTGA ATCTTTGGTTGCCCCCAcccactttcattttcatgacaTGAGCCCTACTT TCGTTGGCTTTAATATACCagaatttttatgaagttgcacaaagtaagaa cattttaacaacatttttttaCGCTTAcactgaaaaaatgaagatcatcc aatagcttcaaaaattttgaacgtATAGTCTAGATTTATATAATCATCTT CTCATCTTCAAATTCCAAGGAAATAAAAGTATGTAAAGGTGTAGCCCTTT TTAATTCTTATCAAATTTTCGCTAGGTTAGGGTGCAAATTGAGAAGCTCG GTATATAATAATGCATTTCTGGAGGATAGTTAGAGAGTCGCTTTGGGGGT ACTCTTTTGCTATTTGTAGTATTTGCGGATATTAAAATGCTTTTACGCTA CGCTATCAAAAAGTAATTTAAAACCTTTTTAGCATGACTCTGCTTAATGA ATAATACACGATATATcttgaaattttctaaattggTATTTGCATGCGAA ATGTACTTGTTTTGAAGAATTACTAGTTTGTTgaaatatgacgtcatcga cgAATTATAAGCTTTGGTCAATATTTTACTTTGACAAGTCCCAAGAAATT CACTTATGTCTACAAGAAGCCCCTAGGGTTGGACAAAAGggtttttatat ttaaaaaattgtgaaTACAGTTAAAGTGATTGTTTTCGAGTCCATCTGAT TATACAATAGATATCACCTCtgctcaaaaaaacaatttcccCATGAAAAG AATTgttactttttttgtttcaactTTTCACTCCTTGTTCTCCTTgtaaa aattttccgaaaaaacaataagtttttcaaaacaaaagacaaaTTCGTGT AtatgcgtttttttttttacggaTTTCGATGTCATATCCCCGTATGTATA ACTTCAGGTTTTTTACGGTCCTGTGCTTTGGATCCTTCGTTTTTGTAGAG TCTTTGTTGTCAACTGGTCCGGGTTTTTATACTTGTAAACTTATGGATGC AGGAGCTTTGTGATATATCCAACCTCTGTGTACTTTACTGATACCAggga attattttttgtgtggtttgattttttgtgaGTACTATGGAAACATCAAA ATTTGGACAAGGGCGCCATTACGTGTACCTCAGTGCAATGAAGCAGGTAT GATAGATTTatgatttgtttattttatgATTGGTAAGCTGAGCAACAATA ATGATCCATGGAGTATAACATTCAGTTATTCTGTTTCAAACGTTATCCGC AATTTTGTTTGTTAAGTACATACAACTTTACTCAACCGAATCCTTTGACC CCGTGAAATGTTAATACAAATTcctagagtctttggaagtccAAGAATAT CAGAGATCTGAAACAAGGTTATGTAATACGAGAACGCAGAGAGACGTGCA TGTAGTTAGAtgtttattataagaacaaactNTAGAACGTAGAGAGACGT GCATGTAGttagatgtatttttatgagaacaaactatataagaacacaaa gcTTCGAtgcccaaaatattaagaacaagttaagatcaTTTTAAGGCATG ACGGACTctaaatttcttagaaaattgcacTAAAATACTCAcgaatggtg aaattaagaacatttttagacgtaaaactcaaaaagttaagaacatacga aggcttcaaaagtttcggacgttctaatgaaaaaaacatctatcgttatc gatgatgaaatttttttttctttctatgcACTTGTCGTTGTATCAAAATG CAGGAAGCCAAGGGGATTAGTAAAAGGGTCAATGGAGTTCAAAAGTTCTT GATTTATCGAACACGCATGAGAGGCTTACAATTGAAATTTCCATTGTCTT TTTTGAATGCCAACTAAACGGGGTTTTGTGTGAAAAAGATTATCATTTTT TTGAATCCACGTCAGCAGAAGATGTTGCTTTTGgaaatagtagggggaat tttgttcgattttttggaatcgcttgactgttttgttagaagcacttgtt atacatttttggaaagctaagtggtaggggaatcgaaattactgtgtttc caattttttttcggacactgttgtgtgattttcggacaaatatgacggtc tcaggcaaaaatcatagggttaaaaatgaacgaaaattttagcttgagaa aacggagaacttttgtatatttttggaaagctctcaaaaaattaagatta gagatatattgcaagtataggtgatttcagtacctaactcgagatattga gcttcaaaaagcgNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNcattaatttttaaccctatgatttttgcctgaga ccgtcatatttgtccgaaaatcacaccaaagtgtccgaaaaaaaattgga aacatagtaatttcgattcccttaccccttagctttccaaaaatgtataa caagtgcttctaacaaaacattcgagcgattttacaaaatgccctctact aaaaGATGATTTGGCTTAAAGTTTGACTCCAAGAGAATGGGTCGCGTTTG CACGATATACAAAAGGCTCGTTAACGGGTCGTTAGTTTTTAGTGTTTTTG GTATATGGGTAACCAAATTTGGTCTCGACTCCAACATTTTCGATCTATTA AATTAGTTTTCGAGTCAGAGGCAATCTGAAGGcttctctttcgatagcta tcgaTCCGAAGGTAGGGGCACTCTTTCTCTCTGTATTGCCCCACTTACCT TTGATCCTTTTGTTTAACTGCTGAGCGTCaaacagagaggcatcaagaAA CATTTTTAATCTATCTGTTGTAAGTCTACCATCTTTCATTAAATGTATcg cagctggcacacaacgttctttcaacgtttatcttaTGTTCACTACGTCC ATATAaagttagatgaacgttgaaacaactttgtgtgccagctgggaacg tCTGCCTATGGATCATCAATCTAAATGGAAATCTATCTCGGTCTTCCTCT ATTCACATTCCTCATTACACAGGTATCTTAAATCAAAACGCTAGATGGAC TTAGTTTATCTTATTCAGGCTTCTCCGACATCATAAAGCCATCCAAATTT CGAGGCTCGCGCAAGTAAAACCACAACGTCTTGCTTAAAGATGACACTTT GTGCTTCATCATTTAGACGTCCTATCtagtgttttgtataagatatcAGT GCTCCATTCTTATATGATGATGACTGGCTGCTCTTTGCAGAGGACACCCG GTTCCGTATTGAGCGGTCTAGGAGTCGTCTCATTAGAACCGTCTACGCGA TGGTTTCTACTGCGACCAGCTTGCGAGACACTGACACACAGTTTTTGGAT CGAGTGCGTTAAGTCCAGCGTGAACCACTAGGGAACAAGGCCAGCGCACT CTCTACTCATCCACGATTGATTGTGGAATCGATACCTAGCACAGTCACCA ACAGGCTTCTTGAATTTCtgtctacccaattcccctcacatggcatgggt tggcccgggcgaaggtacattcacttgtcAAGTGAATCAAAGCACCGagc gggaatcgaaccccgaaCTCCTGAACGGCAGTCAAgattgataaccacta cactactgcgcctgTTCTTATATAAGAGTCTTGATTGATACACTATGAAT GGAATTTCAACTTTTGTATCGAGAGCAATtggtaattttttgtttcgtgt tatgaaaaaaagaacaaaaatctTTCGAGCGAATGTGTTTAACAACTTGA CGGCTTTGAAGAGTTTAATATGCCTCTTGAACTAAATGTCCATCAAAAAC ATAACTCTCTCAAACAGAATAACATTGAATGAATGTTTCATTTCGATCAA TTAGTAGATAGTGCACGAATATGCTTGTGGGatggtttttattttgaacG CTGTTTCATAGTAATAAAAGCTGCAGAAATGAGGATGGTTTAGAGTTTAC AAGGGTTAAACGGTGTCAAACTCTTGTAGGTAATGTAATGGTATACGCAG ACAGTATATAATACAGGTATTTGATCCTCAGTgtcgtaggaagcattttc atattggggggggctgaagtttagtgacaccacGAGGGCCAACCATGTTT TGGCCCGAgggtgaaaattttgaaaatttgagctctagattgcttaaaaa taaactcaaaacatgcacataaagacaattatgacaaattaaaaaagaaa aactttgcattttgcaaaataaccatttttgaaaaaattattgccccccc cagttgctacggcactgatcCTGGTAGAGTGAACAGTTTAGGATGATGGG AATTTATAAGGTAGCAATAGTTTGTAGATGTAACTATTGTTAATAACTta tctaattttgatttttggaaaatggcATCTGATTTCTTTGCGATTTCCTT GCAGCTTCCTCATCAGCCATTATAGTATGAAATTCCAATTCTTAAAACTG ACGTACATGATGCTTCTTTCGTTTGCAGTATTTCCCATACCTTTTCAAGA AGATGCTCTCTTATTGGCTGATTTCAATACAATAGAAAAACGAACCAATC AAATGAATACAGTGGAATCTCTGTAGCTACGGCAACACTTACAGGggaaa caaatttgtttgaacATTTCATGCTATGGAGTAAGTTCAAGGTATCGCTA ACTGAAGGCACTGTAGTGTAGTGGTCGTCGTTCTTGACTTCCGTGCAGGA GGTCAAGGTTCCATTCCCACTCGGCGCTATGATTCACATACAAGTAAATG TACCTTGGCccaggtcaacccataccatgtaaGGGGAATAGGGTATCATC ACTCTGATACAGGAGTATGGGGAGATATGCTGGACATTGAATGTGATGTG GTGATGGTACTCATATGTTCAGTACCTGTGAGAACGCAAGGTTCTCCCGT ACTGTGCgagtatcatcatcgatacatcatggctctgatgtgtcgcgagc acagagtacaatgtctggtaagcgctgtCATTTTCTATGTAGGGGTAAga aactatcccgggatagggcTGATATCGGAGGGTTCGCTTCTCGCTTCTCT TCTCTAACTGAAGGGTCTAGAAAatctgttcgagttaaggagacattcga ctTATAGAGGTTCCAGTTATGGAGACTTTACTGTAATATGTTTTGTAAAA TATTGACACAGTAGTGACTATAAGTCGAATCATATCGTCATCATTATCAA CATCATAAACTATATAAACTGGCGACAGTGAAAGGTTGAAATATGGTTAT AattgagaaaaataaacattggtATAGTCAAGAGAAGAGAGCAGCCCGTT ATGTGAAAgtgtttttttgcttgttttgatATTTGTATAAGCAGTCTATC GTAATGGCGCTAAAATGTAaaacgttttgtttttgtgtgatgACCAAAAG TTTGTGTTTCTGATGTCATCAAGTAAGTTATGATTTTTCTTTTGGTTTAG TGGTGGTTTTTGATATGTCTGAGTATGGTTGTATGTTATGATGGAAGAGA GGTTATTTCACCTTAGATTTTATGTGTATTTTACTTGCCGAGTTTTCACA GAAATTTGTTTTATGACGTTATGTTGGTACGTTTAAggcgttagatggac gttgaatgaacgttgtgtgccaactgagTTGTTTCAGCTTCGGTGAATCG ACTGTTAGTTATTATGGCTGAGCTGTCAGTCTTTTGCCGTGTGGATGGTT AGGTTAAGTTTATGAAAAGCAGATTCGTGcagatttcttttcaattaaaa ctGCTACAATATCATAGTGTTTAGCTAAGCGAAACTAATTCTTCAagaga ttttcattttcttcccAAATTGATTCATGTTTTTATATggataatacacc ttttttataagaacgaaccCTTCGAATGTTCCTAACTTTCTGAGATTTGA GCCCCTgaagatgttcttaaaatgttcttatcttcactatgaattttaag tatttttgtgcaattccTTAAGAAATTGGATAATTTAGTGcccatgaagc cttaaaaattgttcttaacttgttcttaatattttggccatcaaaacgtt atgttctgatatagtttgttcttataaaaaacgtgtagtaggTATATTTT GAGAGATTTCTGGGTAGATAGAGCGGTTCTTTCTGATGCATTATCGGGTG GGTGCAATCAAGATTAACCCTGTTTGTATTTGGGTTTTACACAGTATTGT GATGGGGGCTATACTTTCGATTTGTAATACTTTGTTAAACCCTAGTCATT AAGAAAGTGTTCTGCATCGAATTACAATTTGAGTTCTGCAAAACTGACTT ATTTCTTTCTgcgaagattttgatttttaatagattttgcATTTCAAGAA TATTACTTTAAGAGTAAATTTTCAAGCcgcaaaaattgttaaaaatttta gtttgattAGTTTAAAATGTTAACAAAAAGGGCCTTTGTTGAAATCTATA TAGCTCAAAAATTCTggaaagaatctttgaaaatcaaCATCGGATCTTTC TTTTTTGCGGACGTGAAAAATCTCTCACTTTGACTCAATAATTCAATTTA TTTAAAACTCAACAAAAAAATACACTTGAATATAAAAATTTGTACAAAGA CTTTAAAATCTTTTNTTCAAAAtaataatacaaaaaaatacacttgaata taaaatttgtacaaagatttttcaattttcaaagagattttaaaattttt ttattatgcAAACTTGTTTTTTGGCACCTTTTCCTGAGGAAAACATTTAA TCAATTTTATGATTTCACACTAGCTATTAAATTTTTATGTATCAAGCGAA TTAAGAAGCTACacttttttaagggaaattttatacaaaatttttattga agaTTATATGGACCAtgagaaattttgaagaaatttgtaTAGGTtagttt aaaattttaaagtcaatttaattttatttggattttctttgaggttattt tttcaaaattttaaagaaaaatatttgacaaaaaataataataaatacaT TGAGGAAGTTTTAACTTGAACggcaaaatttcaatatttaatgaaccaaa ttttcaaacaaccgccaaaaaatcaaaaaatcattatCTTTTCTTTGCCC GCTGAAAAGGTTGTACTTGCGGTAATTTAACTTTTGTAAGTTCAACTTTT ATGNtcaaaatcattttcttttctttgccCGAAAAGCTTGTGCTTGCGGT GATTTCATTTTTGTAACTTCAATTTTTATGTGTGGATAGTATTGCTCCTG GAGAAGCACACGTTTTGCAATTTAGGAggttttgattggttgattgccTG ATAATTACATTTAACTTTTGGTTTGATGGTCCTTCATGCTTACCCCTGCT TCACTAACTTAGGGAATCTTTTGAGCCAATATTCTCGTGCGTTTAATAAT GGAAATATCTGTGTTTTGGgtattttcatgatatttttcCAACAAGGAGG