Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000262 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000262
Unique NameTCONS_00000262
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4132

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000262 ID=TCONS_00000262|Name=TCONS_00000262|organism=Clytia hemisphaerica|type=transcript|length=4132bp
gaaaaaaaagaaaaaagaattgacGGCTGACGCTTGCCCCAAAAATCTTG
GTGGTAAGGTGGTGAAACTTTGGTCGTTTTTGACTTTGAGACTTCTCGAC
TATCCCTTACGTGTGGCGCGTTAGACTTTCATAAGGAGAAGGAAGATAaa
agaataataattttttgGAATGGCGCCAATTTCACTAAAGAAAGGAGCAG
TTGACATACTTGCTGGTGAACTTATAATGCATATCCTACAAATCGAGAGA
aagagtgaaaatttcaagataTCAATGGAATATGTCATGTCAAATTTCAG
atTCAACAGATTTCTTGATGTGAATTCTTTGGATGTCTCAAGATCGTTAA
CTGGACTTTGTTCAAAGTTTAGAGTAAACTCCTTCGATAAAAAAGCAGAC
TATTTAGAAAAGAAAGTAGAAGAGTTTATAAATCTACCTCTTCTTGAAAT
CGATGAGAAAGATAACAGAGAAGTTCAGACAGATGCACATTATGCattat
tggcatttttgatGAAGCTCTCCAATAACCCTCTCAACTGTGAGTTTAAA
CCTAAAGAAGAACCAAAGCCTGTCAAagaggaaAATACATTTAATTGGAC
CAAATATCTTCTTTTGGGAGAAGAACCATTGGAAATTGGTGCCAACATTG
ACTCAGACCTAGAAGATGACCTTTATGATAGTGACAATGAAATCTGGCAA
CTTTCTGAAGATGAAGACAGTGCTGAAGATGATGAAGCTCAACATTTGTA
TGATGAGGTTTCTGAAAtacaaaaacaactaaaaaagtTTACTGAAGTCA
ATCAATATGTCGAGGAGAAAGATTGGTTAAGAGAAAAAGTGGTCCCAGCA
TATTGGATAGAGAGTGAAAAGTCAACTTTTCCTTTTCATGTACAAGGAAT
GAAATACATCAACTCTAACAATCAGATGTGCAATAATTGGGAACTTTACA
AGAATCAATTCACCAAAGTATCTAATGACCCTCAACTGCTGTCTGAAAAA
ATATTGGTCAGAGAAACAGTTTGGATGCTGTTAGGACTTGAAAATCTGCA
TGTTTATAAATTCACTGGAACTAAATATGATGTGAATGAAGACATTGTTA
TAACACATTTGACAAAGGAAACGCTGAGTAAATTCTTAACAAGTTTCACA
GAAGTTGGGACAAAAGTTGTGTTATTGAAACGTTTCACTGAACTTTGTGC
ACAGAAATATTCAGAAATACCGAAAACTATTCAAGCCTTTGGATACACTA
TATCCAAATACTTATCTaatcgAAGAGAAACTTTAATCGACCTAGAGAAA
ACGCTCATGGAAAAAGACAATGCGACAACCCTGTTAACTCTAAAAGATGA
TCTTGCTGATGATATCTCAAAGGTCAATTTCATCTACAAGATATACAACC
ATGCTGTTGTAGAGGGACATGAAAAGTATTTCACTGTGACAGAGcgagtt
gttcattttttggacgtattttatgattttgtttgtACTCTTGACAATAT
GGGTGATTCTGGTACTGAAAAGATGATGTTAGTGCTACCAATGTTTCTTG
