Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000311 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000311
Unique NameTCONS_00000311
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length307

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000311 ID=TCONS_00000311|Name=TCONS_00000311|organism=Clytia hemisphaerica|type=transcript|length=307bp
CATCAATCGATTCATCTCAGGACCATCCAAGATATCTCTGGCTATGTTAG
ATAAGCTACTTAGGGATTCTCTTGGCACATTTGATACTTTTAAGTCAATA
TCTCTTGGCGATTCTCTAGCCATATTCGCTTCCTTCTTTgtcgatttttc
attttttgacagCCTTGAACCTAAATCCCTTGATTTTTTTGGAGTGGGTC
TCCTTGAAGGTGATAAAGCCTGTAATGTGATAGTGCCCTGACCGGGAGTT
GCTGGATAAGCATACCAATCTCTCTTCTTATTCCCATTAATGTCAGTTCT
ATCGGTT
Run BLAST on NCBI

protein sequence of TCONS_00000311-protein

>TCONS_00000311-protein ID=TCONS_00000311-protein|Name=TCONS_00000311-protein|organism=Clytia hemisphaerica|type=polypeptide|length=102bp
TDRTDINGNKKRDWYAYPATPGQGTITLQALSPSRRPTPKKSRDLGSRLS
KNEKSTKKEANMARESPRDIDLKVSNVPRESLSSLSNIARDILDGPEMNR
LM
Run BLAST on NCBI

transcript from alignment at sc0000001:1036277..1036583

Legend: exonfive_prime_UTRCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000311 ID=TCONS_00000311|Name=TCONS_00000311|organism=Clytia hemisphaerica|type=transcript|length=307bp|location=Sequence derived from alignment at sc0000001:1036277..1036583 (Clytia hemisphaerica)
AACCGATAGAACTGACATTAATGGGAATAAGAAGAGAGATTGGTATGCTT ATCCAGCAACTCCCGGTCAGGGCACTATCACATTACAGGCTTTATCACCT TCAAGGAGACCCACTCCAAAAAAATCAAGGGATTTAGGTTCAAGGctgtc aaaaaatgaaaaatcgacAAAGAAGGAAGCGAATATGGCTAGAGAATCGC CAAGAGATATTGACTTAAAAGTATCAAATGTGCCAAGAGAATCCCTAAGT AGCTTATCTAACATAGCCAGAGATATCTTGGATGGTCCTGAGATGAATCG ATTGATG

Coding sequence (CDS) from alignment at sc0000001:1036277..1036583

>TCONS_00000311 ID=TCONS_00000311|Name=TCONS_00000311|organism=Clytia hemisphaerica|type=CDS|length=306bp|location=Sequence derived from alignment at sc0000001:1036277..1036583 (Clytia hemisphaerica)
ACCGATAGAACTGACATTAATGGGAATAAGAAGAGAGATTGGTATGCTTA
TCCAGCAACTCCCGGTCAGGGCACTATCACATTACAGGCTTTATCACCTT
CAAGGAGACCCACTCCAAAAAAATCAAGGGATTTAGGTTCAAGGctgtca
aaaaatgaaaaatcgacAAAGAAGGAAGCGAATATGGCTAGAGAATCGCC
AAGAGATATTGACTTAAAAGTATCAAATGTGCCAAGAGAATCCCTAAGTA
GCTTATCTAACATAGCCAGAGATATCTTGGATGGTCCTGAGATGAATCGA
TTGATG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000185XLOC_000185Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000311-exon-sc0000001-1491911889:1036277..1036583TCONS_00000311-exon-sc0000001-1491911889:1036277..1036583Clytia hemisphaericaexon
TCONS_00000311-exon-sc0000001-1510915933:1036277..1036583TCONS_00000311-exon-sc0000001-1510915933:1036277..1036583Clytia hemisphaericaexon
TCONS_00000311-exon-sc0000001-1575043694:1036277..1036583TCONS_00000311-exon-sc0000001-1575043694:1036277..1036583Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000311-proteinTCONS_00000311-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1036277..1036583 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 0 0 0 0 0 0 0 0.481234 0.249883 0 0 0 0 0 0 0.349802 0 0 0 1.16532 0.693349 0 0 0 0
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000311 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top