Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000269 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000269
Unique NameTCONS_00000269
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2960

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000269 ID=TCONS_00000269|Name=TCONS_00000269|organism=Clytia hemisphaerica|type=transcript|length=2960bp
AAAATAATAAATCGAGAGGGAATATctctttaaatattttcatttggatG
CATGTTGTTATAGCTTATGTTTTGACCGTATGGAGGGTATACACATAACT
TTCTAGTGGTGTTAGTATGGAAATTCTATGAAAATCAAGCTtctaaattt
cattattttgaagTAGAGACGGAACTCTTTTTAATTTGTATCAGTTGGAA
ATTTTTTCGCAAagacaagaaattcaaaaaaagttatttaagttgacata
aacaaaaaaacattatgGTTCTTAAGTCAAAGAAAGGTGCAACGACAGTC
ACAAAAAACGGACGTAAATTAACTAAATCACGTAAAAAGGAGAGCACATT
AGAACCCAGTGCCCCACCTAAAGAAGAAGTtgtggatgatgaagaaaaag
tTGTTCTACCGCCACTCTCTAATAACAGCAACGACTTAGTTGGTACAAAT
CGAGGGTCCGCAGACCGCGATAGTCTCTTAGACGAGGAGAATTTTACACC
TAGGAGTATGGAAATTGAAGGGCAGGGCGGCGCTGGGAAGCCGGCGCGAA
GTTATGAAGAGGCGCTCTCGAGTGACAGGCGTGCTGATGAGGGAATGAAT
TCACCGCCACCCAGTGGCGTGTTGAATAAAgGTATTCTCACCCGCAGAAA
TATAAACGACCGTACATACGACCGTACATACGACCGATTCACCGATCCCT
TTTACGCGAAAGCGCCACGCCGTAATTTGAGCCGTCTTTCAAACATATCT
TACGAACGTGGCTACCCGGATGCAGCTACGTACAACGGGCGTTACGCCTC
TCATGCTAACCCGTACGCTCGTAAAGAACAATTCGCCGATAAGAAGGTCC
AGTTCTTCCGTAGCCACAGTTCAACACAAGAGCTTACACTTGTTATTTCG
GCGACACGTCATGGTACACTGGCTGACGTCAGGGACGACGTATGTGAGAC
GTTTTTTCGACGTGGTATTTTCTTGGGTGAAGAACGGTATATCCATACAG
CTCACGGGAACATTTTAAAGAACATCTATGAATTCGAGCATGGcgggaaa
tatttttttggaccAGCACACATCTTTGATATGAACGAATATGATCAATT
CAGTAAAACTAACAGCCCTGCTCAAAGTGCTTCTGGAAGTAACAAAGGTA
GCGCTAGTAAAGGTGTTCTTTCAGAAGATAGCCTTAAGAGTAATGGTGGT
CGCAGCTCTGTCAGTGGAGTGAACGAGTCATCAAAATCTCAGAACGGGGG
TCCAAGTTCCAAGAGTGGAGGAGCCAGTTTCCAGAACGGTGGTCCAAGCT
CAATGAATGGAGGGTCCCGTCTCAAAAATGGAGGGGCCAGTTCCCTTAAT
AAAAGTCAGAACGGTTCAGCTCCAAGCCAAGGCGAATCAAAGCAATCATA
CGCCCAAAGCGGTAGTGGGCGTACCAATAAAATCAGCTCTCGACTCTCTA
ACCTCACAATAAATGATGTGCGCTCTAACCGCTCAAATAGCCAAACGAGT
GGATCTGGTGGTCCAACGGGCGTGTCACGGGTGTCTCAACGACGTCGCTG
TAATATCAAAATCACAGTAGACCATAACCCGGAAACCTTATGCTCGTTTA
CTGTGGATGAATCGAGACATCGTAATATTGCACAATTGATGTCAGATCTT
TCATTCCAATTACATCTGAGAACTAATCAAATCACAAAGATTTTCACCAT
GTCTGGGAGACTGatcaATCGTGTCGATGAACTGTTCCTAGGCGACCATT
TCAATGCGATGACGTCATCTTTCACTGGCAATGGTTATGGTCACATACCT
TATGCGCATGTACGAGATCCTATCAACAGATATACCGATTACCATAATCC
GTACCAAGTCACCGTGGAAGCAGCAGGAACGTCACACGTTTTCGAACTTC
CGTCACAAGAATACGATCAAATTTATAGACGGGGTGCCGAGCTTTACAAC
GATCTACAATTGGATTGGGTTTACGGCTACAATGGTCGAAATTGTCGTAA
TAATATCGTGTTGTTACCAAGTGAAGAACTGTTGTATTTCGTTGCTAAGG
TTGTTGTCATTTTCAACGATCAACAACAGACACAACGATTCTACGCAGAG
CACACAGATGAAATCCGATCAATTGCTCAACATCCTTCAAACTTATGGCA
AATCGCCACTGGTCAAGTATCGGGAGGTGATAGCGGGGATATGGCACATG
TCCGTATTTGGGATTCCAAAATCTTGCACACTCTCAATGTATTGGAATTT
GACTCGATGAATTTGTCTGTGGAATGCCTTGATTTCTGCAGTAGCAATAA
CGGTGAACGCTTAGCAACGGTTGCTAACGGTAACGGAGAATGGTATCTAA
CCGTTTGGGACTGGGAAGAAGGGATTAAACTCTCACACAGTGAACCTTAC
GAAGACCATTATGCTGAACTCGACATCCAATTCGATCCGTTCGATAGCAC
ATCCGTCGTCACCTGCGGTAAAGAGCACGTCTTCTTTTGGGACGTCTCTC