AAGTCTGTCGACCGTACTTGGAAGATGTTGGGTGTTGGATGGCCACTGGG
CAGTTACCAAGAGATGAAGAATTTATGATTTACAGgacTCAAAATCAAGT
TCAAGGTGAAACGCGGTATTGGCATGAACTATTCTTAATAAGAGAAAATA
GATCCACTGATGGAAAATCAAGTAAACTTGTACCCAGATTCCTTGAGAAA
CTTCAAAAACAGattttaGTTTCTGGAAAGTCGCTTGGTCTTTTGGAAGA
ATTTGTCGAGTTCACCTCGACTGTCGTTGCTACCGACTCCTTATATGAAG
AATTTAAACGCAGTTTGAAAATCAACATCCAAAAATCGAACGAACGTTAC
CGCCACACCCATGCACTTGATAGTACCGATCATATACCTGGAGACGCCGT
ATCGGAATATATTTCTGACAGTGGTATCGATCCGTTGTTGAGAGCCAATT
TTCACATCATGTTTAATAATGTTTATCAAAGAATGAAAACGAACAAAGAA
CAAATCGCTGTCGAAAGTGGAAAAGAAGAGATTCAAGACCTTGCTATTCT
ACTAAGAGATTGTTCCTGTAGGCCACCAATGAAGCGAATTATTGATCAAA
GTTTATCACCTGTCGTTCTTGGTCGTTATGGAAAGGCTTGCGTGGTATTA
TTAGAACTTTTCaagaaagaaatgaagttcCTTGATCATCTAGCTGTAAT
GAAGAATTTCTTCTTGATGCAGGCTACTGGAGAAATGTATGAATTTTACA
CAGACATTTTTGAAAAGGCAAAGCATGGTCGATATTGGAGGGACATGTCT
TACTTAAACATTGTACTCCAAGATGCACTACAAGTCAACTATCCAAAACT
TATGGGAAATCTGACAGTGGATTATTATTCATCCAAAAACAATCTATCGA
ACGCTCAATTATTCGATGGTTTGTCACTACACTATAAGGTTCCTTGGCCA
GTGTCTATTGTTCTGGATCAACATGCTGAAGATAAATATAATGAAGTCTT
CCGATTCTTATTCAAAGTCAAACGAGCTATATGGGTTCTGGAGCAGCTCA
GATTTCAAGAACTCGTATACCAGGGCTCATATTCGCAAGACCATAGCGAT
TCTGAGGACGAAGGAATTGACTACAACACGACAACATCCACTACAAGGAG
AGGCTTAAAACAACACGTGCTGAAAGATATGATACTGAGTGGTGCCcatc
aaaaattgaagaatagGATATTAGTATTGAGAATGAAGATGTTACATGTT
GTACGAAGTTTCCATTTCTACCTCATGACAAGGATCGACGATAGTATCCA
TCAAGAGTTTCGTGTTGAATCGGCAAGAGATTTGGACGAGATTCTGGAGT
TCcatcaaaagtttttgttttctttgagaCAAAGATGCTTCTTACACGAA
AAGGTTGCTCGTACCAAAGATGCTCTCGTGCGAATTTTGAATCTTTCTTT
TGAGCTGGAAGAACTTTGGAGATCAAGCGTTGCTGTATTAAACGTGAACC
AACTGATGGCGTTAGAAAAAGAATTCTTCCGATGCACATCGTTTTTACAT
TCATTCTTTACAACTTTGTCCAAGAGAGGCTCCTTTCCACATTTTGAATT
TCTGGCAACAACGATGAAATTTGAGTCAAGGTGAAAGGAATACTTTATCA
ACTCGATTGGTAGATGTTTTTAGTGAGAAAAGTGGTGACAAAAGATGTTG
TTTTAACTCTCAGACAACGTTGTCTGAAAAGATGTCTTTGATAATAATAA
CTGTTTTCAACTAATCGAACGGTTTAATGGACGTTATGGACGCTGGTTTG
ATGGCATATAACGAACGGCGGGCGCTCTTGGTATTTTTGGCATATTTAAT
AGACGTTATGGACGTAAGATGGACGCTGGTTTGATAGTATATAACGAACG