TCTTTAGGACctttttttccagtgggtggGTTTGAAAATAAGGCATAAAC TTTTGTTTTGCTATATGATATTTTTTCAACCTTTCAGTGTATCAAATGAT TTTCGATTTATTGCATGAATAATAAGAGTGTCTTATCATCAGGGTTATAT TTGGAATTAAAACGCACCCACTGTCTTTGTACCGGGTACATCTAAAGGGT GGGAATGTAATACAGtcatacacgtcttttttataagagcatccaaaatt tttttgccttcggatgttcttaactttctgaGATTTGAGCCCCTGAAGat gttctcaaaattttcttatctTCACTAtcaattttaagtatttttgtgca attccTTAAGAAATTGGATAATTTAGTGcccatgaagccttaaaatattc ttagcttgttcttaatattttggctattaAAACATTATGTGCTTATAtag ttttgttcttattttgttaaaGCAATGCTTTTATCcatcttatatagttt gttcttataaataaacgtgTATGGCATCAATGTAACATAACCActcattt caaaatatattccCCAAAATTAATGAGAAGGTGCGAGTGAAGCTATTTTT GGAATTAACACTCGCCTACCCAACAGCAATGATTCACTGCCCCACAACAT CCAAAGTTCATTTATTTCTATCATGTACCGTAAGTTTGTGTAATGTCGAC ATACCTTGTCCTATTCTGTCATAACAACTATCTGGTCTTTTAAATGGTTA TAAATAAAACCTCTTGAGtaagctgtttaaaaaaatctctcaaactactt tgcagaccagatagttgctatggcGGGATTAGACATGGTATGTCGGTATT ACACGAAGTTACGGTATAAATACTGGTATAAATTATTGGTGTAGTACTTT AGAAGATCTTGTGTCACGAAGTTCGTTGTATTCTATTAAGTCCAGCATAA TACTTGTGCTAGAGACaaattggatttcatttttgttgCGGATTTTTGCT TTAACAAAAGTATCCTATCGGATGGACCATCGAGTTCAGTAAAATTGACT CTGAAATAAGCTCGATATTTTAACACTTGGCCGAGACAATACGGTAGGAT TTACTGGTACCTTTAAATCatgaaattttattaattttgtcGATTCTTTA TAGCTTCACCATAAGGAATTCACCCTTATTGTAAATAAAATTAATCAGTT CAAGTCTAATGGCGCTAAAAGTGAGACTCAGGAAGGAGGAATTTTACACA GAGAATATGAAATTAGCTTTAGCACAACATTAAATGAGAAATACAAGACT TTTTATAACGTGTTTTGTAAGAATGTCCAAAATCTTTTAagtttttggat gttctaatGTTCTTTGAGCTTTGagcttaaaaaagttcttattttcacca ttttctgagtatttttgtgcgatttcttaagaaattgggaaTTTTTGAGT GGAAAAGTCTTATAAAAGTTATTAacttatttcaatattttgggcttatg ttcttatgaaaaaaatgtgaAGAACGTCGGTTTAGGAAATACAGACGTTT ATAAGGAAAagatttcattaatttttagccataaattaaattgatttctA ATCCCATtagaaatgatatttttttctgatttttttccaattttaatata attttgaggattaaaaaaataggaaaattaaGGCTTAAGCGTGAAAAGTG TTAATTAATTTTCAAACCtgatttgaaataaatttgaaattgacGTGTGG CTTTTTGAGACAGAATTTTAAATAGGAGCTATGGTAGATTTCCTCAATGT TAATTTGGTTAATTAGAAAGTTATCCGCTAATGGACCCCGTACGGCAGAC TAGGGGGCCTAGACCCGCCGCCTACTTTTTGGTTCAGAAAAGCTATTTAT TTTCATCTATCTTTGctataaattgctttttgaatgcacccccttctcac agacccactggaaacccTTCCCACCGGAagaattggtcaaaatatcgcCC CAAGTTGAAACTATActataatttttgtccccgctgaaaataatcagata agcaaatccccaCTGCAAAATGTTGTGCTATTCTTTCAAccccccactga attttctggctagaaaacaatggaattaaaatcctcagccataaaaaaac ataagaatATCAATCATCATCGAGTTTTGGCCCGTTgttttcaccccccc ccccctggctgaaaaaatccctcCCACCGGGTCTAAGAAGGGGGTGCTTG AATCCCCCCTAAAATTCAATGTAGCAAATGTACATATTATATTTTGATAC TGTATTTCAGAGGTTGACTGTTTTACGCttatgagaaaaaatttatgata CCTCATTGATTTAAATGAACTTCTAAACAGGTTGTGGACAAGTTGAAGAC AGCACATTTTAAGACATCTCGTCTAAACTTGTCTTCAAAACTATTTTAAA GAGGTCAAGCCTTTGACTTGTTTTAATGTATCATATAAGTTAAGCTGGTA TATCAAGTCAGtatttaagaaattttataGCTTTGCCTATTTTCTAAATT ACCGATGCCCAATGTTTACGATGTTGTTACAATGtctcttttttatataa gaacattacgcgttcaaggtaaaaaaaattgagaacattCTTAAAGCAAG ATTAAAGACTTTGCAGACTTTAAACTGGGATTTCTTATGAAGTTAAATCA AATCATTCTATTCTAtagaaatttaagaacattttaaggctcaaaacccc cgggggggggggNtaaataaattttgaaattcttattaattaattcaaaa atcaaataatcTATTCGTTTTAATACAGAATTTGATAATTCTTCAATATG GATATTTCCTCACTGCTACGTTTATAGGGCTAGTCAGCTATCAACAATCA TGAAGAAACAACTTTTAAGAGATTTAAAGGTGCTAAGCCTTGTGAGATTA GGACCTCATCTAGCCACGTTCGAGGGTGTCGTAATggttatcaaaagaaa aaatataaggCGGACAATTTTTGAACAAGAGAGAGTTTCGATTGAGAAGA ATCTTTGAATGcgtttttaaaagaagtttaagAACGTTTTGGTAACGGTT TGGATCGTTTTTAAGAACGGAATGATTTGGCTTTAAAAGTGACTTTATAG GTTTTGCGTTGGGTCTACATTATGCTTTTGAGTATTTTAAGGAcgaacca tggtttggcccgaggaggAGGTGGGGTTTTGAAATTTACATAAGTTCAAG ACAACTGCAAAATGAGATCTTATTATGAACAATCAGTATTTCGTCAGAAA ATTTATTAAAACCATTTCTCAGTTTTTACGATTCTTTATTTTTACgccat gttcttatataatttgttcttacaTTAAATGTTCCACTCATATTCATTGG CGAACTTCATGTGTTCTTTACCCCCAGGGGTATTCTCATAGTATAATGGC AGTCAGCCAACCTTAACTGTTTTGAAACTAAAAACTGTGATCTCGTGTAC ACAGATCTTAATGAAAACCATCTTAATGAAATAATTcaatttagattttt gtaaaCTTTTCCTCCTGTGGTAATTGATTATGGTCGTGTCTGATGGCCGT ACTGTATCGCTATTACAcgctattttataagaacacgaggctaaattttg accaaagcCGTAGTAAGAGCAAATTAGAAACAATTTCAACCTCAGATTAA AATATGACTGACTGGCTTCTTTATTATTATGTCTGTCAATTGTTTTAAAC TCAGCAAGCTCAAAAAGAATATCTTGAGAACATTTCCAcctgaaattaag aacatccaaggCTCAGCGTAAGTGCTTGCCTTGAGATTAATTCGTCTAAT TAACTGAGTTTTGAAGTTAGTTTGAAGTAAAAGTGTTCAATTTTTAGTGC TGAGACTTAAATGAGAAAAAATGAAACACGAAATCTCCATGAAACTCGCA GAAAAGAAAGACCCACGTTTCGAAAAGGTCAATCACGACTTCTCCTCCCC CACGATTTGTTAGATACCCACCCACTGAGGTGCCAAAAATTAAATAATGG TTTGAGAGACTCCTTGGCTGCCattttctcaagaaaaacttaaaGATTCC TCTTGTAGAACCTACTGCGACTTTCTCTATCGAGTTTGATACTGACTGAC CTTTTAATGAAAAGTTATTTCTTAAAAAGAATTATAGACCTAGACCTACC AAAAGAATTGGTAAAAAGTCTTGGATATCCCCTACAAGGCCAGTGGCGGC CAACTGCTGAGTGGTTTACAgacttcttttcatttttcaatgaaCAGTGA ATTTTTtctgaagaaaacaaaaaatatgctGCACGAGGTGGATTTCCTGC TGATTCTTTTTAGAGGGAAGAGTCTGGGTCTCACTCACCTTAATATAGCA TTGTGAATGCAAAGGTTTATTTTAAAAGCACGTGTGAACACTAATTGAAT TTCAAGGGGTTTTTTTAGTGTATAATGTTTACACTCTAGATTTCACCAAG AGAGCTTTTTCAGAGTTTCATGATATTTTTACTGAAAGTTAGACAACTTC GAAATCAAGGTAGGATAATCATCTCATTCACCCTTGGAGAAGGtaagaag attttttcgaaaatgtttctCTATGGGTCACTTTTCCAATAAAATTTGGA CTCCACAAGGATCGGTTTTGGAGGTCTCCCGTTCGCACAACCCGTCATGC CAACTCTAGTGAGTCATAATATGGTATCGAAATTTCACTGATAagtgttt gattttttgttcaTAACTacgatttcaattttaaaatacaaactTCATAA ATATATGGCGCCAAATGAACGACCTCCAACCAAGACGTGCACAATCGTAG GATAACATCAGAATTCGGTTGATTTTGTTAGTAAATTTGTGTGCTATAGT TTGTTACAAAAACGTAAAGAATTTCGCCTTATCATGTTTTTACCATCAAA TTATAAACCTTAACTATACGCCCATTTCCGCCCCATGTTAATTGCATTAG AACAAAGACACGCGCCATGGGGTGGCAGGAATGTTATAAGAAAAATTCTT AAGGTTTGAGAAAGAGTCTGTTAGAGCCCAAAATGCTGTGCTTTCTTTCT TATATGTATCAAACTgcaattctcaaaattttgctcCAAGAGCATTTTTC ATAATTTGTATTTGCATTTTTATCCTTGGACTATTGAATTGCTCATAATA AGAACATTGCTCAAAACTGATTCTCGCCATCGTGTTCTTATGAAATAGGG TGTAAAGCCTGCCCAACAAAAAAGGTCAACTTCAGAGGTCACTATGAAAT ATTctaatttttcctatttttgtcattttttatgtcaTTTCTTTTTGTTA GTTAACTTTTATTCTTTCCTGTTTGTAAGAGTGTTACAATAGCGTGGCTG TCGTTGAAAAATTCATTCATAGTTTCAAATGTTAGGTTATATTGTTACTG TATTACTAGAAAGCTTTGGAGGattatatataatatttatAGTACAGTTT GACTCTCTCTAACTCGATCTTCAAGGCAGAGACCAAGTTTTCGAataaaa gaaagattcgaaGTACGGAAAGTGTTTTTATAAGACTTTCCAGCTGAAAG CTCAGTGTCCCAATgcttttagttcgaattacagagggattcaaataata gaggttcgaattagagagagttgactgtattgTCTGGTAGTGCGGTTTTG CTCTGTGAGGGCATGATTGATTTTGATAGATCTGATTTTACAAGATGTAT GACCCAGAATCAAAggttttcacttttttattttgtttcactttcgaaat tttttaattttgaaattgcgAAATGTCTCAATCAAAAATGCCGGCAAACG GAACGAATAGCGTGCTTAACAAATTGTTTGCTATCAGAAAACAACTTTTT AGCTGCGTGACCTTTATGCCAGAGCAGCAAATTTGTTTGTAGTTAATTTT ATACGCATGTACTTTTTGATGCACATTCGAATCTTATACATATTTGATTT GAATTCATTTTCACATTTTACGAAATACGTCTTAGGAGTGTGGAGAATGG GGTCAAGTTTGGTGGAAATTAGCCTGTTAAACTGCTAAGAATTTGGGTAG ATAATTTTAGGTATTATTTTTTACAATGATATTATAATTTTTGCACTACA TTGTTTGAAATAGAAAATGGTCCCCTGAAAATGCTTAATACCTAAacgtt tttaataagaacatcttaaatTATCTAAGCCTTCGAACtctgatgttctt aattttttaagctctaagcctaaaaatgatcttaaaatatttttaatttc atcatttgattatttttgtgcTATGTATTCCTATGAAATTGGGTGCTTTA aggtccataaagccttaaaatgtttataGCCTGTTTTTAATATTATTTTG CCTATCGAAgttgttatattttttgttcttatataaaagaaCGTTTATCA ACCcctttttttcacaaaaagctGTTACCAAGCTCGAAtgaaatcaaata tctgatTCAAATATCTAATCTGATAGATTTGACGTTAATCGACCACGCCA CTCGGGTCCAATCTTCTTGGAAACactgttttttgtttgattttagtTGT CTTTGTATTCAaatagtgcttataaaaaaccaAAAGGTCAAAAGGGCGGC GATATCGTTCCAGTCATTTCCCACCCCATTCCTTTAATATTGCTCCGCCC CAATATCCACCCCTTAAGATAATCCTACTAAACACCTATACATGTTAACA AGATTTCAAAGTAAGTATTTTACTGACTGTCTCTCTTTATTCGATTTGTC TGCGATTTTGTTGTCACTTTTTATAGTCAATGTACGTATTTTTGTTAAGA ACATGATAATGGAGGGAAAAATGCTTTGCGAGTCGTCTAACTTGTAAAAT GTCATGGAACTACGGAAATCGCTAATCTTTATACAggcagtctgttcctc taaaggatcctgcattgtaacacgcatgcgtggtggtacagtcactttcg gtcggggttgtggacggcgaaatatgtcgttttttatgaaatttgtcgtt ctttttgtctatttttagtaatgcaggattcNtgtggacggcgaaatatg tcgttttttatgaaatttgtcgttctttttgtgtatttttagtaatgcag gattctttagataaaccccctcagGAGATAATTACTCCAAaagcattttt gttttgtttaggAAAGTGAAGAACGAAGAACGATTTTTTCACAAAGAAGC ATTCTAGAACTATTAATGTTTCCTTTGAAGACACGAGGCGAATAAAAATT TCTTGTCGATATAAGAACAATCTTTATGACCTCTGATTTCCTGACAAAAG TTGATTCTAATTGGCTTAAAGCGATTCGTAATGACTCGAAAATAGACTGT