AACCAGACGCCGTCTACCGTGTCGGGTTTTTCGAGGATTACTCGACGCCC
GAATACGTAACGTGCTGCAGTTTCAACCACGACGGACGTCTCATTACTGG
TGACTCAAATGGTTACATCCACGTTTGGGATACGCATTTGAAGCGTACCC
TATCAACCGTACCAACAAACCATACTGGTAGTATCATTACCTTACGCGTG
CTCTCTGATTTCCATGTTGTCACTGGCGGCGGAGCCGACCGTAAACTCAC
CCTTGTCAGTCTTATTGACAGCGTACCAACTAAAGCAGAGTTTGAACTAC
CGGAGCACGTGGGCGGTGTGGTTTCCATTGTGCCGCTTTTCGGTGGGTTC
AGCGGTGGCgataaagattttgatttcttgaGATTAGTTGTTGGTACAAG
TTGTAATTCTATCTTGGCAGGTTCGATGACTGAAGCTTTCGAATGTATTG
TGAAAGGTAT
Run BLAST on NCBI

transcript from alignment at sc0000001:2611662..2625905-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000269 ID=TCONS_00000269|Name=TCONS_00000269|organism=Clytia hemisphaerica|type=transcript|length=14244bp|location=Sequence derived from alignment at sc0000001:2611662..2625905- (Clytia hemisphaerica)
AAAATAATAAATCGAGAGGGAATATCTCTTTAAATATTTTCATTTGGATG CATGTTGTTATAGCTTATGTTTTGACCGTATGGAGGGTATACACATAACT TTCTAGTGGTGTTAGTATGGAAATTCTATGAAAATCAAGCTTCTAAATTT CATTATTTTGAAGTAGAGACGGAACTCTTTTTAATTTGTATCAGTTGGAA ATTTTTTCGCAAAGACAAGAAATTCAAAAAAAGTTATTTAAGTTGACATA AACAAAAAAACATTATGGTTCTTAAGTCAAAGAAAGGTGCAACGACAGTC ACAAAAAACGGACGTAAATTAACTAAATCACGTAAAAAGGAGAGCACATT AGAACCCAGTGCCCCACCTAAAGAAGAAGTTGTGGATGATGAAGAAAAAG TTGTTCTACCGCCACTCTCTAATAACAGCAACGACTTAGTTGGTACAAAT CGAGGGTCCGCAGACCGCGATAGTCTCTTAGACGAGGAGAATTTTACACC TAGGAGTATGGAAATTGAAGGGCAGGGCGGCGCTGGGAAGCCGGCGCGAA GTTATGAAGAGGCGCTCTCGAGTGACAGGCGTGCTGATGAGGGAATGAAT TCACCGCCACCCAGTGGCGTGTTGAATAAAGTAAGTTTTGATGATCTTGA TCAAGATTGGGCCCATTCCACTTTTTTGCAAAATAAAAGTTTTTTTCTTT GCGCCTCCTTAGACTTAGGCGATGCTATCGTCCGTTTAAAGGTCAGTAAA CGCGGGAAAGAGTTAAGGCGTCAGGGCGGTTTACGGGAAAAAAAGTGGCG GTAGAGTTTTGTAACAAACACTGTAAACATCTCTGCCATTGCTTACTCCA CCCAAATTTATCACGTCTCTCCTAAACTATTCCCTTTTTTAGTGATCTTG TGTAGACGATAGGATCGTCTACCTTAGACTCTATATTTATTCCTCCCCCC CCCAACTTTCAAATTCAAGGCGTGGGCCCCATGAGTTTAGAGTTCTTTTA TCTCAAGGGACGATGATTTGTTTTCCATTCTGAAAATTTTAACTACCAAA ACTAAACATATACATCCTGAACTTTTTTATAGTTCTTAAGCTTAACTTTA AGGTTTGTATGATCAAATTGGAAAGTTTGTAAGAAATGTCTATGAATGTC AGTGTACACGTTTTTTTATAAGAACTTCTATATAAGAACATAAGGCTTTG ATAGCCACCATATTTCTTAGGAAAATGGTCACAAAATGGTCAAAATAAGA TCATGTTAAGAATATTTTCAGGCTTGAAACTGAGAAAGTTAAGAACATCC GAAGGTTTAAGAAATTTTGGATGTTCTAATAAAATAAACGTGTATAGAAA GAGTTCATATTATACTGTTTTTTTATCGACGTTGAATAAAATACAGTAGA TCAAAATCAGTAATGAGATGACAGGGGTCGTGGCTGATTTTTGGGGCGTG GCAAGACAAGAGGGTTATTACTTAGACTGTGACAAATTCTTGGACTATAG CATAATCTACCTCACAAGTATGGGTCAAGCCACTACGCTATTGATCAAAA GTTTCACGAATTAATTGACAAAATTGAGCCGTACGAAAGGTTTTGACTTT AGATTGTGACGATGTCTTGAATTCTGGAAGCATTCTTATGTTTTGGAATT CGTATAGTACAGTACAGAAATCGACCATACTCGCTTAAAAGTCTTCTAGA TAGTTTTTCGAGAGCTTTCAGATTCTATAATTGGTTTTGGCCTAAAATGA GTTTAAAATTTCCATAAAAATTTAGCCCTTGGACTTAGCCTAGGTTTTCA ATAAATGGGTCCAAAAATAAGGTCAACCCTTAAAATTTTTCTGGGCCGCC CTTCTAATATCGATCCATAGGATATTAGGCATGTCTGGTCCAAATTTGGT GCTTTGTTCCAAAGTTGCACGATAAATACACCAATCAGGCCTACTAAGTT TATCTATTGGACTTTTATATTTGTTTTTAAACCTTTTTGGATTTTTTGAA TAACTCTAATTAGATTTGACTGCGAACTCGGTTTAAACAGTTGAAATCTT TTTTCTTTCTTTCTAGGGTATTCTCACCCGCAGAAATATAAACGACCGTA