GGGGGCGCTCGTGGTATATTTGCGTATTGAGGCTTGTGTACTGAAGAGAG
GGTAAACCACAATGTGTGCGTTTAATCCCAGACTTTTAcaggactgaaat
tccaaaggTTGGAAATATTGGTAATCCAAGAAAAAGTGCACGGCCATTGA
GCTCTATTTATCATTACAGGGCCGAAACGTTATTTCGCTGTGAAAGGCTA
CGAAAACGTGTCCAAAGACGTTACAATGAGTTTGTCTTTTcatcattagc
gagtttatgtatttgcgcttttgaggacggtaaagtgattgaagcaattt
agaataacccgcagttctgacccgcattATCGAGGACGGTAAAGGTGCTG
ATTCACTGTCGTCCTCAGATGGTCAGTTTCtaatcaaattagaaccttac
cgtctccgtcgcagaaaaacacacatacataaattCGGTATTAAAGGATG
CTGAAACGTCGTGTCGTTATGAAAGAACattgaagaaatcttttttgaga
AATCGTAAAAGTACAAAGACCACTTTTGTTAAATCGAATTCATTCTCATT
CGTTTTGTTTCAATAGCACACCGtggtgaatctaaaaatagacatcacTT
TCTTTATTTGCCCGAGTTTCAATCCCATCGTTCATTGCGTTAATTTCTTG
TGCACATTAATTACACTTATAACAAAGAAAAT
Run BLAST on NCBI

transcript from alignment at sc0000001:2492688..2532984-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000262 ID=TCONS_00000262|Name=TCONS_00000262|organism=Clytia hemisphaerica|type=transcript|length=40297bp|location=Sequence derived from alignment at sc0000001:2492688..2532984- (Clytia hemisphaerica)
GAAAAAAAAGAAAAAAGAATTGACGGCTGACGCTTGCCCCAAAAATCTTG GTGGTAAGGTGGTGAAACTTTGGTCGTTTTTGACTTTGAGACTTCTCGAC TATCCCTTACGTGTGGCGCGTTAGACTTTCATAAGGAGAAGGAAGGTATT TTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAGGATATTCAGAGAAAGCT TGTTATTGATCAGCCACCTACTGACATTTTCCATCTCCCTATTCACCAAG ATTTCTAGTTCCTTGAGATCACTGTGACGAGCCACCAGGCAAGTATCATC TGCAAATAAGGTATAGAGAAATGATTCTGTCGACTTGGGGATATCGTTAA TATAGAGTAGAAACAAAAGGGGACCCAGGACCGAGCCTTGAGGAACACCA TATTTCATTTTGAGTGGAGTGGAAAGGTTATTTCCAACACTGACACACTG GTACCTTGAATCTAGGTAACTCTCAAACCATTTCAACATTGGGCCTCTGA TACCTGACCTCATTAACTTACCAAGGAGGATTTTGTGGTCCACTGTATCG AATGCTTTTGCTAGGTCTAGGAAAATAGCACAGCAGTGGTCTTTATTTTT CATGGCTGTCGATATTTTATTTGTAAGGTCTAGAATGGCATGACTTGTTG ACTTTTTGGGTTGAAAACCAAATTGATTTGAAGAAAGTATTTCAAAGTCA GTAAAAAAATTGATAAGACGCTGGTGTATGACTTTCTCAAATATTTTATC GAATATTGGGAGTACAGAAATGGGTCGATAGTTCTTGAAGTCGTTCTTTG CCCCATTATTTTTAAAGAGAGGCACTACCTTTGAGAATTTGAGTTTTTCT