Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000278 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000278
Unique NameTCONS_00000278
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length703

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000278 ID=TCONS_00000278|Name=TCONS_00000278|organism=Clytia hemisphaerica|type=transcript|length=703bp
CCAATAAAAAACAACTCAAAACAACATAAGCTCCAGTGAAACAATTCACA
TGTTCCGTATACGGAAACATGTCAGAAACAAGACCAGAAAGGAATGAACC
AGCGGAGAAACCAAAGGTTCCAAACATACGGTTCCAACCAAATTCTTTTG
GAGTCGGGGATGCACGTATTCTTTTTACAACACCAGCATCCACCAATGTT
ATAATACACCCGTCAAAACATGAagccaaaatattaacaaaTAGAAATAT
AATCAATCGAGTTGAACGGAAGTTAATAGTCGAATTGGCCTCGTTGCGTG
TGGCTGATCCACTGCTTGTGGTGTTTGTTTCCAAAGGTGCAGGGCAAGTG
TTTGTCCATTGATCACCGATCCATATAGATAACAAAGGTTGACCGCCTAC
CCATAGTATTGACATTAAAGCCATGAGTATGAGAATCAGAACATGATTTT
GTCGTTTGTCAGTAATGAAGCCCCATAAAGGACCAGCAAAAGTCATCCCA
AGAAGACGAAGACCTGTCACCAGACCTGCTTCTGCTTTGTTCAATCCGAC
GCCGACAAGGAAGGATAATGCATAAGGTTTGAAAGCGCCATCTATGCCAT
TTGCGAGAAAGTAAGTAATTTTGGCAGGGAACATGTACCAATCGATCATG
AAAGCTGTCGTCAATTGACCAAGTAACGTTGGGTGAGGGTCATTACTGAC
TGA
Run BLAST on NCBI

protein sequence of TCONS_00000278-protein

>TCONS_00000278-protein ID=TCONS_00000278-protein|Name=TCONS_00000278-protein|organism=Clytia hemisphaerica|type=polypeptide|length=234bp
SVSNDPHPTLLGQLTTAFMIDWYMFPAKITYFLANGIDGAFKPYALSFLV
GVGLNKAEAGLVTGLRLLGMTFAGPLWGFITDKRQNHVLILILMALMSIL
WVGGQPLLSIWIGDQWTNTCPAPLETNTTSSGSATRNEANSTINFRSTRL
IIFLFVNILASCFDGCIITLVDAGVVKRIRASPTPKEFGWNRMFGTFGFS
AGSFLSGLVSDMFPYTEHVNCFTGAYVVLSCFLL
Run BLAST on NCBI

transcript from alignment at sc0000001:214162..214864

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000278 ID=TCONS_00000278|Name=TCONS_00000278|organism=Clytia hemisphaerica|type=transcript|length=703bp|location=Sequence derived from alignment at sc0000001:214162..214864 (Clytia hemisphaerica)
TCAGTCAGTAATGACCCTCACCCAACGTTACTTGGTCAATTGACGACAGC TTTCATGATCGATTGGTACATGTTCCCTGCCAAAATTACTTACTTTCTCG CAAATGGCATAGATGGCGCTTTCAAACCTTATGCATTATCCTTCCTTGTC GGCGTCGGATTGAACAAAGCAGAAGCAGGTCTGGTGACAGGTCTTCGTCT TCTTGGGATGACTTTTGCTGGTCCTTTATGGGGCTTCATTACTGACAAAC GACAAAATCATGTTCTGATTCTCATACTCATGGCTTTAATGTCAATACTA TGGGTAGGCGGTCAACCTTTGTTATCTATATGGATCGGTGATCAATGGAC AAACACTTGCCCTGCACCTTTGGAAACAAACACCACAAGCAGTGGATCAG CCACACGCAACGAGGCCAATTCGACTATTAACTTCCGTTCAACTCGATTG ATTATATTTCTAtttgttaatattttggctTCATGTTTTGACGGGTGTAT TATAACATTGGTGGATGCTGGTGTTGTAAAAAGAATACGTGCATCCCCGA CTCCAAAAGAATTTGGTTGGAACCGTATGTTTGGAACCTTTGGTTTCTCC GCTGGTTCATTCCTTTCTGGTCTTGTTTCTGACATGTTTCCGTATACGGA ACATGTGAATTGTTTCACTGGAGCTTATGTTGTTTTGAGTTGTTTTTTAT TGG

Coding sequence (CDS) from alignment at sc0000001:214162..214864

>TCONS_00000278 ID=TCONS_00000278|Name=TCONS_00000278|organism=Clytia hemisphaerica|type=CDS|length=702bp|location=Sequence derived from alignment at sc0000001:214162..214864 (Clytia hemisphaerica)
TCAGTCAGTAATGACCCTCACCCAACGTTACTTGGTCAATTGACGACAGC
TTTCATGATCGATTGGTACATGTTCCCTGCCAAAATTACTTACTTTCTCG
CAAATGGCATAGATGGCGCTTTCAAACCTTATGCATTATCCTTCCTTGTC
GGCGTCGGATTGAACAAAGCAGAAGCAGGTCTGGTGACAGGTCTTCGTCT
TCTTGGGATGACTTTTGCTGGTCCTTTATGGGGCTTCATTACTGACAAAC
GACAAAATCATGTTCTGATTCTCATACTCATGGCTTTAATGTCAATACTA
TGGGTAGGCGGTCAACCTTTGTTATCTATATGGATCGGTGATCAATGGAC
AAACACTTGCCCTGCACCTTTGGAAACAAACACCACAAGCAGTGGATCAG
CCACACGCAACGAGGCCAATTCGACTATTAACTTCCGTTCAACTCGATTG
ATTATATTTCTAtttgttaatattttggctTCATGTTTTGACGGGTGTAT
TATAACATTGGTGGATGCTGGTGTTGTAAAAAGAATACGTGCATCCCCGA
CTCCAAAAGAATTTGGTTGGAACCGTATGTTTGGAACCTTTGGTTTCTCC
GCTGGTTCATTCCTTTCTGGTCTTGTTTCTGACATGTTTCCGTATACGGA
ACATGTGAATTGTTTCACTGGAGCTTATGTTGTTTTGAGTTGTTTTTTAT
TG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000153XLOC_000153Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000278-exon-sc0000001-1491911889:214162..214864TCONS_00000278-exon-sc0000001-1491911889:214162..214864Clytia hemisphaericaexon
TCONS_00000278-exon-sc0000001-1510915933:214162..214864TCONS_00000278-exon-sc0000001-1510915933:214162..214864Clytia hemisphaericaexon
TCONS_00000278-exon-sc0000001-1575043694:214162..214864TCONS_00000278-exon-sc0000001-1575043694:214162..214864Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000278-proteinTCONS_00000278-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:214162..214864 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.28357 0.291993 0.562021 0.34585 1.96695 1.6434 2.15573 2.55915 0.894151 1.16849 0.540963 0.229486 0.583845 1.6077 0.337126 0.519776 0.651477 0.539675 2.40448 1.29838 0.441069 0.20317 0.0986263 0.429465 0 0 0.170019 0.105096 0.275161 0.257679
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR024989MFS_assoc_dom
IPR020846MFS_dom
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000278 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top