CATACGACCGTACATACGACCGATTCACCGATCCCTTTTACGCGAAAGCG CCACGCCGTAATTTGAGCCGTCTTTCAAACATATCTTACGAACGTGGCTA CCCGGATGCAGCTACGTACAACGGGCGTTACGCCTCTCATGCTAACCCGT ACGCTCGTAAAGAACAATTCGCCGATAAGAAGGTCCAGTTCTTCCGTAGC CACAGTTCAACACAAGAGCTTACACTTGTTATTTCGGCGACACGTCATGG TACACTGGCTGACGTCAGGGACGACGTATGTGAGACGTTTTTTCGACGTG GTATTTTCTTGGGTGAAGAACGGTATATCCATACAGCTCACGGTACGTTT TTAATTTCAAGAGATAATCAAATAGTTTGAGATACATGACTTGTAGATTC CTTTTCAGGGTCGGATACAGGAGGTAGGCTATCTTATTCATGGAGAGTAA TTAGTTTCCATATAAGGTAATACGATAATAAAGTACACTCTCCTCCATTG GTTATAGCCTCCCTCTGTATCCGAGCCTGCTTCTAAAAGGAAAGCAAAAC TTTCAAATCTTTTTTGCTCAACTCTTATCCAAAGTCGAGATATCAAGTTG CAAGTTTTATGACTCCTAGCTATAAAACAACAGAATTTCAATGTAAAAAC CGTGTCAAAACCCATTTTTCGAGATAAAGAATTATCACAACTCAACTTTA AAGAAAAGAGTTGAAGGCCTCTGGCCGATGGATGAATTTACTGGCAAAAG ATCTCAAAACTATCTGAATATCTCCTTAATACTAGACGATGTTGATCGGA CAGAATCGAACCATAAGATCGATTGAACCAAATCGATTACCTAAAACTCG ATTGTCAAATGCAAGCCGAAACTTTCTGATTCGATTTGATCGGTCGAACT AATTGAATTTTATCGAGAGTTTTTTCACCGTTCGATCTAGTTCGATTGAT GATGATTGAATTTCCATTCGAATTTTAATTTTAAATTAAAAACCATCATT TTAACTAGAATCTTCTTGCATCGGAGACCTTACAAGCTCTTCTAATTCTA TAATATCTGCCAAAAGAAATGGAATTGTGCTACTTCTGTCAGCCTCCCCA ATATTTTCCCCCTTCGTCGGGGAAAATTTTCGTCGGGGAAAAATATTCGT CACTTGCTGGTAGTTGGTAAACGCATTAAGGCCGGGGAAAAATTTCGTCG GGGAAACGACGAGGAAACGAAGTTTTCCCCGATAAGGTAACAAACAAAAT AAGATCATAAGGCTGCCATGGTCAAAATACTAAGATCAAGTCAAGAACAT TTTTAGGCTTTGCGGACTCTGGAACACCTGACTTTAGGAAAATGAACAAT GAAAATAAGAACATATCAAAGGAAGAACATTTTTAGGGTTAAAATTAAAA AAGTTATGAACATCCGTAGGCTTTAAAATACTGGACGCTCTTGCTTAAAA GAAATATGTATCCCATTCCTCAAGAGAATTTTCATTTGAATTAAGTGTTT AATTCCATGGGAAAATGAATATAATAAAATGGATTGTTGATTTTAATATG CTTATGAAAGTTGCTAGCCTCGTTCAAAACTTCCACCTTTTTTAGTCGAT TTCAGGTAATTAATTCTTTTTGGTCCCGGTTGGGGATAATAGGCTAGGCG AGATGACGGGTATGTCCGAGCCAAAGTTCGAAAATCGACCCTTAGGGACT GAATTTCGAAAATACTGTCCATGTTTTGACGTTTTTGCCACCCTTAGAGA GACCATTTCCCCAAAATCTTTTTGTACCCCTTTGGGGGACTTTCGAGAGA GTGAAAAGGGGCCCTTATGGCTCCCCCATCCCCGGCCCCCCCCCCCCCCC CGGGGGGGGGGGGAAAAAAAAATTTTTAAAAAAAAAAAAATTTTTTTTTT TTTAAAAATTTTTTTTTCCCCCCCCCCCCGGGGGGGGGGGGAAAAAAAAA TTTTTAAAAAAAAAAAAATTTTTTTTTTTTTAAAAATTTTTTTTTCCCCC CCCCCCCGGGGGTTATTCGTACAAGAGATTTCGTAAGTAAGTGATAGCTT TTTGATGTCGAGTTTTTCGATTAAATTTTACAGTGTTTTGGAGAAAAAAA TGAATATACTATTTCATAAAAATCTCATATTATCATACTGATTTACGCTC TCTTTTTAAGAAAAACAATTTCATAAGAACAATGAGGCTCAAAAATTCTA AAAAAATGAGATGCCTGCTTGCGATTGCTTAATTTCAAGCAATTTAACAT TAATAAGAATCAGGTATGAAGCCTAAAATTAGAACTAGATTAATTTGAGG CAAGCTTAAAGTTCCAAAAAAATAAGAACAGCCGAGCCTCGACAAAAAGT TTACTGATTCTTATAACAAAGAGCAGAGTAAGTAACTTTAGAAAATCTTT NCGAGCCTCGAGAAGAGTTTACTGGTTCTTATAACAAAGAGCAGAGTACG TAACTTTAGAAAATCTTCAAATATAACATGCAATACTGTATTTAACAAAC AGTAAAATGATACTATCCTCTTTAATATCATGATTAAGAAATCAAATCTC TAAAGTTTTGTATTTCTTTGACAATCTTTAAGATTATTTTTCTGACATTT CAATACTGCCATTCACTTTGTTGTGTTTATCTCGTGTACAAAACAAATAA AAACTGGTTGCCATGGAGATTACAGAAATCACGCTTAACGTAATAACAAC GTATAACAGTATTTCCGTATTACCGCACGACGTCGACTTCAAAGGTTCTT TTCGTGCCTTTCCACCAACCCAAGCATCAAAACTCCCATCTTCCATTTCA AACGAATTGCATTGTGGTAATGATTTGGGTGGCTGTTGCATGTCGGGAAA TGATTCATTAAATACCAACATCATGCCTTCTGTTATATGAAACATGGTGT