GGAAAAATTGATTGTGTGACAGAAGCATTGATTAAGAATGATAGAATAGG AGATATGGCCTCATCAATTTGTTTAATCACAGCTACTGGAAAATTGTAAA TGTCACTTGCTTTCTTCTCATCAAGTTGTTTTACAAAAGCAGAAATTTCA GCTTTGTCAGTTGGTTTGAAAAAAAAACTTTTATTACTAGGGATAATAGA ATTTAGTGGATCTGTGCCTTTTTTTTGCTTGGAAAGTAAATTTTCAGCAA CATTTGAAAAGTGTTCGTTAAATTTTTGAGCGATTTTCGAATTGCCTGTA ATTTTCTTGTCATTGTATAACATTGTTGGTGGAATATAATTGTTTTTGGT TCTATGTTGTTTGTATTTGACTTGTTTTATCATTTTGAATTTTTTTTTGT ATCCTACCCACAAGTGAACCACAAAACCAGCATTGCAACATTTAAAACGA AACTTCCTTTATGGGAGAATCAGGAGAATGGGACCTTCCTGCCCTTCCTG CCTCCTCTCCCGCCCAGACTATCATATCTGTTATATACGTCACAAGGCGT CTTTTTGTCTGAACAAAAGGCAGCAAAACTCCGAGCAGAACATCATATTT TCCAACATGGCGGACGACGAAGTTGCATCAAACAGCGAAGTGTTCGACGA TGTCGATTCAGATCCTGGATCAATCATAAACAATGTAGTTGAATCATGCA GTAAAATTTTAATCCCTTCCATGGCTCAACCTTCCATGAACAGGCCACAC AATGAAGAAGAAGTAAATACGACTGACGCCATTTTTCATACGGATCACGA TGATGAAGGGATCAACACTAAAAGTGACGAAGAATCGTCGCTGGAAGATC AAAACACCGACGATGTGGTAAACAACATTAAGCGTGGAAGTCCTCTTCTC GAAGATAAACAAAGGATCAGTGGTCACAGTCCAAGAGTTGTAAGATGGAC ACTAGATACTATGGCAGCTGCAATGGATGCAGTTTTTGCAGGGGAGATGA CCACAACAAATGCATCAAGAAAATTTGGAATCCCCAGAACCACCCTCCTT GATAGGCTTTCAATGAAAGTTAAGAGGCAACATTTAGACTGTCCAGGTTC TTTCCCTCTTAATGCTGATAATGATGCAAAAGTTGTTGATTTTATTCTTG CTAATCAAAATCTTGATAAACAAACTTTAATCAAGGGGCTTTTAAGCCTT GGAGAGGAATTAGCTAGTATGCAGGGAAGACCTTTCAATGGGCCATTAAA CTCCAGGAAATGGTTGAAATTGTTTGTTCAAAAGCATCCAAATTTGAATG TTTTTTCTTACAGCCGATCTAGAGCACCAAGCTCACGCTCAGTTTCTTTT TCTGGCACTAGCTCCCATGCTCGACTTCAATCGTCATCTATTTCTAATGA TAATACAGTGCTTATTCCTCAGCAAATATTACACATCCAGCATGATCCTT TAGCACAATTGCAATCTGAACATGGCACAGAACAAGATTCTCCAACTCTT CCAGATNTTTGAATGTTTTTTCTTACAGCCGATCTAGAGCACCAAGCTCA CGCTCAGTTTCTTTTTCTGGCACTAGCTCCCATGCTCGACTTCAATCGTC ATCTATTTCTAATGATAATACAGTGCTTATTCCTCAGCAAATATTACACA TCCAGCATGATCCTTTAGCACAATTGCAAACTGAACATGGCACAGAACAA GATTCCCCAACTCTTCCAGAAAACGATAATGTGTTTGATTCTTTGGAGTC ATCCTTAGCAAAGCAAGGCGTTCGAGCTATAGAACAAAAACTGGGAGCTG AACAATTGTCATATTTCAATTATAGATACATGAACAAAAATTTAGAGAGG GGATATGAGTTATGGAAATTATGCAAAATCAAAACAGATGCAGGTGATAA