CTCTATTTCTCTTTATTGTCCGTAAATTTTTAAtccatttttttatttgt tgcGTTATGTAGAAACTTTTTCATTAATCTTTAATCTGTTACTATTTCAT TataactacaatcatggtcagaaTATGTTGGTATTTCTGGGTATTTTAGC GTTTTGCTGAATTTAAAGTCGGGTGAGGCTTTTTAAGGTTTTCTACTTCA TCTAATcggatatttcgatttgggaggggtatataatggcttctaggcta tattctcagccttagtTGGAGCATTCATAAGCTTTTAGATCCTCACATCC TATAAACTCTTAAGTCATAAAagtcatgttaaaactctactttccaacac TAAGCGTATTATcattacccggggggggggggcccNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaaaaaaa aacgtgtagtgcactgtaagggacggaaattacaaaactgcactgaactg cactgtaagggtagaaaattgtgataaaaggccaattttttggtaaaatt ggcacaaaattggtcaattttggaggaaaaattccaatttttttgaaaaa agtgcactgtaagggtatgatttttcatggaaattcactgcactgtaagg gtccgattttaaaagccaaattttgggccgaacgtatggtcattttcaga tcgagtgcccccccgggtATCATTATTCCTTATTTTTCGTTTGGTCGCCG TTTGTGTTTGTTTTGGACCGGCTAAGGTAGCCGTTGGTTGAATAGTCGCT TTTTTATAACAATGGTGTTTCCCATTTCGtcatggatatttttaactGAT ACACAcgtaaagatttttttctcaaaaagtttgCCGAAAAATGTCGCGCT ACTCTTCCACTTATTTCGAAATATTATGATTTTCAAATAAGTTTACTTTT TTGTCGTACGTCgcaagaaaagaaaatatttttcctctcctgaattttta ttttatcaataCAGCATATCTCGTGGGAAAAGAAGAAACTCTTCCGAAAA CTATTCATGTAGTTTCAAAACACCCATGAAGTTATAAACTTATACATTAA TTAACATAATTCTCCccccttttatttacaaaattctacaatcttttaaa aacttggcgaaaatttctttttgtactCTCGTGAGAACGTAGATTTTTTG TCCTCTGtccttttgaataaaaattttcaaattttgacatagATTTACGA ATTATACTTAACAATTTTGGAGGATTGTGAATTCGCACTATTCTCCAAGA GAACAAAAGTCTCTCGAAACTTTGGCAAGATGTCAATTTTGGGATCGATT CGTCAGAAGGAAGTAATATTGTAAAGATATATAGATCATATGTTTCTGTT GAAAGTTCTGTCATAAGCTCACATAGCATGTTATGTCTGGAACATTTTGG AAAGTTGGGTAAgctagtacacgttttttaataattgctttataagaaca agtaaTAATTCACATAAAAATAACCCAAACGATCTGACAATCCTTTTAAC AtcatgttcttaaaatgttcttatttcctccattttgtgaccattttctT AAAGAATCGGATTCCGAGTCagcaaagccttatgttcttaacttgttctt gatattttggccatcgaagacttatgttcttatgtttattcttataaaaa aggtgtgTACATCATATTAAGTTGATGCTAAGCCTTAGATTTTCTACCTT TTTAGAGCGGTCTATAACGTCGGCATACGTTTATATGGCGATGAAAAAGT CTTTGGTTACTTTCTTAATGATGCGCCAAAACGTTTTTAATCCCTTAAAG GTACCGTTGGCTGTCTAGAATTTGTCTTTGTAGTTCCTTCAAAGTTTTAA CAATCTTTGATGATACAATGATAACTTATTCATTGATTTTGTGATCATTA TTAGTGCATTCTTTCTTAGCTTTGAGTCGCCCTCGAATAAGCCGATAAAT GCCCTCCTTCCAACGAAATTAATTTTGGTAGTATAATCCACAATATTTTC AAGCAATGCAAattgctacacgtttttttataagaacatccaaaaatttt gaagcctttggatgttcttaactttttgagttttaagcctaaaaatgttt ttaacatgttccaatgttcttatatagcgtgttcttataaaaaaacgtgt attcagaGACcacaccactttttgattttattgatcgGCGTGAAACAAAA GAGCTAGGTATTTAAAAGTAGAATTCATCCGTAGACTAAACCATCTGTTT ATTTTCCCCTGTAATTGTGCCATTGAAATTATAAAGGAAATCGCGTTGAA TTAGGAGTACAGTTAAAGGACTACAGTGagctcatgtaattcgaattctc aagggaccgagaattttgttcgaattacatgagttttcgaactagatgag ttttcgtatttttgaccaggtttacttttgaacaattttttgtattttcg agttaaaataatgaaatactaAAATGATTCGAAAAGGGTCATCTTTTTGA GAGTCTCCATCGCGTCGTCAATCTCATTTTGAGATGGGGTGGAATTGGAA TTGGTTCGATTGACAAAATGTCAAGTTTGTCAgcttcaaaaactcaaaaa attcgaaaattcgaattacgtgattaaaatttcttgatgaGACCAGAAAA TCTGTTCGATTTACatgatttttcgaattacatgagttcaaaTTATAGGA GTTTTCTTATAGGGTTTGCAAGTTAAATTCTGAGGGGACCACAGAATCTT CTCGAATTAAGTGAGTTTTCGAATTAAAggagttcgaattacatgagttc agCTGTAGTTTCATTCGAATTAgaagagaaagattcgaattatagagtgt aatTTAAGTCACCTACCAGCTGACGGAGCAAActttttagttcgaattac agaaagattcgaattacagagagtaatttaagtCACCTACCAGCTGACGG AGCAAACTTTCTAGTTctaattacagaaagattcgaattacagagtgtAA TTTAAGTCACCTGCCAGCTGACGGAGCAAActttttagttcgaattacag aaagattcgaattacggaGAGTAATTTAAGCCGCACTTACCAGCGAATTA CAGAATGATTTGaataatagagattcgaattagagagagctgaCTGTATT CATCAATCCTcataaactttttttcacgTTACGTTTTGATGATGATgact aaataatttttttgagtgACAAGAGTTGACAGGTCTGACATTTCGCGCTC TTCTCGTTTTTTAACGCTTTTACTTTACATCTGAAAAGATCAAAGCTTAA AAAGCCGCAATTTTTCATTCGTTATTTCAATCAAATCTATCGGACAATAC TAAGAAATGATATATGAAATAACGCGAATATTTTATTCTCGTAAATTTCA GTCATTTTGTGACTTTATTTGTTGGGGTAGCTGTTAACTGAAATTTGAac atcaaattaatatttttataaggcGCATACAGTAATCGAATTTTATATGA TAATATCGGGTTTGGACGGGTTTAGACTCGAGCTTTTTCAGATTCCATAT CTAGGGTTAACGGCAGATACAGTTAACTTCTCGCTATTTCGAGCTCTTAT TTGTTCAAATAACcagagagattcaaattatGTTTAACGGGGAAAaggaa tgcggctattataatttgattcgaatagtagagagTATTTTAAGAGGNAA aggaatgcggctattataatttgattcgaatagtagagagTATTTTAGGA GGGTTTCTCCCTGATTTGAACAGAGAGTAAGTTCGAaatatttgaataat agaagtttaAATAAGCAAGATTCGACtgtatcttataaaaaacgctTTTT ATGTATAGAACTTTTTTCGGCAGTTGaattagtctagcaagctagacgac taatttatacatagtagaaataaagcaaaaagtaatgaatggaacaattt tagtcgtctagaaacctttgtgcactaactccaaacaaaagaaaagtgtc aatatttgcgattataattttttactgctcaaaataatttcttgagaaaa aattatgtgtggatttgtgtattgaaagtttttcatttgagttgatttcg ttttgagagtttgttgttgcttgataaattgttttctcgctacgcaagtt tctgcgNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNctacgcaagtttctgcgtagctagcccctgtatctataa ggctggaacaccggattcttccagtcgtttatacaaactaaatcccgtac tattattattagtattacatgcattataaacgactccagtctacagtTGA ATCGAAAAAATACGCTTcacggaaaatatttttttcaattaaaaccAAAC AATTGACATGACACAAAGTGAGGAGACGAGAGAATGGTCTTGATCGTTCA AATTTGCCGGTGCCGAACTGTGATCTCCTTATAAAGATGGTGTGTTTTTG CTTCAGGCGTGGACGGAGTAGCTCTATTAATTTGTGACGATGCAAAGCAG TCATCTGAGTTAATTCAACCCATTTTAAAGCCATTCCTCTTATGCCACTG CCAAATTTTCGGCTTACACTtatcatggaggtaataaaaatatagatgga gataccactcctactattctattgtattgtatcgttgatagcaaactgtt gctttgttgctttgggaaaaagccattaattttTGCTTTCGCTCATGGGA AAACTTGAgtcgaagagaatttgaataaaatcacgctacatttttaattt gttcattgtgtgatgacagttttgtttataaaacataagaaaaccttgca agaataagNNCTTAAAATGTTCGCTGCTCAGGGAATCCTCggcaattttt gtcaatttttacatatttactaatgccaatctttcaactatattctatca aaattttgaggcagctgctattttagatctaaagatatttatagcaaaga accttccacaaacaacaaagtattcgcaaaattttaaataaagaaattat tactgaaaaaaattcgcattttacctaaaaatacgaggtttcgttggaca gaataactttactttagttcttataatctatatcttgactgatttttgct atcaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtattttttattacctcta tgCACTTATTAAGGATCCGCCACTAATTTTAAACTTGTagacaataaaaa tatttaggtTTCGATATTACTggcaaaattataaaaagtaaTAATCCGGC TTTCGCGCCCTTTCAACCGCTAATCCGTTTTTAATTGTTGCTACTTTTGA AACACATAAAGTGGGTTCTGCTTTATCACTTTATTATGACTTGTCTGGCT GGCGCCTGATAAAGCATTAAACGCCATAACATTTAAAAAGCAAATGAACT TCGCATATTTTGGTACTTTTATCGagtagaaaaaatcttaaaatgtgaca tcaatttttttcacactttgaattaaatttgaatttaatcTTCTATAAGT CCATCAAAGACtttatcatcaattttttttctttaaccaAATTTCTTGTA GGCTTCATTTCTCGTCAATTTtagatatattttttctttcaattacTATT GATGAATTCCAAAATCCAgtttatttgaaagtttttgataacGCGATTAC TTTAAAATCAGAAATATAAAATGAACATGTGATNTTTTTGAAGGTTTTTC ATAACGCGATTACTTTAAATCAGAAATATAAAAGGAAAATGCGAAGGAGA CACAGAattgaccttttaaagaaagtcGCCTGGTGAAATATGATCTTCTC CACAGGGAGTTATAACTTGACATGGGGTATTGTTTATATAAGGGGGTACT ACTGTATAGATAGGCAATGCAAGATACATCTCTTTCCGTAGTTTTGAAGT AGTCTCTCTTCTGACGTTTTGAGAGACCGGTTGTTTTGATAAATCGAAAG TTTTCCTTCCATAACTAATATCCTGTATTGGTAGTCTGTGATTGGTTGCA TTTGATAAATACTCGAATCCTATTGGTCGAATGATGCGAACATTCGATTT TCATTGGTCAATTTGATTTGGAAAGTCATTTGATTGGATGAACTCGATTG CACTAATAATTTTGTCAGTATTTGTTTCTTTGTTGACCCGGAAATTTTCG ACTGAGATTTTTTtcgattgaaaaaataatgcaAAGACGTTTAGTATTTT ATCCATAtgctggtggtggtggtggagcCGCCGCTAATGTCGAAAATTAT CGGTGGTTCAAACAGCAGCAGGTATTATTGGATTCAATTTTCNCggcggt ggtggtggtggagCCGCCGCTAATGTCGAAAATTATCGGTGGTTCAAACA GCAGCAGCAGGTATTATTGGATTCAATTTTCATTGGGAATTTCAAATTAT AATTTATTCTGGTTTATCTAAATTATCATTTTCGTTTTTGGATGGCTTCT CGCTTCGTGAGACAGGGGTGGTTTAAGCTTACATTAGGGAATGACTTTAT GAAACTGAATAATTTGGGGGCGTACGGGACTTCgtaataccgatataccg atcacTTTTTAGCTCAATTACCGATATTTTGTACCAACATCCATATGGAG ATTTTCTAGACTCCCTTTCCCTTGTATCTCTTACAAATTTCAATGATGTA TCAATATCCCCCAAATAATGGTAGTGAAAAAAATCTTCATGCTTCAGAAT CGCCATAAAACTTTCCGGAATAACTGAATCATCATGACCTCTGCGTGGAT GCTTGTTACGATCTCAGCATGTGCGCTAGACAATTTTATTGTTGTCTTTC CAATTCATGATGGTGCCGAAGTACTGTTTTTTTACGAGAACATCAaatga atgttcttaacttttggagttttaagtctaaagatGTTCATAAAATGTTg taattttcgccatttttatgagtatttttgtccatttttctcagaaatcg ggtgttttagagcctgcaaagcctttaaatgttcttagcttgtgttctta gtattttattggccatcgaagccttatattcttataaagtttgttcttat aaaaacacgtTTACAGTAATGAGTATTAAACGCTCCTAGTGGAAATTTGA ACAAAGAACCCATTTTCATGTTCGAATTATTTGTTATTAGTTTGATGTCA tcgtttgttttttcttaaatagGGAGTTCAATATTTATCAAATAAAGTCT GACCGACATCTTTCTACATGTCAGACCATTGTCAAACGTCAAAGTTAATA AAAATTGACGAATTAAAATGTCGTTTTACGAGGTGCCAAATATTTttgct tggaaattttgaattatgtATTGGATTTTTTAACACGGAGGGGCTAAATT