GACAATGCATCAACCAAAACCCAGGGTTATCACTGCGAAACCGGACCACA ACGTATCCGGATGAAGGGACAATTACCGTATCCTTTACCGGTGGTTGATC AAAATTCAATCGTTGGGTCATATCATCTTTCCAGTGTTGTCGGCTACATG GTTTATTATCACAAATTATATCTTGATTTAAGTCGGCTATAAGATTCGTC TGGTTGTCCATTACACCAAAACCTTGTTTCAAAACATGGAAACTGTGACC GTGTAAATGCACCGGGTGATGTCCCATACTGGTGTAATTTTTGCCAGGAT CATTCGTAGTCGTGTAGGACATTAAGATCAATTGGATGATTTTGTTTTTG GGAAGTTGGAGAACATTTGTACATCTGCAACCGTCATCAAAGCATTCTTC AACACATGGTGTAAGTTCAGTTCGGGAATCATAAACCGGTGATGATTTTG GGAAAATAAATCGATGCATGTTGATACTTGAACCGGTAGCGAAAGCAAAA TTCAGGAATAATTCATGAATATCTGCGGTTGGGGATAGGATCTCTTCGTC GGTGTTTTGTTCATCATTGCTGAGGTTGTCGCCATCTGATCTAAGTTGAT CCACAGTGATACATTCAGTGTGCGGGTACTCTTTTGCTGGGTAGGCTCTC CAGGGGCAGTTCAGTACGCGACAGGGTTCTGCTGAAGTGCAGTTTCGAGG AAGGCTTGTTGGGTCTGTTCGGTTATTAGCACCTTCGTAATGAAACACTG CAAACACTTGAGCTTTTGGTATCATTTTATCCTCTTTTCGAACAAATGGT CCTTGATAGAAAAAATAATTTCAATATGATTTTTATGTATACAATTTACT CTCGCTTATTAGCACTCGAATGGAGAATTTTATTTGTTCGAATTACAAAA AGATTCGAATTAGAATTAAACTTCCATTTTGGAGTCTTTCGTATGACTCG GCAAGGGATTGAACCCACGACGTTGTGCTGCACTGTAGCCGAAGGCTCTG TCTTAAATTCTTGATATTCGTGACGCAATCTTTTTACGGAAACAACAAAA AAAACACCGGAAGTTTGCCACCAGTTTTGAATTTAAACAATGAAACTGAT GGTAAACGCCCGATGTTTTTTCGGGTGTTTCCGTATAAAAGATTACGTCA TGAGTATCAAGAATACACTACGGTTCTTATAACAGGACACTCAGAAAATT TAAAACAAAACTTGTTTCTCACCTTCACCGTCTTTCAGTGTTTCTGCTCT GATCCAATATGATTGTATAGGTTGGTCAGCCTCCACCTCAATTACGTATG TTTCACCACCAAAGATGATAAGAGACTGGAGTCCAACTGGTTGCACAGGG AAACCATCTGACTCAATAACGGTNATAAGAGACTGGAGTCGAACTGGTTG CACAGGGAAACCATCTGACTCAATAACGGTCAATGAATGTTGATCAATAC TGATGCGATATGCGTATTCACTCAAAGCTCCTACGATATGAAATCGTATT GTCTGTCCTTTGGTCACATGGAAATAACTCAAGGGTGCTTGGTTATTATC ATACCGCCCACGCCCGTTGATCAGGCCGGAGACGTAGGTTAATGAGCTTA ACTTCACGCCATCAAAACTGTTGTCTTTGTCTAGATTATGTGAGTGGAAG ACTCCGGATCCCTTGTCGAACGTCGCGTACGGATTCAACGTTTCTAGTTC CGTTGAGGTTACGTGGTACCAATCAGATATTACGAAAATAGAGTATGGTA CGACGGGTGGTTTCCGGTGGATGATGACTCCGCCGTATACACCGTCCGCT TTTTGATTTGACGTGTGAGAATGATACCAATGAGTTCCGGCCGGGTTCGC GTAGAACCGGTATGTGAAGCTTTGTCCGGGGCTGATCGGACATTGAGTTA TATACGGGACGCCGTCACTATACATGGTTGACCTTTGATGCATGCCATGC CAGTGGATTGATAAGGATTGCTTTTGTAAGTTATTTACGACTTTCACAAC AACTTGTGCCCCTTCCATGACTTCGATGGTGGGACCTTTGTAACGACCAT TAATCATAATGAGAGTTCGTGGAACACCATCTAAAGGATTGGAATGTTGT GAAAGTTCTTCATGTGAAACATCGGGTACGGTTTTATGGTAATCGTTTGA TTTTAAATGCAATCGTGAACCATTTAAGACTACATCGTATACGTCCTGCC ATCCGGTTGCGTATTTAACAGCGTACATCATACTTCTCCCTTCACGGACC ATAAACTCATATCTTTGATAAAAAAAAGAAGAAAAATAAACAGAACATAA ACAGAAAACTTTCGGACAATTATATTTTGAAATTTTTTTTACCTGAAAAT GGAGGGAAAGTCTTTCATTAAGAAAAATCTAGACTGAATTAAGAGAAAAT TAAAATTGGCGGGAATATCTTTTGCCTTTAAAGTTTCCTGTATTAAATTA AGTTACCTGCATCTTTTCTCTTCGCACAATTCACCGTTCGTTAAACCCAA TGTTAAAGTCAGAAATACAAAGATGTGTATTGCAAACGCCATGACTTTCA TATGATGTATCAAAGGGAGTGTTTCTACGCCGATCATTTATAGAAGAGAT TTTAGATAATCTCTCATTAAATAACGCGTTTTTTGTTTAAATAACACACT GACTTTTCGAAAGATTTTTGAAAGATCGAGTTTCCATAAGATTCATTACA CTACACGCTTTTTTTATATAAGAATACACTTTATAAGAATGTCCATGAAA TGGCCAAAAAATTAAGAATATGGTAAGAATATCACCATCATGGAATTTAG CAACTGAACCTAAGAATGCCATTTTTAATGCATTTTAACCTGTAGATTGC