Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000385 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000385
Unique NameTCONS_00000385
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length490

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000385 ID=TCONS_00000385|Name=TCONS_00000385|organism=Clytia hemisphaerica|type=transcript|length=490bp
GGTTTTCTTATCTAAAggattagtaaataaataaggTTATTTTCGGTTAC
ATCATGGGAACAGAAGCTAATATTACTACATGGTTCTTGAGATCAGCTGG
TCGTCATGACAATCAAGAACCCTTCCTTCTTTGGCTCGAAAACGTCGCAA
GCACCAAAGAAGTGCCGCCCGTCCACAGCGTCAGTTACGGAGATGTTGAA
AGTTCACTTTCAGTTCCATACATGCAACGCGTAAACACTGAATTCATGAA
AGCTGGGGTTCGTGGAATCACAATTTTATTTGCCAGTGGCGACGATGGAG
CAGCATGCAAGAAAGGGAAATTTTCACCACAATTCCCAGTCTCCAGTCCT
TACCATTGTTTAACTTGCCATCGTTGATTGATGACAATTTAGAGACAATA
GAGTATGATGACCATTTGCTAAATGCTGTATTTGATAATTATTCTATTGT
AGATTCTTCTTTGTCATGGTCACATTTAATATTCTTAGAg
Run BLAST on NCBI

protein sequence of TCONS_00000385-protein

>TCONS_00000385-protein ID=TCONS_00000385-protein|Name=TCONS_00000385-protein|organism=Clytia hemisphaerica|type=polypeptide|length=107bp
MGTEANITTWFLRSAGRHDNQEPFLLWLENVASTKEVPPVHSVSYGDVES
SLSVPYMQRVNTEFMKAGVRGITILFASGDDGAACKKGKFSPQFPVSSPY
HCLTCHR
Run BLAST on NCBI

transcript from alignment at sc0000001:2803032..2803521

Legend: exonthree_prime_UTRCDSfive_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000385 ID=TCONS_00000385|Name=TCONS_00000385|organism=Clytia hemisphaerica|type=transcript|length=490bp|location=Sequence derived from alignment at sc0000001:2803032..2803521 (Clytia hemisphaerica)
cTCTAAGAATATTAAATGTGACCATGACAAAGAAGAATCTACAATAGAAT AATTATCAAATACAGCATTTAGCAAATGGTCATCATACTCTATTGTCTCT AAATTGTCATCAATCAACGATGGCAAGTTAAACAATGGTAAGGACTGGAG ACTGGGAATTGTGGTGAAAATTTCCCTTTCTTGCATGCTGCTCCATCGTC GCCACTGGCAAATAAAATTGTGATTCCACGAACCCCAGCTTTCATGAATT CAGTGTTTACGCGTTGCATGTATGGAACTGAAAGTGAACTTTCAACATCT CCGTAACTGACGCTGTGGACGGGCGGCACTTCTTTGGTGCTTGCGACGTT TTCGAGCCAAAGAAGGAAGGGTTCTTGATTGTCATGACGACCAGCTGATC TCAAGAACCATGTAGTAATATTAGCTTCTGTTCCCATGATGTAACCGAAA ATAAccttatttatttactaatccTTTAGATAAGAAAACC

Coding sequence (CDS) from alignment at sc0000001:2803032..2803521

>TCONS_00000385 ID=TCONS_00000385|Name=TCONS_00000385|organism=Clytia hemisphaerica|type=CDS|length=324bp|location=Sequence derived from alignment at sc0000001:2803032..2803521 (Clytia hemisphaerica)
TCAACGATGGCAAGTTAAACAATGGTAAGGACTGGAGACTGGGAATTGTG
GTGAAAATTTCCCTTTCTTGCATGCTGCTCCATCGTCGCCACTGGCAAAT
AAAATTGTGATTCCACGAACCCCAGCTTTCATGAATTCAGTGTTTACGCG
TTGCATGTATGGAACTGAAAGTGAACTTTCAACATCTCCGTAACTGACGC
TGTGGACGGGCGGCACTTCTTTGGTGCTTGCGACGTTTTCGAGCCAAAGA
AGGAAGGGTTCTTGATTGTCATGACGACCAGCTGATCTCAAGAACCATGT
AGTAATATTAGCTTCTGTTCCCAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000259XLOC_000259Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000385-proteinTCONS_00000385-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000385-exon-sc0000001-1491911889:2803032..2803521TCONS_00000385-exon-sc0000001-1491911889:2803032..2803521Clytia hemisphaericaexon
TCONS_00000385-exon-sc0000001-1510915933:2803032..2803521TCONS_00000385-exon-sc0000001-1510915933:2803032..2803521Clytia hemisphaericaexon
TCONS_00000385-exon-sc0000001-1575043694:2803032..2803521TCONS_00000385-exon-sc0000001-1575043694:2803032..2803521Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2803032..2803521 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.2705 0.778633 0.298957 1.58452 0.866464 0.163865 8.2132 8.77656 48.189 31.1297 55.3745 54.1214 41.4165 42.1916 145.64 209.546 114.421 84.0934 22.0518 22.0793 65.3438 63.7055 136.38 124.305 43.0774 23.1555 67.3605 92.9118 408.646 282.088
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000209Peptidase_S8/S53_dom
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
Vocabulary: Molecular Function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
molecular_function GO:0004252 serine-type endopeptidase activity
Blast
BLAST of TCONS_00000385 vs. Swiss-Prot (Human)
Match: TPP1 (Tripeptidyl-peptidase 1 OS=Homo sapiens GN=TPP1 PE=1 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 1.133e-33
Identity = 60/106 (56.60%), Postives = 73/106 (68.87%), Query Frame = 3
Query:   48 YIMGTEANITTWFLRSAGRHDNQEPFLLWLENVASTKEVPPVHSVSYGDVESSLSVPYMQRVNTEFMKAGVRGITILFASGDDGAAC----KKGKFSPQFPVSSPY 353
            Y+M   ANI+TW   S GRH+ QEPFL WL  +++   +P VH+VSYGD E SLS  Y+QRVNTE MKA  RG+T+LFASGD GA C     + +F P FP SSPY
Sbjct:  279 YLMSAGANISTWVYSSPGRHEGQEPFLQWLMLLSNESALPHVHTVSYGDDEDSLSSAYIQRVNTELMKAAARGLTLLFASGDSGAGCWSVSGRHQFRPTFPASSPY 384          
The following BLAST results are available for this feature:
BLAST of TCONS_00000385 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TPP11.133e-3356.60Tripeptidyl-peptidase 1 OS=Homo sapiens GN=TPP1 PE... [more]
back to top