TTTGAATGATGACTATATTTTCACGACTGTGTAAGactttgaaacttcaa aatacTAGGTTAAAAGGCTTTAAAATGTTAAGTTTGTAAAAGGAAATATC TCAAGTCCTTTCGACAGAacgaaatttttaaactttaatttATGATAGGG TATATCCTGTTCGAGTGTTTTGATTCCTGTCTAAGGGTCCTCCTTACTTC CTTGATTCAGTTATTTTACCCTTACTTTGCCATAATCTCTGTCAACTTTG TACcattttaaaaaggttttgtttttgaacaatagtgatatcgtttgctt actcatcacttttaattcacaaggtttttcacattggattgacacggatg tggagcaagattggtcagaaaaaggaaaagaaaaacatttgttttgctta tatcagcacaatatataacaataggcaaacactgtcctggtatgaaatat gtgtctcatatgaaacggaaacaattatgtataaaaataaaacccggggg ggggggggNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNcccggggggggggcagctgggcaaaaggaccgacgggtat ctGCGGGTCCTAAGgataccttttccaatatgtttaaaatgcactgtaaa ggtcggaaaaactagagatgcactgtaagggtagaaatcttgaccaaaaa tgctagaattttgaccattttttgcacgaaagggattgaaaatttggggg aaaatgcactctaagagtattattttcactgatttttgctgcactgtaag ggtgtaattttaaaagccaatttttggcccgcacataccgtcaggtCCGC AAACCCATATTATTCAGTCGATTAGAATTAGGGGCTTGCTCATCAAATGT GTGATACAGGGGTGGTCGTTATGATTCATCAATCATTCGATATTTGTTAA CTAATAATTATTATTGTTAGCAATATGAAAGCAAAAGGGAGGGgatctta aaacaaaagaattactATCTCTAATTAAATCAAAAAGGATGACATCATTA CATGTAATAATAGTGTATcatattttcaatgtttgtactgtcttattatt ttctttcatatctgataaaaaaatcagaaaaaaagttatggggATAGTTG AATTTGGAAGTTTTCGTTGCTTATTCAGGGCGTAGTGACAAGTAAGTAAG CTGCTTTCTTGTTTTTTATGGATCAGTTTTGAAATTCATCTGGACTAACG CTAAGTATATTGCTTTACAGGGCAagcacacattttttataagtgTTCTT AAGTTTGAAGCCATTTAATCTACATTTGTTCTCATTTTTAGTGTTTTCTC GGTAATTTAGTAAAATGTCCTAAAAAAATTGCTtatgtttttgagttttt taacGTCTATCCAAGTTTTGTAACGTTTTTATCTTCTTAGTCTCTGAAGA AGCAATTTCTTGCCTATCCTTTCTCCTTCGAAAAGAAACGTTTTCTACTA AATGAAGTGAAGCTGTCAAGGGAAAATTTACTTTATTCAAAGATTTACAG GGTTCTTCTTTTTgatcaaatatttttatcctGGTCCATTGTCACGTGAC AAATATTTTCAAGTATAaacaagaaaattttcaaaatataaaaaatcaaa atattataaatttcTAAAGTTTTCTTCCTTAATATGtaactatttttttg tttccttttaaGCAAGTTTTTATAAACACTAACCACACCCTATTTCAATG CATTCTCAAGTGGAGGGGGACGTAAGATCANTAAgcaagtttttataaaa actaaccACACCTTATTTCAATGCATTCTCAAGTGGAGGGGGACGTAAGA TCAAAGTTTTCAGAACTTCCTTTGCTACCCTATAGGATTACTTGTATGAA GGACAAAAACTTAGTAAAATGTAAATGCAAGCTGTTTAGCCGTTAGAGAG AAGagaagaacatttttcttataaaaaaagaagcacCAGTCATAAAGTTT TGTTCACACTCTCGTGTTACACACTCTACGCGCGATTCACAACGAAATCA AAAGCTCGCGGCCGCCACTCGAAAAAGAGAAATCTCCTTTTTCCCTTGTG GAAAGtctcaaaagtttttctttcttcCTTTGAGGGAAAAAATCTCATAC TTTAGTGTCATATTTGGATTAGAAATTAATTTTCCATGTCCAACAGTATG TTGCCACTTTTCTTTTAGTCTTTTAGTCATGCgtggtggtacagtcactt tcggtcggggttgtggacggcgaaatatgtcgttttttatgaaatttgtc gttctttttgtgtatttttagtaatgcaggattctttagataaaccccct cagGAGATAATTACNTAAAACAACACAACACGCCACGcagatttttcaac tttttttcgtGTCGCTCTAgaatttttgataaatcttATGAATAAGCTCC TGAAATGAATTGGAATGAGTTCTGTATCGTGTGTCTTCAATTATCCTACT TAAATGttaatcattattttttaattatatacTTTTTGCTATCTTTAATT AGTCTTTTAAGTGTAATTCTTATATTCGAAAAAATTGAGGAAATAGTTGA TCTTTAGTCGCTCACGCTGCCatggtttgaaatatttgtttttgttttgt agaAGATTTTTCGGTAGAATTTGTGGTATACTGATTTTAGAGGATGttat ttttgctgaattttagAGAATACCGATCGATTCACACAACGCTGTTTCAA CGTTTACTGTAACTAaaattcacaacgtccatatatatgatattagatga acgttgaaacaacgttatttGCCAGCTGAGAAATTTTGACGGAGAATGTT GAAAAATCACAAATAAATTTGATCGCTCTCCGATTCCGTTAGCattcttt ctggttcttttaACAACCTCCCCCCCCCTTAATAGTTTTTCCTGTTTAGA TTTTAGGCCCAAACTGCAAAATTTAGTCAAATAGGAATCTTACAGCCTTT GAAGATTACAAAATATTGCATTATCTTTGACGAGGACAAAAATTTCATAC ATTTCATCAAtcgaaataatttttctatCAATTAACCATTTTAGGACGGT TTCAACCAAAAGTAACAGAAAACAAACATAAAAACACAAATTAagagtaa aaaaagaaaaaaaatcaaactgtgATAAAAGCCGGTAAAGTCGCCGGCGT CTAGGCTAAGGATAGATATTTCAATGCATTTATAGAAACTTGAACTATAC CCTAATCCCTAGGTTATTGTTGATTTGGTCCAATGAATTGGTTGTTTGGA CTATAGGGACCCAATTTACCCCAATTTTTCCTTGCCGCCGTCTGTTAAGc ttgtttgtttatgttttgacTTGGGCGCTATTTCGAAGGACAAGTTGTTT AAAAAAACCATTCGCTTCCGCGTTTGGCTTGTGTAGAGACTTATAACTTA TAACGCACGGTTGATCTTTCAATGAAGATGCCGGGCCGCTGGTAAAGCTA TGTGTATAAAAGGCTGAATAGTTGACAAGAATAACGTACTTTTTATTCGT TGAAATGTTAGAGACCTGTTTCTGGGGATATAGCATTTTATGGCTCGAAT AACGATTAGTTGTTTTGGTGGTTGATGTTTTGAGATTTACCGTATCTGAT TCTTGGCGAAATATTGGTacttatcggcgatccaaaaaatatcagcaatc tgattggttaaaaagagtacaatatatcttgtattttacatgtaaaaata taaattattatccatatagcggtcattaagtaagccattaaagattcgaa cggcgggcggtattgaaaggttctatgactcaaatagtcatacccgcgct gagaaaactaaagcgccaggcttcagagggctgaaatattaTTAACCACC CTGGTTATAGGGCGATAAcctcatttgcggcccgctcattgaactttatt gaagtcgttgcattgaagcggtgagactaaaccgacgtcagaaaaaaaca ctttttgttcatttgcggcccgctcgcaaggatactcaaaacttgttgaa gtcattgcattgaagcgaaaagacatggctgacgctagaaaaaaacgttg tttgaatgtccgatatggataataatagtaatagcgttaagctttcgttc gttgttgtcattaattctgcccttgcagtttgNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNctccgcttcgcg tcgggcccaaatgacactctcgggctaataatcaaactgcgcgggcagaa aataacaacagcgacctcaaactgaacgctattgttatattgacgaaaag atgttgttgcattgtagcggtagaagcaatctaacgtcactttgctacaa aagtgtcctccaacacaaaaagtgcattttttgggtcaccggtaaaccag ttatcagacattgtccgataactattacatatgtACTATTACAGCGGAGT CTctctaactcgaacctctataactcgattgTCTCCCTAACTAGAACAAG TTTAgtagtcccttcagttaacataAACCTTACTCGatatctcgaaattt ccttaattcgaacaaatttgagCTCCCtgtgtgtgttcgagttatgaaga atgagtacacgttttttttttttttataaggaaccttaactttgctctga acctggagttccttatttttacagagaatttcagtctcaaagttccttat cgagttccttactacataggaaattttgaactttttgNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtaaattagtcccaataag gtacattattttcaAATCCACTTATTCTCAccctgagcagttccttaaca attccttatttctcaaaccattttcagcctcgagttccttataaacatgt tccttataaaaaaaaacaacgtgtagtAAAGTTTATAGTGACCATGATAC ACTTTAAATCCTTTACGGTCTTGGATAGAGTTTAAATCTTCATTGGTTTT CAAAATGATCTCGCATTTTCTGTCGTCAAAAAGTTGACTTAAATTTGACG AGTTGTTGAGTGTTGAAAGAAGAGAATAAACTTCGAAAAAATGTCAACAG TTTGTCAAACTCCTTGAGATATCGTGTCTTTCTAGAGAGAAAAAGTTTCG CTTTAATTTGCATGTTAAGTTGCCAATGGGCAGTCACATCATTTGAACAT TAAACTtgtcaaaaacatcaaaaacccTTTTTGTATTCTTTCGTTTTTGT TCATGAAAAGGAAGTCCAAATGGACAAAATTTGTTGCGATAAATGTTGTG CTAAATGTCAGCAGAAATAAATCATCAGTTCTAAGTATATATCTTCGGCA TAGGCCAACTGCATACTAATTTCGACCTGGGCATCTCGATTTTCTATTAT TGTGAACTGCATACTGTAAATTTAGATTTGTAAATCTGTAAATGTTTCTC CAAACTTTTAgatgattgaaaaatattaacccAACTTGCTCAGAAATTAG CGTGGATGGGAGACTTTGCGATGTGAGGAAGTTCGAAATGATTATGTTCA TAATGCTTTATCTTTTCATttacgttatatggacgttctTACGAACCTTA GatagacgttgaaacaacgttgtatgccagGCAGAATAACTTGATTATTG GACAATTTCCAAATAACAGAgaaaatttattgaataaaccGCCTTTTTCC GTACTATATCTTTTGCGGGCACCCATTTAATTCTTTAGTGCCTGACGTGG TTTAGTGAGGGTAcctattcttttaaaaaagaatttaaattttcaatagg CGGTACTTTAATATAAATGGGAACTCATTTCTTCAGAGTAATTGCTTTTT CATTAGTTAGCGTAGGTCAACAAATTAGCATGATTACAGTAATTAGAAAC TTCTTATTTTTGATTCTAATACGCTAATAAGCAGCCATGTGCCTTGTGTT TTCTATGATTTCTTTATGAAGTTTCAaacttcttttataagaaaatagga acaatttttccaaattattttactttttgctGAAAATGATTCGATGTACG ATGGAACTAAGATTTTAACCTTCTTCCTTCACTTTTTCgattctttattt aaaaaaaatttccttaaaactTCACAATGAATATGTCAACCATGGAAAAT AAcgtaatatttttgttttgatcacgtgaatAAAAAACTAAGTTTGCAAC TGTTTACTAAGACAGATACATGGTAAGCCAAGCTAATCCTTACGtataaa aatgctattttcaaAAGGGTTGCACATCTCTTAATCTAGCTCAATTAGAA CTTGTTTGCAAACCTAGCCGTCATGTTTTTCAGTTAGATTCACATTCAAA TCTCTGTTAAATCTTTCTTAATTCGTTACAAGCTCAGAGAAGCTGGGTAA GGTCTCTAGTTACAATCGTGCAGCTTGTTTTTTTATCAGTGTTTTTTGAT CAACCTGTAGTTAAAGTTTGTCTTGATCAAAGATGGCTTCAATGACGGTA AACttattttttacgattttttaaaTAGTAGTAAGTTAAGAGTTTAGGTT GAGCATCTGTCTACGGCGGCGAGTAAGGTTTTGGGCTCAAACCAAGCCGA GTCATACTAAATATCGCAAAATGGTGCTTAATACCTCTCAGCTTTATAAT CAGCTACTAAAGAGAAGAATCAAGGGTAAGTGAAGAAATCCAGGGATGGA GTgacaccctcccctaccttcgggtagacagctaaaGAAAAGGGGCGTCT TCGAGTCACCCTCGACTGTGGTTGCAAATTTACTTGAACGTTCATAAAAC GTTAATTGATGGGTGCTGTTTGACATTTTGTGCTTGCGAGCAATAACCTT TGCATTCTCTTATTTCTGTCAGTTTTATATGCTCTTTTAAAGAAATATAC TTGAAGATTTAACAGGGGGGTTTCAGCTTCTTCTTTCATCAATGGTATTG CTTTTAAAAAGTAAACTTCCAATTCCATTCCATAACAGTTTGGTAAAAAA CCCGACTTTTTATATACATtctaaagtatttttttgtaataatttctatt ttctaccttttccaataattgtggtttttaaaaaaaattgtgtgacgTCA TGATGACATCACAATAGAGAGATGGGGTgttttatcaaaactttatcaAA GAACAAAAGATGTCGATCCTCTTTGATGTGTTTTGGAGCAAGGGGGTTTT AAGAATGATGAATTTTTCACTACTGTACGTGTGTTTTACTTCAGTGACTG GCTTTTTTATCTTATCGGAAAATTTCGGTGAAGTTTTTTTATGTGTGTAT GAGatatgaaatgtttttttagtTTGGTTTTTTAAGATGTGTGGAAATGT