CAATTTCAATCTTAACCTAAGAATACCGTAAGAATATTTTTGGATGATTT TCGCCAAAATCTTAAGAATATCCATGATGAAATGAAAAAACACCATTCTT ATAAAAAAAAGAATACCGTAAGAATATTTTTGGATGATTTTCGCCAAAAT CTTAAGAATATCCATGATGAAATGAAAAAACACCATTCTTATAAAAAAAA GAATACCGTAAGAATATTTTTGGATGATTTTCGCCAAAATCTTAAGAATA TCCATGATGAAATGAAAAAACACCATTCTTATAAAAAAAAAAGCGTGTAT AAGAAACTGCAATACGATACAGAAAGGATGACAGCCTCACCTATCTCCAA ATCTCTAAACAACGAAGATAAAAAGCCTTCATTTTGATTTCAAGATTTGA TTTTTATGTTTATTTATTCGGTACAGTCAGTCCGAATAAAAAAAGTGTAA ACCAGTTTCATACTTCATGACCAAAATAAACGGAAATGATAAATGGAAGA TTGTTTCATAAGAAAATGATGAATTGGTGACAAATATATTATATCAAAGA GGATGTTTACACATTTGATATATTCCTCAAGGAAGGACATTCTATATGGT AATTGAACCACAAAAAAGGGACAAGATAAGAAAGAGGCGTAGCCTATACA ATAGACAGCTCCTCCAGGCTTTTAGGCTTTACTCTCGGGTAGGAATTTTA CGCTCAAAACGAAGGAAGATATGGGGTCAAGCTGAGAGTTTTTACAAGTT CTTTGATGACTCTGTTGGTCGTTAAATGTTGAGACAAACGATTTTATTAC TTTTTCTAAAGAACGCGTCATCCCTATTGTTTAAAAATAACCAATCAGTT AAGCATCTTGTAAAAACTCCAAGGCATCCCAATATATAACGTAGCCTAAA AGAGGCTTTATTTTTGCAAAAACTCAAATGAAAAACAAATAAGAATATAT AAGAACATTTTAAGATTTAAGAATATTTTAAGTCTTGAAATCATGAGAAA TAAGAACAGCAGATTCTCAGCCTACATTTGACGTTTGAAACGAACCATGC CAGCTGGCACACAACGTTGTTTCAACGTTTATTTAACGTTCACAACGTCC ATATAACGTTAGATGAACGTTGAAACAACGTTGTGTGCCAGCTGGGATAT AGGTTAGAAGATCGTTATCGGAGTACGTAGTCCTAATAACCCATACACCC CTGTGTCACAGACCCGCTGGAACCCCAGCCCCACTGGAAAATTTGGCAAA CATTTCCTCCTCGGTGGGAAAATATACCCTGGAATTTCAGCCCCACTGGG AATTCGAGATCCAAGTTTTTAAAATTTGCATACCAAAACCATCCCCACTG GATTTTTTAACCTTGGAACCATAAAGTTTCTATCCCATTGAGATTTAAAT AGGAATTTTTATCCCCATTTAATTGCATTATGCATTTCTTTGTGGAGTCC GTATAGAGCTAAACCCGAATCTTTTAACACTTTCACAGGAAAGCAAAAAA ATGTGACTTGCCTAGTCAAGACATGCACCACATTTTCATGATCTAGTTCA TTCTTTGTTTTCGGGAATTGCGTTTCTCTTAATCTGACCGCCACGTTAAA ACCATGCTTATAAAGGTTTTTCGAGTTGACTAAATTACCTAACTTCCGCA ATTATAAAAGTAAACGTTGAAATTTTCAGATTTTTGTAATCGTTAGAGAG ACTTTTGAAGGTGTAAAAAAACCGACCCTTATCGTCCGCACATACCCCAG CACTCATTTCGATTTCAAAGGGGCCAAGTCGCCTCTACAAATGTAAATGT TTGCTCCTCCATTCAGGTAAGTTTTCAATTAGGTATATAAATATATTCTT TCGTTTTTCCAGGGAACATTTTAAAGAACATCTATGAATTCGAGCATGGC GGGAAATATTTTTTTGGACCAGCACACATCTTTGATATGAACGAATATGA TCAATTCAGTAAAACTAACAGCCCTGCTCAAAGTGCTTCTGGAAGTAACA AAGGTTTGTTCTTTTTCCTCCGTATAAGCCAGAGTAATTAAGTTGAAGCT CCATTAGCGCGGTGTCAGAGGAGATAGAAGGGAGACGCTCCTCTGATTTT TTTACATCCTAAAATCAGCAATTATTGTGCTTTGACTTCCCAGCTTATTC CAGTTTTTGTTGTACCCCCATGATACTGGTGACTTACAGTACTTACAGTA GTTTCATTGCCCATTAGCTTATGAACTTTTATTTACCTCAATTCTTGTTT TCAATTGTTTCTGTAGTACTCCTTACCTCCCTAAGTATCAAATTTGTAAA GAATACCACCTTTCTTCCCACAATTCAACTCTTACTTTTTTGTTCTGTAT TACTTTTAGGTAGCGCTAGTAAAGGTGTTCTTTCAGAAGATAGCCTTAAG AGTAATGGTGGTCGCAGCTCTGTCAGTGGAGTGAACGAGTCATCAAAATC TCAGAACGGGGGTCCAAGTTCCAAGAGTGGAGGAGCCAGTTTCCAGAACG GTGGTCCAAGCTCAATGAATGGAGGGTCCCGTCTCAAAAATGGAGGGGCC AGTTCCCTTAATAAAAGTCAGAACGGTTCAGCTCCAAGCCAAGGCGAATC AAAGCAATCATACGCCCAAAGCGGTAGTGGGCGTACCAATAAAATCAGCT CTCGACTCTCTAACCTCACAATAAATGATGTGCGCTCTAACCGCTCAAAT AGCCAAACGAGTGGATCTGGTGGTCCAACGGGCGTGTCACGGGTGTCTCA ACGACGTCGCTGTAATATCAAAATCACAGTAGACCATAACCCGGAAACCT TATGCTCGTTTACTGTGGATGAATCGAGACATCGTAATATTGCACAATTG ATGTCAGATCTTTCATTCCAATTACATCTGAGAACTAATCAAATCACAAA