CCTCTCAACTTTTGCATTGAGTGGGGTAGAGGAAGGTTTAGTGGAAGAGC ATTTGAAGTATTTCAGATTTCGATATGACAATACAGAACTTGAGGAGGGC TATAAACTTTGGGCTGTTCTGAGAGAGAAAATGCATGAATGAACTAAGAT ATCCTGTGTTCGTTTTAATATTGAATTAACTAATTACTTTATATACTTCA GTATAATTTTTTTGCATGTTGGTTGTAAAATACGCATTATCAGTGCCTCT TAGATGGCGTTAAACATCTTGAAAGTGTTCTTTTCATCTTTTCAAATTTC CCTTGGGGATTTTCAGGGATGACAACCAAATCCACTAAATCCGCGAAATT TGATTCCTTTGTCTTTTGCAACACAAATGTTACCTACTGTAGGGACAATA TAATTTATCCTGTTTTTATTGACTGAGTAGTAATGTTTGATTAATCTGTT ATTCAATAGATCATTGCGTTCTCCCAAACAAATACTGGCTCATAACTTGT TTTTGTACATATTTTTAATCAAATTTCCCTTACTTTGTTAGATTTACAGA TTTAGTTTGTTGTATATACTATCTATATACCTTGCATCATAAAAATTATA CTGTTTTCTAATGTCAACATTAGACCAAGTTATGGTATACTATTTTTCGC TAATTATTGAAGTAGTGGAATTGGATTAGGAACCATTCAAAACGTACATA AGTTCAAATATAAGCAAAATTTGATACTCCCTCTGTGTATGTACGCTTTT CTGAAAACCCCCTCCTCTAAGAAAATGTTTTATAATTATAGCTGGATAAC AAATATGGGTAACACAAGTAAGCTGGGTTACGAATATCAAATAGAAGGTT ACAAAAAAACTAGAAATCAAAACAGTTTGAAAAATTTGCAAAGAGTAATT GACCTCTCCCCCACTAACCCTTTTCTACACTTTTCGAGAGAGCTCCCTTC CCCTCTTAGAGCTTACATAAAGTACTTTTTGAATGGTCCCTTAAACTCTG TGTGGATCAATTTTCCTGACTTCTGTTTTTGCAAAGAAGAAAAAAGAAAG CCCAAAAACTCAAGGGGTGGTGCATTCTTAACTTGAAAAACATTGAAACT TTAAATGTATTGAGACTAGGATAAACTTTTAACCAAAACAATTTTGTAAT ATATGAATGAGACAATTTGAAATTCTTGATTTATTGTTGTTTCATGGTGA AATGAAATATAAGAAATATTAGAGTGGAATGTTGCCTAGACCTCTTACTT TTCTTGAAAACTTTTTTTGATACACCGATCAACCCTTAACAGCTATTAAA GCAGTTTACAAGTGAATTTTGTTGCTGCCTATTTTTTGGGTAATGTAAAT AAACTGAGCCAAAACTCAACTTTATAAGAAGTGTTTCTTGTTTTTCATGT ACACAGTTTTTCAATAAGAATTCTTTTTATAAGAATCACAAGGCTTTTAA ATTCGCAAAATTTTAACCAATGACAATCTGTTTATTCAGTTAGAACCCTT TAGTTTTTCATTGTTCACTTAAAATACCAACTGGTTCTACCATTTTATGA GGTTCAAAATTTGAAATTATCAGTTTTTGTTTTGTTCCCTAATACCTGGA GAGGGGAAACATGTTTTTTATAAAGTGTTTGAAAATTTGATTTCCTGTTT CAGATAAAAGAATAATAATTTTTTGGAATGGCGCCAATTTCACTAAAGAA AGGAGCAGTTGACATACTTGCTGGTGAACTTATAATGCATATCCTACAAA TCGAGGTATTGAATTTGGAGTAATGATGTATTTTCCTTTCAAATGTAAAC TTTTGTTATAATAAAGATCTTTCACCTTCTTAAAATTAAAGAAAGTTTCA TTATGTTAGGGGAAGGGGTTAGGTTTCTTTAGGTTCTTTGGGTTCTTTGG