CATTTCAAGAGTTGAGGCTTTTCTTCATAAAACCGTATTTTGGCGTATTT CTTGTTAGCGTTCGTTGGTACACGGTAATGAGTTTTGAAATGTCCGTATA TTTATCTGGTACAAATGTAACAGAGGGTATCTGTTACTAGATAGCTTAAA AGCCCGTGAGGTAGCTTTTCGCATAAAGCTGTCAATCATCTTTGAGGTTG GTTTGAACCCTGCACGTGGACATTACAACTTGAAATGGAAATATGTGCGC AATAAAGCATCATTCACAACCCTGTGTctcagacccgctgggaccccagc cccactggaaaatttggtgaaaatttcgtccccggtggaaaaactCCAAa agcactccaaaaccatccccactggatttttaaccttgaaacaatagaat tcctttccccatttggatttcaataggaatttttatccccactgagggaa aaagttccaccggggctgtgagacaggggcgtGTTTTCAAACCCACAAAT GGGATCAAGTAACTGCACTAGCTTTAATGAATATTTAAGCCATCACTTAA AACCTTCCTTTGGATTTTATCAAAAGGAAACGAGCATTTTTGACATATCG AAACTTTTGGctcgagttaaaaaaacaaGAATCATTAAGTATCTGGGTTG GGTAGAAGGTGGTACTAGACAATTGGTATTTTTGGCATTGCTCTCAACTC TCATCAAACTAaccaaatgaaaataaataagcCTTTGTATTTTTACTGCT AATTTATGAAATTTCCAGTATCGTTGCCAATTCTACCTTGACAAACGAAA GGATATTATATTCTAAGCTTTCTATTTTGGAAAGAGTTTTGTGCGACGGT CTGTTTTTGTGTGTCTCGGGTATGTAGTTGTAAGCAtttcaaaatttcga ttttctCAATGTCATGGATGTTAtcataacgttagatgaatatTGAAAAA ACGTTTTGTACCAACTGAGAAACATTTTGGTGCTCTAAAAATGGATACGG ATATTGGCAATTGATTGAAATTTAGTCATGGGTTTACATTGTTTGTGGCT TGGACGGCGGAATTTATATCAAACTTTTGTGATACAAATTCAAAGGGGAC GTAAAGTCTAAGTATATGCTTCATTTTTGTCGCTTAGACTAACTAAGTCA CTTGGCTCCAATGTTTTACAGAATTATCAAAATGTATTTCCTTTTCAATA CATGTATATAGGTTTAATGTGCCTACGTTtccttttgacaaaatatgatg aattttaagtcaaatttaaacaaaatataGTCTTTACTAATATAAGTTTG TCATATTTGAtggtattttgaaaattttcataagcTCGCATTCTTAATGC CAGATTTTGAGTCATCTGGTATTTATCAAACTTCAGCATAATTTTTTCCA TTATAGCGTATTATAAAGTTTGAGTAAGTTTGACTTGAAATCTAAATTTA GTAACATTTATGAAAATTAGAAACATTTGAGTCATTTGCGCTTCTTGTTA TGTTTTAGGTCCTATAAAATTAgggtaaatatttttgaatatttttaaaa aatattgaaactttgaaaataacaaaaagttacaaactggtttaaaaaaa ttataagtcTATATTAACTAatgtcaaaatgttaaaaatcttttatgtCA TTTCCAGTCCACTTTATAACCTAACACCCTAtatgaacattttttatttc ctgTTTTGATAAGCGAATTATTTCCGCCCGCGCGTTCAAAACATGATAAG AGGTGACATATTTCATGAGAGTACGTCATTTAAGGTGAACAACTGTTTGT TAGAGTGACGCGAGATGAGACTTTACACTGTATCTTCTGTATGTTAccgt tttatattttcttataatgatgatcaagaaatcagtcaTTTAGTTATTAC TAAGAGTTTAGAGAaggtttataatattttttaagctTGGTGTATCATCC TAGTTAAGTCAGTCAAAGTCTTTATGAACAAATTTTAAAGTGTGTGAGGT GTCTTTGTCTTAGAGTATACCTTAAAACGCAGCTTTAATTCTTTACGACT CATATGTACACGCACGTACAAACAGAGTTAGAATAACGTTATCAAGCGCA TGTATTTTGACTCTGGCATAGAGAAATCTTCTGGGTAGCAAAGCGGTATG GCAGTATCAATTTGAAGTTGAAAAACACTTGGATTTGATCATGTAGGGca cctttaaaatttttccatGTTTGAGAGAGACATTAGTGAAAATAGAGTCA CGGGCTGTGATGTAACGTTTTGTAACTATCGCAGCTCATTTATCTATGTA CCCATAAAGTTAGAAGTGTCGTGATATTAGTGTATTGTTTTGTTGTGTCC TTGCCTGCAAACAGACTTGTTGTTTACTGTTTGTCTggcgtttttgtttt tgttaaaaatggaGTCAGTCTCCATTTTCCATGTATCAAGTTTAAAACTA GTCTCTTGTGTTGGCTTGCTCTGTTTATTTAAGTAAACAGTCTTGATACT TTATATATAGTCTGTTTGTTGGCCCTCTTGGATTACTTTTTTGGTTGCCT GGCTTTTTATACGAAGCAGTCGTTTTATACTGAGATAGAATCAGAATTTT GCTATGAAATAAGAATTTATTGGTTATTATAGATACAGCGGAGTCACTTT AACTCgaaactctataactcgaatgtctattctaacttgaacaagttttc ttgCCTCTTCAGTTAAAAATACCCTATTACCCNAAGTCATTTAGTTATTA CTAAGAGTTTAAAGAAggtttataacattttttaagctTGGTGTATCATC CTAGTTAAGTCAGTCAAAGTCTTTATGAACAAATTTTAAAGTGTGTGAGG AGCCTTTGTCTTAAAGTATACCTTAAAACGCAGCTTTAATTCTTTACGAC TTATACGCACACGCACGTACAAAAGAGTTAGAATAACGTTATCAAGTGCA TGTATTTTGACTGTGGCATAGAGAAATCTTCTGGATAGCAAAGCGGTATG GCAGTATTAATCTTTGTGAAGTTTGCTAAAATTCGTACTTGAAAAACTGT TGGATTTGATCATGTAGGTcacctttaaaaaattttcatgtttGAGAGAG ACATTTGTGAAAATAGAGTCACGGGCTGTGATGTAACGTTTTGTAACTAT CACAGCTCATTTATCTATGTACCGATAAAGTTAGAAGTGTCATAGTACTG TACTGTTTTGTTGTGTCCTTGCCTGCAAACAGACTTGTTGTTTACTGTTT GTCTGgcgtttttgttttgttaaaaaTGGAGTCAGTCTCCATATTGCATG CATCAAGTTTAACTAGTCTCTTGTGTTGGCTTGCTCTGTTTATTAAAGTA AACAGTCTTGACTTTATATATAGTCTGTTTGTTGGCTTTTTTAGATTACT TTTTTGGCTGCCTGACTTTTTATACGAAGTAGTCGTTTTATACTGAGATA GAATCAGAATTTTGCTATGAAATAAGGATTTATTGGTTAATATAGATTCA GTAGAGTCTTTATTACTCGAACCTCTCTAACTTGAATTTCTCTTTAACCC GAACAAGTTTTCCTGTCTCTTCAGTTAAAAATACCCTATAACTGTTACTC catatttctaaatttccttaactcgaacaaatctgTGTTCCCCATGCTTG CTCGAGTTACAGAGGCTCCACTGTACTTTCAATACTGTATTTTTTTGTCT CTCTGACTATATGTCACGACTCAGTTTGGGTTTAAACAACGATAGCAACG ACCACCATTAATCTTTCAACATTTTGATTTCGTTTCAGATGAGCACAGCA ACAACACAACAACAATATACACAACATTATCAACAATATTCTTCAATACC TTCAACACATCACAAGATGGATTCAACAAATCCCAATCAACAAACTTCAT CCATGAATAATGTACAATGTAGACCATGCCTTAATCGGTTCTTAGAATTA AGGAATCAAGCCATCAACAGAATGACAATGGAGTATCAAAAGATATGGAC TGGCCAAGGAGTACCAGCGGtaagatttatttatttatcctTCATTTACC TAGCTGgaacaaaacgttgtttcaacgttcgttTAACTTTGTATGATTCC TATGGGCGTTAGATGGGCGTGAGTTTGATGATTTACGCAAGTATGTTCCT TTGTTATAGGTTTCAGTTGAAAATTGGTTCTAGATTAAGGAATTTTTTGT GGTTTTGACAGTGTTGAAAATAAATAGACTCTTTTCTCTCGCTACCCCAA TTTCTACAAAGGGCTCTAAATTATGGTTCCTTAAAATTAAGTGGGATGTA CGTTCCAGTTTAGTATGGCAAGATTCGGATATGTTTTTGTAGAGAATTCG AACTGAAAGAGATTTATTTATTATGTAGTCCTTGTAATTCACTATAGTAA TTGTTTGGTTTTAGTCTGGATTGTGATAGTGCAAAGTCGATTTTTGGTTT CACATTCTAGCTATAGAAATTGATAGTTACAGAGAATTCTCTatataact cgaatatctccttaactcaaacaagttttaagaccctttcagttaacaat gccctaTAAACCTCCATATCTCGAAATTCCCTTAACAAATTTGTCTTCCC CGTGcctgttcgagttatggaggctcCATTGTAGTTATTAAATAAGGTCA CGAGCCGTTTTGACGTTAAACAAGTGCAAGAGagaaaaaaacgaagaaaa accTTTGATAGTTTTGTGTtacttttataatattttttggcAGGATTTGT TCTATCTTGTTTGAAGTAGTGTTTCAAAAATCCTAAGTAGAGTTTACCCT AAAAAGTGTCACTGCTGATTGAAAGAAAATATCTGTTTCAAGTTCTTATC CTCAAGCCTGTTGTAATGAAAGCATTTTTTAAGATGAAACCAAAATTCAG TTTCAGTCCTTTATAAACTGCAACTCTTGCAGAggacgcaattttttttt tcgaattatggAGTACTTGAGACCCCATGGAGTAGTAGAAAGTAATAGGT TTGTGGCTTGAGGAGTTagtaagcccgggggggggtactagggttggcga atgaggggtatgtgcggatgggacctccgaaaaccgacccttaaagagac tgatctttgctgaaaaggtgacccttagagagactttttgaaattttttt taaaaagtcataccctggaaattaaaaaatttcctaaaaatcctgaattt tccgaccctcagagagactaatttaaaactttctgatttttcggaccctt agagagactttgaaaggtgaaaaaaccgacccttaccgtctgcacatacc catcatccatttttgcctaagtacccccccccctggggtaAGAGACCGTG CTCGGTTTACGAAGTGATTCGAACTATAGAGAATCTGTTGTATTCGGGTT AACGCCAATAAAAGTAAAGCTCttccaacctcgtccccgtgtattccagg ctttatatACGTTACTGATAGACGCCAGACAATGCCAATGTATTATCTGG CGCTATCAATaggcatcaaaaagctgatgatACACAGGGAACGGGGTTGA AGCTCTCCttcaaacaaatcaaattggATAATACCTAATATGGTTTAATA ATTTTATTAACCGTTACAGGTCTATTTTCTCAAAGATTCTGTCACTTCTT TCCTTAATTCTTTGaggtttactttttttaaacattttttacaaaacgGT GATTTTTAACCAGACTATCCTTCCCGTCTGACCACTGAAGATTAACATTT TTCATAGCCATTATAAAGATTTAAAGAATGAAATTCTGAAATTCTGATCT TAAGATCGCATATAAATGTTGGGATGAAAGTTTCGTTTGCAGATTGAAGG TTAATTAATCATTGACTATGTTTATTTGGCTCTACCATAAATCTTTAGGC TCAGATTAAAACTATTATTTAACTCAAATCCACGAGTGTGTTGATCTTTT CAGCCAAGGAATAACTATTTATGTCTACTTTTAGACTAAAAGGAGATTGA CTGCTTTAATCAAGTAATATGTAGTAGTCTTTAGTCACAAGGATTATAAC AGACACAGTGTGTACCAAGCCTTATTTGTTTTTAACGCTTCATTTACATT AGGATCTTTAATTTAGGATTCTGTTTACATGTTAAATGAAAGTTTATATC tatgagatttttttattttctcaggGACTACTTTTTATTGTTTCACGTCT GTAGTTTTGTTTTAAACGATTGAtagatcaatttttttgttctaaATGTA GAAAATATATGAAAACAGAAAAGTATTAAATAGAGGGACATCATGCTGGG TCAAAGGAGACTTTGGCGTCGTAAAGGCTAAAGTATCAAGTTTGATTCGC TGTAAGGAGTATCTGTGAATCAAATCTCTCAAAAGTATATAGAGCGTATT TTGATGAGAAGGAAGGAAATTTTTCTCTAgagacgaaaaaaaattacaaa attcgTTTTATAACCGTCATATTTCTATCGGAGTTGAGTATAAATTCGGC GCGCAACGACAAGGACTTCCATGTATTTTTTACGGTTTTCGAATGTTGCA GGAAATTGACAGGAATGACAAATTTGTTCTGGCTATAGAGAGGTTTATTA AAAAGAGTTTTGTGAGCTTAAAACGGGAGATTTGAGTTTTGCTAGGACGA GTAAGTGTAAAGTACTTTCATTTTTGGCGGCTTATATTAGTGGGGCGTAC GTGATTGTTAACCcgaaacaccgaaacaccgaacAAGAAAAAGGGCtaat accgtcacaccgtcaaacCGGCATGCTCCTCTTAATACCCGGTTCCGTCT GGAATCCAAAGTGTTGTTGAAATTTTGTGTCAGCTGTGAGGTATTTTTCT GAgtggtacacgctttttttgaataagaatacactttataagaaaatggc caaaaaatcaagataatgctaagaatatcaccatcatggaatttggctac tcaagctaagaataccatttttagagcattttcgattataaattgccaat taccccaaAGTAAGGCTCACTACTTTCACGAacatgccattttatgcttg agacgtatgtactaaatgataaatctagtctgaattaggatcctaaccta agaatgttgtaagaatattttatgatgattttccctaaaaagctaagaat attcatgatgaaatggatttacaccattcttatgcAAAAAAGCGTGTAGG TAACCTGTCACAGACAATGGACATGGTGTATGGAATGGTTATCAGTGTGG CGTATCAGGCACTAAGAGTAGAAAGATTGACCTTTTCACACTCTTGCTAC TAATTTTAGACCATAGGATAGACTTGAGTTTATTTTGAATGGGATAGCCA TGCGGTAAAACACAACTCAAAgaccaaatcaaaacattccaaaaGTGAAC ATATTTGTGTGTAGAGTATAGAGAGCCCCTATTTTTCTCCTTTGACAACG