GATTTTCACCATGTCTGGGAGACTGGTAAGTTTGGTTTGGAGCCTTACTA ACCAGTCCCCCAACCTCGTCCCCGTGTATCCCAGGCTTTATTTACGTTAC TGATGGACGTCAGAGAATTATCTGGCGCTCTCAGTAAGCATCAAAAAGCC GATAATACGTAGGGAACGAAGATTCCAGTCCCCTTATTTATGATATGCCT CAATGTAGAGTCTTATAAGAATTTTCCCAAGATTTTTAACCTTCAATTTA TTGAAGTGAGAGGTTGTTGAAGAAAATTTCTAGTAATTTAAGACATTATT ACAAATCAATATTAACACTCCTGATAATTGGTGCNTTACAACTTATCAAG TTTTAATTGCTAGCAAACTCGTAAAAAAGTTTGATAACCTAACGAGGAGT GTTTTCTATGAGTTCTTAATCCACCTATTCTAATCCGTTGGTGCAAACCA CCAAAAGTTCTTTTTAGGACTATTTTAACACTAACCATTTTTCAACGTTA ATCTGCAGAAAAATCAAAGATGGTGTAGCTTTGGGTACTAGTTAGAGTTA AGAGATGTGGACTGAACTTTATAACTTCAGACTTACGATTCAATCTTGTC ATTAAAAGGGAACTCGAGAAAACTTTTCATTTTCATTTTTCAGACCTCGC AACTTTTCTGTATGTTTTATGATGATTTTTCATAATTTCCACAAAATTAA AACTAAAATTTTATTTTTATTTTTTTCAGATCAATCGTGTCGATGAACTG TTCCTAGGCGACCATTTCAATGCGATGACGTCATCTTTCACTGGCAATGG TTATGGTCACATACCTTATGCGCATGTACGAGATCCTATCAACAGATATA CCGATTGTAAGTAGAACATTTTCGCGTTTTTTTTGAAAAACTATAATCCT TCTGATGAGTATAAACCAGGGGAAGAAGTTCTATTGGTTACATTCAAGTG TTACGTCACTTCTAACCAATAGAATGGCTTCATTCCGTTTTTTAAAAAGA TAACTTCAGATCTAAAAAAACAGAATTTTATTTTCGGTTATTAGGAATTA GGCACAAATGTCATTCAGGTTTTAAGGTTTATGTTTAGTGAAAACCCACA CTGGGCGAAATAAGAGATTTCCAATCCTGGAAATATCTTGAAAATATGAT TTTTCCATATACTTTTGTAAATATGGAAATATGACTGTTCTATATTTCCA AAGTTGTGGAAATATCATATTTCATGATATTTCCATTTCTGAAATTCATT GAAACATCATATTTTCAAGATATTTCCAATTTTTGGAAATATCATATTTC ATGATATTTCCATTTCTGAAATTCATTGAAACATCATATTTTCAAGATAT TTCCAATTTTTGGAAATATCATATTTCCAAAAGTTGGAAATATTTTGAAA ATATGATATTTCAGTTTTGGAAATATCATGAAATATGGTATTTCCACAAT TTTGGAAATATAGAAAGGTCATATTTCCATATTTACAAAAGTATATGGAA ATATTATATTTTCAGGATATTTCCAGGAATGGAAATCTCTTATTTCGCCC AGTGCCATGACAGCAATTTGCGTTGATGCATTTATTTAACTCGTTCTAAG GAAATCTAGATAGTAGGGTAGTTCTAGAAAGACACTTCCACTGCAAAGCA ATTTTTTAAAGGTCTTGGGGAAAAGTTTTATTTTGGAGACTTTTGAGCTA AAAAGGTTTGAGTATAGTTTTTTAAAGAGAAAATTAAATTTTACGATCGA TTATTATTTTCAGACCATAATCCGTACCAAGTCACCGTGGAAGCAGCAGG AACGTCACACGTTTTCGAACTTCCGTCACAAGAATACGATCAAATTTATA GACGGGGTGCCGAGCTTTACAACGATCTACAATTGGATTGGGTTTACGGC TACAATGGTCGAAATTGTCGTAATAATATCGTGTTGTTACCAAGTGAAGA ACTGTTGTATTTCGTTGCTAAGGTAAAGTTTACCCTCTCTTCATGAGTGA CACTGTCAAAATTAGGAATATAGTATTGTCCTTGTTTTGTACGCTGTTCC AATGAAGTCAATGAAATATTGGATTCTAAGCAAAATTAGTAAGTAAGAGC ATCATGCAGAGAGGCATCAAGTACTATTTTTTGGGAATCTTTGGTATGAC CCGGCTGACCACAACCTTGCACACCGTAGCTGGATGCTCTACCTTCATGC TACGATCGCTAAACTAGTCGTTGCCCGTGGTAAATTGTTAAATACCAGAA TTAACAGAATTTAATTTTGTAGCCATATCTACATGAAAGTAAGCCCCAAT TGATGGTATGTAAAACATTTATTCTTCCAACTCTAGGTTGTTGTCATTTT CAACGATCAACAACAGACACAACGATTCTACGCAGAGCACACAGATGAAA TCCGATCAATTGCTCAACATCCTTCAAACTTATGGCAAATCGCCACTGGT CAAGTATCGGGAGGTGATAGCGGGGATATGGCACATGTCCGTATTTGGGA TTCCAAAATCTTGCACACTCTCAATGTATTGGAATTTGACTCGATGAATT TGTCTGTGGAATGCCTTGATTTCTGCAGTGTAAGTGTAGTTTTAAGTGAA ATCTTCTTTACACTGTTTTCGGTAGTTCTGTCGCTATACCTATTCTTCAA AAAAGCCCATGTTAAAAAAAACCGTTGTACAAAAGAAATCGAAAATAGTT TCTTGTTAGCTTGTGCACGAGTTGTGCTTATTCTTATTTATATTATAACG TGACAGCTTTATTTGAGGCCATACTGTAGAATCTAATTTTATCGTATTCC CATTGCATCGTATTTGTAATTTTCAGAGCAATAACGGTGAACGCTTAGCA ACGGTTGCTAACGGTAACGGAGAATGGTATCTAACCGTTTGGGACTGGGA AGAAGGGATTAAACTCTCACACAGTGAACCTTACGAAGACCATTATGCTG AACTCGACATCCAATTCGATCCGTTCGATAGCACATCCGTCGTCACCTGC GGTAAAGAGCACGTCTTCTTTTGGGACGTCTCTCAACCAGACGCCGTCTA CCGTGTCGGGTTTTTCGAGGATTACTCGACGCCCGAATACGTAACGTGCT GCAGTTTCAACCACGACGGACGTCTCATTACTGGTGACTCAAATGGTTAC ATCCACGTTTGGGATACGCATTTGAAGCGTACCCTATCAACCGTACCAAC AAACCATACTGGTAGTATCATTACCTTACGCGTGCTCTCTGATTTCCATG TTGTCACTGGCGGCGGAGCCGACCGTAAACTCACCCTTGTCAGTCTTATT GACAGCGTACCAACTAAAGCAGAGTTTGAACTACCGGAGCACGTGGGCGG TGTGGTTTCCATTGTGCCGCTTTTCGGTGGGTTCAGCGGTGGCGATAAAG ATTTTGATTTCTTGAGATTAGTTGTTGGTACAAGTTGTAATTCTATCTTG GCAGGTTCGATGACTGAAGCTTTCGAATGTATTGTGAAAGGTAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000145XLOC_000145Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000269-exon-sc0000001-1575043694:2625276..2625905TCONS_00000269-exon-sc0000001-1575043694:2625276..2625905Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1575043694:2623464..2623839TCONS_00000269-exon-sc0000001-1575043694:2623464..2623839Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1575043694:2616053..2616193TCONS_00000269-exon-sc0000001-1575043694:2616053..2616193Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1575043694:2615131..2615696TCONS_00000269-exon-sc0000001-1575043694:2615131..2615696Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1575043694:2614300..2614426TCONS_00000269-exon-sc0000001-1575043694:2614300..2614426Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1575043694:2613184..2613392TCONS_00000269-exon-sc0000001-1575043694:2613184..2613392Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1575043694:2612577..2612819TCONS_00000269-exon-sc0000001-1575043694:2612577..2612819Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1575043694:2611662..2612329TCONS_00000269-exon-sc0000001-1575043694:2611662..2612329Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1510915933:2625276..2625905TCONS_00000269-exon-sc0000001-1510915933:2625276..2625905Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1510915933:2623464..2623839TCONS_00000269-exon-sc0000001-1510915933:2623464..2623839Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1510915933:2616053..2616193TCONS_00000269-exon-sc0000001-1510915933:2616053..2616193Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1510915933:2615131..2615696TCONS_00000269-exon-sc0000001-1510915933:2615131..2615696Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1510915933:2614300..2614426TCONS_00000269-exon-sc0000001-1510915933:2614300..2614426Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1510915933:2613184..2613392TCONS_00000269-exon-sc0000001-1510915933:2613184..2613392Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1510915933:2612577..2612819TCONS_00000269-exon-sc0000001-1510915933:2612577..2612819Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1510915933:2611662..2612329TCONS_00000269-exon-sc0000001-1510915933:2611662..2612329Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1491911889:2625276..2625905TCONS_00000269-exon-sc0000001-1491911889:2625276..2625905Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1491911889:2623464..2623839TCONS_00000269-exon-sc0000001-1491911889:2623464..2623839Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1491911889:2616053..2616193TCONS_00000269-exon-sc0000001-1491911889:2616053..2616193Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1491911889:2615131..2615696TCONS_00000269-exon-sc0000001-1491911889:2615131..2615696Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1491911889:2614300..2614426TCONS_00000269-exon-sc0000001-1491911889:2614300..2614426Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1491911889:2613184..2613392TCONS_00000269-exon-sc0000001-1491911889:2613184..2613392Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1491911889:2612577..2612819TCONS_00000269-exon-sc0000001-1491911889:2612577..2612819Clytia hemisphaericaexon
TCONS_00000269-exon-sc0000001-1491911889:2611662..2612329TCONS_00000269-exon-sc0000001-1491911889:2611662..2612329Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2611662..2625905 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0782243 0.0553871 0.0519051 0.182238 0 0 0 0 1.62949 0.746244 1.11372 1.45267 19.6168 15.3949 6.59819 11.0078 3.98328 4.64231 36.9167 26.5333 15.6401 13.4557 3.3105 6.7139 7.42821 13.9231 2.07186 0.796687 0.0767545 0
Blast
BLAST of TCONS_00000269 vs. Swiss-Prot (Human)
Match: EMAL1 (Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens GN=EML1 PE=1 SV=3)

HSP 1 Score: 224.557 bits (571), Expect = 2.051e-61
Identity = 128/338 (37.87%), Postives = 191/338 (56.51%), Query Frame = 1
Query: 1954 LQLDWVYGYNGRNCRNNIVLLPSEELLYFVAKVVVIFNDQQQTQRFYAEHTDEIRSIAQHPSNLWQIATGQVSG--GDSGDMA-HVRIWDSKILHTLNVLEFDSMNLSVECLDFCSSNNGERLATVANGNGEWYLTVWDWEEGIKLSHSEPYEDHYAELDIQFDPFDSTSVVTCGKEHVFFWDVSQPDAVYRVGFFEDYSTPEYVTCCSFNHDGRLITGDSNGYIHVWDTHLKRTLSTVPTNHTGSIITLRVLSDFHVVTGGGADRKLTLVSLIDSVPTKAEFELPEHVGGVVSIVPLXXXXXXXXXXXXXLRLVVGTSCNSILAGSMTEAFECIVKG 2958
            L+L+WVYGY GR+CRNN+ LLP+ E +YF+A VVV++N ++Q QR YA H D+++ +A HP  +  IATGQV+G   D   +  HVRIWDS  L+TL+V+     + +V C+ F  SN G  L  V + N +  L+VWDW++  KL+  +   +  A     F P D+  +VTCGK H++FW +       + G FE    P++V C +F+ +G  ITGDS+G I VW     R    V   H G I  L +L D  +V+GGG DRK  L+S   +     + E+PE  G + ++    G             +++GT+ N +L G+++  F  I +G
Sbjct:  221 LKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRI-TIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSN-DHVLSVWDWQKEEKLADVKCSNE--AVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRK--LISWSGNYQKLRKTEIPEQFGPIRTVAEGKGDV-----------ILIGTTRNFVLQGTLSGDFTPITQG 541          
The following BLAST results are available for this feature:
BLAST of TCONS_00000269 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
EMAL12.051e-6137.87Echinoderm microtubule-associated protein-like 1 O... [more]
back to top