CTCTCTCTCTCTCCCTCTTGTATTTTATTTCATCGCGACAGTTACGTGTT TATGTTAAAAGAATTTCGTTTAGTGTTGGACTGGAGTTTGTTGTCATTTT TGAGTGTTCTGTTAGTTTCTTACAGGTTGGCCGAACTAACTTTACAACCA TTAGAAGAAAATTTCGTTTCGTTTTTCATAGGCTAGAAGAGTCGTTCATT ATTCATGTAATACAGTATAGTGTATgtgtgttatatgataatacgataat tgttgCTGGATAATATCAGTTTAAATTAACTATAGTCTACAATTATTTTC TGCTTATTCTATGTATAACTTAATCGTCTAGCATGCACTACGGCAGCATA CTAAATGAATACATAGGGTTCAATTCTGAGACTGTTTTTTAAAGAATTCA ATGGTTTTGTTTAAAGGTGCAGTTTATTTTCGAAATCTTCTCTCAAAATT TTAGTACGCTCTGGTAGATAGGAAGGTTTTTAAAATCTGATCTTGAGATT GTCATTATATGTACCTACAAACCGTCTAGATTTATTTTAAAGGATCTAAG CTTGACTCACACTATTGACTATGAAACAAGTTGTAATAGTGGGACGGTAC CTAGGAAATGCATTAGCTTCCGATATTATGGTTTAATAAATAAATGACTT GCTTCaacttgcattttttttttgatNCAGACgcagtaggattttttcaa gccagttgggataaaaataacggactgaaactcgatggggattggtattc caatattttttatggctggggatttcaattcttttgtttccaagtcagaa aattcagtagggatggGAAAGATAGCATAATATCTATATCTTGTAGTGAA GTTTGgttcatttgattattttcggtggagacaaaaattggagaataatt ttctacgggggacgatattttggccaattcttTTAGTGGGAAGTGTTAag tgagtctgtgagaaggggtgttttTAGCTGTACTATCAATGACTACAGTA CTTTCATAATCACTGGAGCTCGTATaaaacgtcataaaaatgttcatata atgttagatgaaTTTGGAAACAACCTTGATTGTTAATTGGGAGCTTTGCA GAAAGCGAAACATCTCCATAACGCTAAAAGTTGGCTTTGCTATGGACACT TTTGCAAGCTATTGACTAGATTATGGAGAATTTGACATCATAAGCTGACA GTATTTACCAAACTTGATGGAGTTATCGCCAAACTTTGAAATCATGCTGT CATTAAAGTTTACTGTTTGCATTTAAATGTACAATAGTGAAAAGAATAgt aaaaatctggtaaaataaATATGTTTTAGGCctagaagttttttttataa gagcatccaaatttttccaaagccttgggatgttcttaaccttttgagtt ttttgtctaaaaatgttcttaaaacgattttgtgagtgtttctgtgcaat ttcctaaaaaattggTTGCCATAGATTCCAGtaatatgttcttaacttgt tcttaatattttggtcatcgatgcagtgtgttcttatatagcttgttctt ataaagaaacgttcttataaagaaacgttcttataaagaaacgtgtAGTA GATAACCTCAGAGAAAGCCAACAGTTCCAAACAAATCAGCAACAAACACA TAATAGGAGGGGCTGAATTGAATAATAGAGAAAAGCTAATAAGGTAACAA GCATAACATATAACATTATGACAAGATAATAGGGAATTTNATTTCGTTTt tcatagactggagtcgtttatttTTCGTAGTAATACAGTGGTGTATTGGT GTTAtttgataatacgataattgttgCTGGATAATATCAGTTTAAATTAA CTATAGTCTACAATTATTTTCTGCTTATTCTATGTATCGTCTAGCATGCA CTACGGCAGCATACTAAATGAATACATAGGGCTCAATTCTGAGACTGTTT TTTAAAGAATTCAATGGTTTTGTTTAAAGGTGCAGTTTATTTTCGAAATC TTCTCTCAAAATTTTAGTACGCTCTGGTAGATAGGAAGGTTTTTAAAATC TGATCTAGAGATTGTCATTATTTGTACCTACAAACCGTCTAGATTTATTT TAAAGGATCTAAGCTTGACTATTGACTATGAAACAAGTTGTAATAGTGGG ACGGTACCTAGGAAATGCATTAGCTTCCGATATTATGGTTTCATAAATTG ACATTTCATGACTTGCTTCAACTTGCATTTTTTGATGAATTGGATTCAAT GCCCTGGTAAATGTAGATAATGTTGCAACATTAAGTGTCCCTATATTTTT GGTACGGAAAAGGTTCTTGTCTGGTCTACTAATAAAGCAGAGCTAGCTTA TCATTTTAAGTTTATTTACTTATGAGAGGGAGTTTGTGAGAGTAGCTAGC TGGCAAAAAATATCGCTTCAATTTTAAAATAGTTTTATATGGACGTTGGA ttggccccggggggggggggNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAAAAGCTTTTTAGTGTT TACTTGTTGACATTTACTCAGTTAAATAGTGAAGTACTCACAGCGAGAGA GATGTGGTACTAAATGTGAAAGAggatttcttgattttcttgatttcttc ATATACGACTTATGCATATAACTCacgcaaaaaaagatttttctcttttt attttgGCTTGGAGAGGACTTGCATGTTCGCTGATCCTCGaagattaatt tttttgtgttttttaatttttgaaccTGTCACTGTTCTTGCATTTAGTTA TTAGTTGTAGTTAGTCATGCAAAAAAGTTAATCTTGCTGATATAGTGTCT TGAGGTGCAGGCTGGTTTAGGCAGTTgtattgaagtttttacaagatgct cacataattggttaaagtttttgtttgaatagttaacgaccaatcctatg acaaaaattcttgtaaaatgttcaacttgacccGATTTAGGCTACAAAag ccaaaaaaaagtttgttccATCCAGATGTTTATTTTTGGTCTTTGGTGGA ATTTGTGTGTAGATAGAACTTCACTAACGTATGCAATGCTGCAACCTACA AATCTTTTCCCTTTTGCTTAGTTTTCTTAAGCTTTTGGAAATAGCTGGGT GTCTCAGCTCTATTTACTCTTGTTATATCTTTATCAAGTAATTACCTTGG GATCATTTACAtagacactttgttttgaacTTGTTTAATATGCCTAGCAG ACTTGTGTATGTCTGTAAAGCCttttggtctttttttttaattaaaggtA CACTTGACTTTATGTCATATTGCTAAATTTGGTCTCTGAGATCGATTGAG AGACTAAAGgggttaaaataaaaaaaggatttttcttTCCCCCTTTTTTG TTGTATGTTTGTTTGTGAATGTTTTGTAGTTTGAAGGACATTAGTATAGG TATGTGATTTTTTATCATATTGTTTTTTGGAAGTCagttcattttgtttt tgttgtttgacGAATGTTCATACTAATTGTGGAAGTTTGAAGTGCCATTA TTTATTgcaattttataaaaagactGGATTCAAATTTGTGCAAGATTGAT TTTGGTTCGGCGTGTCTTTTTTAAATACAATGGATTCTCCATAACTCTAA CATGCCCGGGAATCACAAATTTGTTTAAGTTGACGAGATTTCGATTTACG GAGTAAGGTTTACAAGCCATTGTAAACTGAAGGATACTTGTTCGAGATAA GGAGTTGTGAgtaatagaagttcgagttaaagagactccactgtatttta TTATGTCCGACTGATGTTTTTGAAATatccaaatttgaaaattgatgcaa tttcacttttatctaTGTTAATCTGGTAACGTTGCTCATCAAAACAATTG CATCATTCAAATTTTAGGAGTTCGATGCCAAATACCAAGTATAAACCATG CAACTCTTTACTGTGACGGACACACTCCATGTAATATATTTCCCCTTTCT CTCTTATCTTTTTAGATTGATAGCTTAAATCATCTCGTCTATCAAAGCTT ACGACTCTCAGACCATGAATTAACAGGGACAGTCAACGGTAAATGTTTAT ATTGTGATTCACATGTTGAAACGTTAAAAAAATCCGCACTGGAGGTTGTT AAAACGCAATTTAATCCGTTTCTGAGGAACATGATTCCATATAACAACGA CACGAATAATCTTACGGCAGCcgaccaacaacaacaacaaagcaTGCTGG TTGATCGCAATGTAACGACGCGCGGTGAATCAACGGATACTTTTAACGGA TATCGAGTACCAGGTAAGGAGGTTTCGTATTATTTTCGTAATATTTTGTA TCTTTTGAACCTTGCTCTTGACCTTACTCAATACACGCCTTTTGCAGGAA TTTCGTATTTAATAAGTCCGATATTTACCcaagtttttatgaaaaaacaa tttacGTTTCAATCTCTAGGGCTAAACAATACTGTTGGAGACTCGCgttc aaatgacgtcacacttcATCAATACACTAATCTTCACCAACCAGATATGG GCAAATCAACAACCAACCAATCAGCTCCCTCCAATACAACTAATCCGACC AATCAGAATTCGACACGATCAGCAATGACATCTCAGTTCTTCGTTGAGTA AGTGTATGAGCATTATCATTTCTTAGTGAATCTATTTCAGATTATCTGTT TATCCAATAAAAGTGCTCAATGCTAACAATGATAACAGAGCTGTATGCTT TCACTGAATTTCACTGAAGGTTACCATCTGTATGGCCTGAACCTTTATGA TATTTACTTAACTCGTTTCCATTACTCAAACTAGTATCTTGCAACCAAAA ACCAACTCATAGGTTACTGGTATATTTTAACTAACCCTAATTCCTTTAAT ACCTTTTGTAAGGGGGACGACTCAAAGACACTTTTCAACTTGATCTTCTT TGATCTACATTTAGAATTGTAGGAATAAGTCTTAAGACCGCAGTCGGAGG TAACCCGAAGACCCCAATTTCAATAGTCttctacctgaaggtaggggagg aTGCCACCCTTTcttcctggattgctccacCTTTCCTTGTTCATTCTCTT TAACTGCTGAACACTAATCGTAGATgaatcaagtaccattttgctGAGTC CGGGTGGgagttgaacccacaaccttgcgcaccttagctgaatgctctac cactgcactactgTACCTGATATCAAAAGACTTACGATTTATTTATTCCG TTCTCTTTTATTATCACAGGGCAGCGAAGAAATATAATGTCCGAAAGAAT cgttcatcttcatcttcaaaaCACAAGAACAAAGAATCAAGTTCCTTGTT CCCAACCAACTTCACTAACATGCTGAAACAATCATCACCATCTAACCCAC CCGGTCTTTTCAAATATATGGGGCGTAGAGTTGATGGCAAGGTTTGTAGA TTAAAAATATCGAACCTAGATGCGTACTAGTAGATAAAGGGCAGTTTTTT CAATCTTAGTTCATCATTTGGGCTGTCTTGAATCTGAAATGAGATTGCAC TTCATTTAAACACCAGCTGTTCAAAAAATACCAAGCTAATAAAAATATCC ATATtatttaaatttgtatttttaacCGTTTTTACCTTCTTCGTTTCCAG GTCTCTGTCATGTTACGCGTCCAACCTTCCATCAACGACCAATCAGATAA CTCGCTCATCGAAATCGATCTTCGTAAAAAACAAATCTCCTTCTTACAAC CCAACGCCCCTTCATCAACACCCTTAGACGCCAATCAAGCACCACCGCCC TcccaaccaaaatattttggcttCGACAATATTTTTACACCGGAAGAACG ACATGATCGAATATCATCTGGATCTCTATTAGACGTCCTACACGCTGTTA TTAACGGTGGCGACGGGGCTCTAGTCACGTATGGAGGACCGGGAACCGGA AAAACACGGACCATGGTCGGGCAAGATGGTAGCAGCACAACGGCCGGTAT TTTACCATGCGCAATAGCATGGTTATACAGTTTAATAGACGATTGTAAAC AACGAACGGGCGCCCGGATCTCCATACGGGTTTCCGCAGTCGAAGTTGTC GGACGTAACGAAGAGTTGAAAGACTTATTAGCAGATCAAGCATCTGGGAC TGATAGTATAGACAGTCATAGTGCGTCACCTGGTATTTATTTACGCGAAG ATCCGGTAGGCGGGATAAATTTGGAGAATGTGAGTGAACCACAAGCAGCT AACAAAGAAAAAGCGGGCTTTTATTTGGATGCAGCTCTGGCTTCCAGATC AGCTGGTAAGTTCATTGGATAACTTCTGACgtgaaacaaaatttttatca aCGTCGATCATATAACGTTGGATAAACGTTTCTAGGGTGTGATTCTCCCC TAGGGAGATGACGGAATTTCTAATGGGGGATTTCTAATAATAGGAAGCAA ATCATTGAGATCTGTAGTATCTTTCATATATTATATGTGTGATTGGTTCG AGATTATTATTAGTGTTGAAATTCCTTATTGATGCTGGGAGGAGTTTCAA CCATCTTCAAGTTATTACTATTCATCTGATTCTAATTTTCGTTTTATTTA TATAGAAAAAGACAATCAAGGAGTGACGCAGAATAGCCATATGATCTTCa ctttccatatttatcaaTATCGCGTGGaaaaaaatgcaagaaaaatCCCG TCAGGTAAGTTGTTTCGTTTGGTATTTTGTCCTGctttttgattggttga ttttccTTAGAATGAAAGGTTTAAAGTTTGCCtttccaatttctttttca ctatCGGGCTCGTAATATTGACAAACACGTATTGAATTTTGGTCCCGATT AATTTTACTTGTTACTTTTCCTCAACGTATATTACAAATTCAAACGTACA TTTCAAAAGTACATATTATAAAGAAACTAGGTCATCAGCGTTGCTCGTGG ACCATAATCCCTGTAATCCCAAAGTGAATTTAGAATATAATTGGTTAAGT AGTAGACGACAGACGTCTTGAAACAAACTTGTAACCTTAACTTTCATTCA AGTGCCtctttaaagattaaagaaaaATACGCGAAAATATCGCGCGCTTA AGCTCTTGAAATTACAAGTGTTTTTCTAAACTAAGAAATTTGCGTTCACT ATTTGTGTTTATTTGAGTCATTGACAAACTTTTTGGCTGTGTTTATTGAA AGTAGTCACTAACTGACATGTCACTATTTCCTTTCATAAAGAACATGAAC AAATAAAGTCCCCTTGTTTTTGACCAGCACACCAAACATAGTGAATGTCA GTCAACCCTTCTTGAATGTTTGTTAAAACGATAACTTTAAACATCCTGTT GTGTGTCCGTTAGCCATGTTACTTTCTATCACTTTCTCTCTCCGTCATTT TGAATTTGGTATCCTAGCTAGCACCATATTTGTACGTAAATATCTCTTCT GCGTGAATACAAAACGAGCGCTGTATTAATCTTTACCCTCCAACTCCTAA GTTTGTTTAACGTAAATTTGATTTTGGCATTATAGTAATCAGGATGATCA GGGGTAACgaaaaaacaaattgtaaacgATCAGAGCCTCCGATTTCaaat atcgcaaaaaaaaatgaatgttATAATTATTCTATGTCcttcagtaaaga aaaataattgagAATATCATGAGAATAGTTATAGCCTGAAAATCAAGAAT ACCGAAAAATAACAACTGCACCAAACCAGTTTGGATTCTATAATCGCTTA TACTCACTCACACTTTTTAGTTTTTCACTCATATCCTAAATTGACTTCAA TCCTAACAATTCCACATTCTTTTTTCATTAGGTTCAGTACCGCAATACTC AGGTGGGCGATCCAGGCTACATTTGATTGATCTCAGTTACGTCAACCaaa atttcgaagaaaaaacatcACAGCCTAGTCAAGCACCTAGTCATGCTGCG TTGGGTCAAATTATGATCACCATGCTTAATGGAAACAAAAAAGTCACGTT GTTCAAAGACAGTAAAATCTCACGACTTTTACGTGACTCTATTGGTAACC AAACGTGCCGAACAACCGTGATAGCTCACGTTTCTGCGGAAGAGAAAAGC GCACGAAAAACACTTCAAACGCTGAATATCACGCAGAAAATTCAACGCAA ACGTAGAAAAAGAAATAAGGTACGTAATGACGTAGTAGCGTAAGTACGTG GATAATCTTCAATCATCAAGGGAGACCCTTTAACTGAACTTAGTACAAta aagtctctataactcgataGCCCAcaagaaacacaaatttgttcgagtta tatgGAAGTTTAAAGTAAAACAAACAGGTTTTATAAGGAATGCGGTATGT TTACCTAAAGGGNGCCTGAAAATCAAGAATACCGAAAAATAACAACTGCA CCAAACCAGTTTGGATTCTATAATCGCTTATACTCACTCACGCTTTTTTG TTTTCCACTCATATCCAAAATTGACTTTAGTCCTAACCATTCCACAATAT TTATTTCACTAGGTTCAGTACCGCAATACTCAGGTGGGCGATCCAGGCTA CATTTGATTGATCTCAGTTACGTCAACCaaaatttcgaagaaaaaacatc ACAGCCTAGTCAAGCACCTAGTCATGCTGCGTTGGGTCAAATTATGATCA CCATGCTTAATGGAAACAAAAAAGTCACGTTGTTCAAAGACAGTAAAATC TCACGACTTTTACGTGACTCTATTGGTAACCAAACGTGCCGAACAACCGT GATAGCTCACGTTTCTGCGGAAGAGAAAAGCGCACGAAAAACACTTCAAA CGCTGAATATCACGCAGAAAATTCAACGCAAACGTAGAAAAAGAAATAAG GTACGTAATGACGTAGTAGCGTAAGTACGTGGATAATCTTCAATCATCAA GGGAGACCCTTTAACTGAACTTAGTACAAtaaagtctctataactcgata GCCCAcaagaaacacaaatttgttcgagttatatgGAAGTTTAAAGTAAA ACAAACAGGTTTTATAAGGAATGCGGTATGTTTACCTAAAGGGATCAAGT CTATCagcaaacttgttcgagttaaggagatattacaatctaccttaaag gaagaaatttgggcgggaatttaatttggcggatggccaaaaaagttttt tcagagggaatttaatttggcggatggacgaaaaaagtaaatttggcggg aatttaatttggcggtcgcttaaaaatttaaccttaagatggcgtcaaaa cagcgaaaaaatagcaaaaacaccttaaaagagaNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNagcggg aatttaatttggcggatggcggaaaaaagaaattttggcgggaacttaat ttggcggatttcagtcaaatccgccaaatccgccaaattttctttccgcc aaaatttcttcctttaaggtagtgcTGATTTGGAAATCTTTTTGCTGATT CGTTTTTTTGTCTCAGTCATTTTGGTTTCTATTGCGTTTTTAAACGGAAA TAAGGTGCTTAGCATGTATTCCCTTTTATGAGGTATTTTTGCGGACATTA CCATGGTAACTAAAATAAACACTTGCATGTTTCAGGAAAATCCGGGAAAT CCGGAAAAATATGAAATGCAAACAAACTTACACATATTTCAGAAAGTTTA AAATTCCAACCAACTGAAAAAAAGATGATTGACTTTGGGATGTTAATTAA TCATAAATATGGCTTCCTTATAATACTGTTTTATTTTTCGTCCCATAGAA CTATAGCAGCTCATCAGACCAAAGCTCGTGTGATGAAGGAGGCAAGCCAA AATTTCGCGTGCAACACCCTCTTATCTCAACACGTGCAATCGAAGACACT TACAATTGTTCTGATTACAATACATCATCAGCCGGCGAAGATTCCTGTGA CACAGTTATCTATATGGGCTCGTCAGGCGGACACTTAAGTGATCGCGATT TAACGGATAATGAACGCCCACCTTCGCCGAACacaatgaaaattatgaaa ttgaaactttcttcttcTGAGGATGAGAATACGGATACTGGTAGTGATAT TATGCCATGTGCAGATTCTACTGAAGATTTGAGAATGAGATTAAAAACAT TGGAAGAGTGTGAAGAAAAGACTAGCTCACAGGCTCCACTCTCTCCGCCT CCTTCTTTGTTGATAGCTAAAAAGCCAATCGCTCCAATCGAAAGAGCTGT AAATGTTGTTGCGCCTCTCGTTGTCAAAGAAACGCCCATCATTGAAGAAG AGACCACTCCCAAAACGCCCGATATGACGAAACCTTTAACGCCCCCGCCA CAAACCGCAGAAGAAGTGAAACGTGAGATCAGTATGACTTTCAACGCCCA AGATACAACGCCCAAACAAGAAGCCGCCATGGATTTAGAGAGAAACGTTA GTGAAAAAGACTTACGTAACCACGAGAAAAGAATTGAGAAACTTTTAACA GACTTTAACGCTTTAAGTGATGATGAGGAAAATTCAGTCGAAAAACAAAA CCGTAGAAATAATTCGTATACACGCGGTGACGGCTATTTGTCTGATGCTG CTACGTCACTACTTCGTAACTTCCGTAGAACAACGTCAACGAGTTCCGCT AGAGACGGTTACATTTCTGCACCGGAATACTCTAAAAAACCGGTTCAGAT AGTTCGTGGAATGGTCCGTAAACAAACGAGCCTCGACGAAGAAGAAGTTa ttgaaaaacttaaaaaactgAGTAATCAAGACGAAACAGAGAAGGAAACT TGTCTCGATGATATTCTAAATAATGTCAAAACAAGCACACCAAAATCGGA CTTATCGAAGCAACCAACCACGAATgatcctttaaaaatacaaccCTTAA CTGTCGGTCGTTTTTCGTGTATACGGGAAGCATCAAACGGTGAGTCTCCA AAGATTGCTCCACAAAAGGATCTATCTGGAATTGCACTTCAAGAGATTGA CGAGACAGATTTGTCGAGGGAATGCCAGCCCAGTACTAGTCGTGTCGAGG AAGAACCGACATTAAACGCCTCTACTGATATTGCTGGTCGACTTCAGAAC TTAAATCATATAATTACCGTATCCTCGGTACCAAATTTCTCGGTTGCTAA GAAACCTTCTCTTTCCAATCTTCCATCATCACCGACGATGCCTATTCGTC AAAATCTGTCACGTGATTTACTCGAATCAGTCAATAAGGATCGAATGTTT AGTCCACCCAGTTTCGAACGCTCGTATTCGCGTGAAGACACAATCAGTGT GGTTTCTGCATATGAGAGTGACGCCTACGATTCTGACGCCCTTGCAAGTC CCGCCCTTGGTGGAGGGCGATCTGGGCGTAACCCAACTCGTCTGAGATAT CGTTGGTCGACGGTTTATGAGGAACCCGAAGATAAAAAATCGGAGAAACA CAAATCCCGAAAACCAGTCGTGGATGGTGAAGGAAAACCGGCTCGTGTAA TCACATCTCcaaaatcttttgccaaaaaCCAACACCAAAACTCTAAGAAC TCACTAACATCTCGATTCACAAAATCacctaaaaatgaaaagaaatcatC AGAAACGCCAAAATCgcctaaaaaattattttcctcgTCATCTTCATCAA AAACAACGGACATGCCGCTATCACCGAAATCTGGAAAATCGAAATTCAGC ATCTTGTCACCAAAATCGGAACGGAAAAATAAGAAATCGAACAGCGGAAA TAACCATTCGCCGGATAAGCGAATGTCCGGATGTAGTGAAGCAAGCAGTG GATTGGATAGTGGTATTCACAGTCAGACGTCTTCATTGAGAAGTGGCGAA GAAATTAAAGTTGATGATAGCACGATTGTTAGGGAAGAAGTTCGATCAAC CAAACATAAGTTATGGCCATTTGGGTAAGTGAATTTTACAGTCCAATGTT GCAACTTTTCCATAATGCGGAAATCCGACTAGCTAAGAGACAAATACATC ATTTTCGTCTAGCCAGTAAGAGGGTTTTTGACTCAAACGACAATCCTAAG ATTTCCGTCCATGCTCACAAATACGCGGTTGCAATACTGTActgtcaact ctctctaattcgatacacgttttttttataagaacgtcaaaaattttcga agccttcggatgttcttagttttttggatttgaagcttcttattttcagc attttttgagcattatgatgtaattttttaagaaattgcatgtttttaag tctccaaagccttagtatgttcttagaatgttcttaaatttttgggcctc gaagctttatgttcttatatagtttgttcttataaaaaaaacgtgtagct tttATTATTCGAACACCTGTGTAGTTCGAACTAAAGCATTAGTGTGCTCA ActggaaaattgtataaaaTACTATGCATAGTACGAATATTTATataatt taaaagaaattcttgaccccttgaagatcgatttAGAAAGAGTAAACTAT TTTagattttctggaaattttgTAAATGGGTTTTGTAAAGAAATTTACTA TTAAGCCGAATCTTGAAAGAGCTCTGATAAAGTTTCAAATCTTTAATAAA TTATTGTACTGACAAACTTTGTTCAACATGAAAGTTAATCAGCTCAGATT ACCAAATGTTTTATTAGACTCTTCAAGCCAATGAATTCATCTTTCAAAGA CTTTTACCCTCTTTCTACCTTATTTTCAGACGTAGTAAATCACGCAAATC GTCACGAAGTTTATCGGGATACGTCAGTGATAGTGTCACGGAATCACGTT CACGAAGATCACGATTCTTCTCACGAAGTTCAAGTAAGTACATTTCTTGT ACTCTCTTTTGCATATCTTTCATTATTCAAAACACTTTAAAGCATTAATG TCTTGCTCATGAACGGCTGGAGAGCTTTTTGACCAATAACAATATCAATC AAAAGCTCTTTTAATGATATTTACAagtatacagtggagtctctataagt CGAACGTGTATGGGGAATTGAAATatcttcgagttatggaaacttcgagt tatggaaatttcgagttatggagactgaTTTACAAGGCTTTTTCACTGAC GTGACGAGAAACTTGTTTGAATTAAGGACATTCGGGTAATAGAGCTTCGA GCACTGGAGACTCCAGTGTATCATCGTTTGCGAACCCGGTTAACAATCAC CatcttttctttcttctatAGAATCTTCTTTGAGCAATACAGAAGGATAT TGCAGTGGTTACGAAACGTCCGTGACCGAAGGAGGCTTGACCAGTTGTAC TGAAGACAACTATACCACTGATAACGAGTCGGTTACCggcaaaaagaaga agaaaagattcCTCGGTTTCCGTAGGCGATCGACAAGCGATCTTTCTTCA ACGCGCGGCCGAGTGAAGAAACCATTATGGTTCGATTCCAAACGCGGATG TCAGTCGGATACTGAAGATTTGCAATTGAAAGTTTATCAAATAGACGATC CACAGCAAGTCAACAAACGAAAAAGCAGTGGCAAAAAGGAATCGCAAAAT ATGGTACATataatttgattaattttaaaTTCATAGTCCGATGTTATTTG TTTAGAGTTGCactgtatttttttcaattagaattcttttatagaaaagc cAAAGCCGGGGGCAAAGACCAACAAGGCTGAAATTCATTCGATTATTGAT TCTCTGAAATTTCAGAACCCTTTAAAGTAAAACATGTATCCTTCTTTCTC ACTTGCAGCCTTCGCGACAACATCCGCAACAGCAGCAAACATCGAGACAT ATCGAAGGACTTCGAACACAAAACGAACAATTAAAAAGTGAGAGTTTTTC TTTAGTTTCAATGATGTTACATCAAGAAACTAATATTGAGGATTTATGCT CATGCATATGGGAAGTTTTAGTAACATGCTccaatttttccccgataacG TATGCTGGAAGTAGGCTCgctgttttgaatttttatctcAGGCTCTTTTA TATTTCCTCTTGTTTTGATTGCTTAGTAGACTAGATTCAGCTTCTAACTG AACGAGTCCAGTTAACTAAGACTGGGTATCCAGTCTATAAGAAGTCCCCA GGTTACTTGCTTAGGGATTGACTTTTTAGAAAACAGAATATTAATAATAA ATGCTGttcatttctttttcagaaCCGATTGGTTACATGAAATATCAACC AGCTGCTGTTCCCTCATACAATCCAAACCACCATCCCCAACAAAGTTACC TTCAGCATCAACATCCTCATCCTCCCCATCAACAAATTGCTCAACATTCT TCCTTTACTCAGCAACAATTACATCAGCACCagattcaacaacaacaaca ttttCAACGACATCAACAAGCCATGAAAAACCATCATATTCAAGTGGTGA CCTGCTTTGATCGAACTTCACGTAAAGTCACacagatttgaaaaattttg tttctgCATCGCtcaatttttctaagaaaatcgaaattcaatcaTGCCAA GATGGTTACCAGGCTTTTAAAGATCTTAAAACATTGTCCCTGtctatccc aggctttatttatgttACTGATTGACTacagagaatattatctagcgcta tcagtaagcataaaaaagccgATAATACGCAGGGGACGAAGATGACAATC TCTGATAAACgtggatttgactgaaattttatggctcaaatttttcgTAA ACTAAAGTTTTTAAAGTATTTAGCTAGCTTAAACTACGAAGATTATACCA ATTTATGTTAAACTGAGATATTTTTAAGTTCTTCGGTTTTTCCTCGTTTT ATCAGGAAACTGTAATCAAATTtccgaaaaatcatcaaaaaacaaaattt gctcaaatatGATAAGATTTC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000272XLOC_000272Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000411-exon-sc0000002-1491911889:142447..142641TCONS_00000411-exon-sc0000002-1491911889:142447..142641Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1510915933:142447..142641TCONS_00000411-exon-sc0000002-1510915933:142447..142641Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1575043694:142447..142641TCONS_00000411-exon-sc0000002-1575043694:142447..142641Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1491911889:184135..184365TCONS_00000411-exon-sc0000002-1491911889:184135..184365Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1510915933:184135..184365TCONS_00000411-exon-sc0000002-1510915933:184135..184365Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1575043694:184135..184365TCONS_00000411-exon-sc0000002-1575043694:184135..184365Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1491911889:194762..195059TCONS_00000411-exon-sc0000002-1491911889:194762..195059Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1510915933:194762..195059TCONS_00000411-exon-sc0000002-1510915933:194762..195059Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1575043694:194762..195059TCONS_00000411-exon-sc0000002-1575043694:194762..195059Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1491911889:195216..195393TCONS_00000411-exon-sc0000002-1491911889:195216..195393Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1510915933:195216..195393TCONS_00000411-exon-sc0000002-1510915933:195216..195393Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1575043694:195216..195393TCONS_00000411-exon-sc0000002-1575043694:195216..195393Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1491911889:196016..196187TCONS_00000411-exon-sc0000002-1491911889:196016..196187Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1510915933:196016..196187TCONS_00000411-exon-sc0000002-1510915933:196016..196187Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1575043694:196016..196187TCONS_00000411-exon-sc0000002-1575043694:196016..196187Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1491911889:196397..197051TCONS_00000411-exon-sc0000002-1491911889:196397..197051Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1510915933:196397..197051TCONS_00000411-exon-sc0000002-1510915933:196397..197051Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1575043694:196397..197051TCONS_00000411-exon-sc0000002-1575043694:196397..197051Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1491911889:197352..197450TCONS_00000411-exon-sc0000002-1491911889:197352..197450Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1510915933:197352..197450TCONS_00000411-exon-sc0000002-1510915933:197352..197450Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1575043694:197352..197450TCONS_00000411-exon-sc0000002-1575043694:197352..197450Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1491911889:199259..199596TCONS_00000411-exon-sc0000002-1491911889:199259..199596Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1510915933:199259..199596TCONS_00000411-exon-sc0000002-1510915933:199259..199596Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1575043694:199259..199596TCONS_00000411-exon-sc0000002-1575043694:199259..199596Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1491911889:200545..202670TCONS_00000411-exon-sc0000002-1491911889:200545..202670Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1510915933:200545..202670TCONS_00000411-exon-sc0000002-1510915933:200545..202670Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1575043694:200545..202670TCONS_00000411-exon-sc0000002-1575043694:200545..202670Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1491911889:203476..203579TCONS_00000411-exon-sc0000002-1491911889:203476..203579Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1510915933:203476..203579TCONS_00000411-exon-sc0000002-1510915933:203476..203579Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1575043694:203476..203579TCONS_00000411-exon-sc0000002-1575043694:203476..203579Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1491911889:203968..204299TCONS_00000411-exon-sc0000002-1491911889:203968..204299Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1510915933:203968..204299TCONS_00000411-exon-sc0000002-1510915933:203968..204299Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1575043694:203968..204299TCONS_00000411-exon-sc0000002-1575043694:203968..204299Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1491911889:204505..204583TCONS_00000411-exon-sc0000002-1491911889:204505..204583Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1510915933:204505..204583TCONS_00000411-exon-sc0000002-1510915933:204505..204583Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1575043694:204505..204583TCONS_00000411-exon-sc0000002-1575043694:204505..204583Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1491911889:204919..205617TCONS_00000411-exon-sc0000002-1491911889:204919..205617Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1510915933:204919..205617TCONS_00000411-exon-sc0000002-1510915933:204919..205617Clytia hemisphaericaexon
TCONS_00000411-exon-sc0000002-1575043694:204919..205617TCONS_00000411-exon-sc0000002-1575043694:204919..205617Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:142447..205617 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0.00088482 0.00826744 0.0307992 0.0190933 0.908674 0 0 0 0 0.873581 0.125648 0 0 0.849731 0.76773 0.16874 0.482123 0.539164 1.02363 0.303547 0.825279 1.51406 8.45434e-05 6.97235e-07 0.38814 0.229621 6.04266e-06
Blast
BLAST of TCONS_00000411 vs. Swiss-Prot (Human)
Match: KI26A (Kinesin-like protein KIF26A OS=Homo sapiens GN=KIF26A PE=1 SV=3)

HSP 1 Score: 317.775 bits (813), Expect = 2.252e-87
Identity = 205/489 (41.92%), Postives = 285/489 (58.28%), Query Frame = 1
Query:  982 FPTNFTNMLKQSSPSNPPGLFKYMGRRVD-----GKVSVMLRVQPSINDQSDN---SLIEIDLRKKQISFLQPNAPSSTPLDANQAPPPSQPKYFGFDNIFTPEERHDRISSGSLLDVLHAVINGGDGALVTYGGPGTGKTRTMVGQDGSSTTAGILPCAIAWLYSLIDDCKQRTGARISIRVSAVEVVGRNEELKDLLADQASGTDSIDSHSASPGIYLREDPVGGINLENVSEPQAANKEKAGFYLDAALASRSAEKDNQG--VTQNSHMIFTFHIYQYRVEKNARKIPSGSVPQYSGGRSRLHLIDLSYVNQNFEEKTSQPSQAP---SHAALGQIMITMLNGNKKVTLFKDSKISRLLRDSIGNQTCRTTVIAHVSAEEKSARKTLQTLNITQKIQXXXXXXXXXXXXXXXXXXCDEGGK----PKFRVQHPLISTRAIEDTYNC--SDYNTSSAGEDSCDTVIYMGSSGGHLSDRDLTDNERPP 2391
            +PT+F+ +L+   P  PP L +   +  D     GKV VMLR+ P+   Q      S +++D RKKQ+    P A         +A   + PK F FD +F  +     + SG++ DVL +V++G DG + ++G    GK+ TM+G+D S  + GI+PCAI+WL+ LI++ ++RTG R S+RVSAVEV GR++ L+DLLA+ A G+      + SPG+YLREDPV G  L+N SE +A   EKA FYLDAALA+RS  +   G    ++SHM+FT H+YQYR+EK  R          SGGRSRLHLIDL              +  P   S +ALG +++ ++NG K V  ++D +++ LLR+S+    CRTT+IAHVS       +TL T+ +  +I R RRK+ K  SSSS   S  E G+    P  R  HP       + T  C   D + SS+ E SCDTVIY+G  G  LSDR+LTDNE PP
Sbjct:  336 YPTDFSGVLQLWPPPAPPCLLRAASKTKDNPGSIGKVKVMLRIWPAQGAQRSAEAMSFLKVDPRKKQVILYDPAAGPPGSAGPRRAATAAVPKMFAFDAVFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWLFRLIEERRERTGTRFSVRVSAVEVCGRDQSLRDLLAEVAPGS---LQDTQSPGVYLREDPVCGAQLQNQSELRAPTAEKAAFYLDAALAARSTSRAGCGEDARRSSHMLFTLHVYQYRMEKCGRG-------GMSGGRSRLHLIDLGSCEAAAGRAGEA-AGGPLCLSLSALGSVILALVNGAKHVP-YRDHRLTMLLRESLATAGCRTTMIAHVSDAPAQHAETLSTVQLAARIHRLRRKKAKYASSSSGGESSCEEGRARRPPHLRPFHPRTVALDPDRTPPCLPGDPDYSSSSEQSCDTVIYVGPGGAALSDRELTDNEGPP 812          
The following BLAST results are available for this feature:
BLAST of TCONS_00000411 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KI26A2.252e-8741.92Kinesin-like protein KIF26A OS=Homo sapiens GN=KIF... [more]
back to top