GTTGTCATCTTTTTCAATTTGTAGTACAGATTGTAGTAGTGTACCAGATT GAATGAATAGTTTCAACTGTTTGAAATTCTTTTTTTTTACATTCCAGAGA AAGAGTGAAAATTTCAAGATATCAATGGAATATGTCATGTCAAATTTCAG GTATTATTTTAAAATAAAACTTTTAGCTACAATCATTTTCCCTGTTTTAA CATGTTCTTGGCTTTTTAGAAAAACAGTTATAACTTTTGATCTAAGGCTG GACTTAAAAAATTATTGATTTGCCGTCACCCGACCCTAGATTTTGAAGGT GGGTCGGTTGGTCGGAATATTTTTTTATTTTGGTCATTCATGGAATTTTA GTTTACATTTTGTAATTTTTGAAGAAAAAAATTATCTTTGTCAAAATGGC AATAAAAAATCTTTAGGTCGGCAAGTTTAGCGAAGAGTCGGTTGGCTGAC GGCAAACCAACATTTTTATGTCCAGCCTAATCATAAATTTTCTTGCTTTT TTAACATCCAGTTATCTTCGGTTTTGATTGGATGCTACCCTGCCTTTTTA AGATATGATATGCTATTCTAGAGATTTGATCCGAATAATCTGAAATCAGG CAGACTCAAAGGTTCAGGATTGTTTTATATGATAGAACGCCATTCTTCAT TCTACTTGTGTCAGCTTTTGTAATTCAAACAATTCTTCAATTTTTTAGAT TCAACAGATTTCTTGATGTGAATTCTTTGGATGTCTCAAGATCGTTAACT GGACTTTGTTCAAAGTTTAGAGTAAACTCCTTCGATAAAAAAGCAGACTA TTTAGAAAAGAAAGTAGAAGAGTTTATAAATCTACCTCTTCTTGAAATCG ATGAGAAAGATAACAGAGAAGTTCAGGTATGTATCAGGTGTCCCAGAAAA AGTCCCCCCTCTTTGAAGTGAATTATCATGCGATACAGTAATGTATCTTT GTCTTGAAAATAAATTTGATACTCTATTCTTTTTTAAAAAATAGTGTTTT TGAATTTAGACTATAACTTTTGATCTAGTTTGCCAAATTTTACAATTAAT TATCCCTCAAAATTTAAGTTTACCCTTTACCATCCCTTTTATTGCAAAAG ATTTGATTCTTTAAAAATCAGAGAACTCGAGAAAATTCACTTCAAAGATG GGGACTTTTTTTCTGGGACACCCTGTATCAATGAATGGTGTTTTTCCTAC AGAAAACTTTGCAATAACGAAATGCCACAAAACTTTTCTTTCTGTTGCAC TAGGATTTTCAAAACCATTTGCGACAGCCAACATTGGGTAAAAACAGACT TAATTTCCTCATTTTTTGAAAGCTTTTCCAATCTGGATTCTCAAGATTGT TGACAGATCAACCTTTTCTTCCTTTAGACAGATGCACATTATGCATTATT GGCATTTTTGATGAAGCTCTCCAATAACCCTCTCAACTGTGAGTTTAAAC CTAAAGAAGAACCAAAGCCTGTCAAAGGTAATAATATTTTTTTCTTTTTA TATTCTGTAAATGCAAGATAAACAACAATAAAAAGAATATGTAGACCTTG TAGCAAGTTAACCATCAGTTTTAAGACTCAAATCTTTTTAAATGCTAGTG CCCAGGTCATAGTTCTTTGTGGTATTTTTTCTTAAGCCATAGTAACATTT TTAAGCTTTTTTTTTTCAGAGGAAAATACATTTAATTGGACCAAATATCT TCTTTTGGGAGAAGAACCATTGGAAATTGGTGCCAACATTGACTCAGACC TAGAAGATGTAATAACCACATTAGATTCTGATTTTCTTTTTATGTGCAAT AGGCCTTTTCATGAATTATTTTAAGTACAACGACTGCCTCATTTGAAACA ATTACCAAGGTGATCAAATCTCAAGGTGTCAAGTGTTACTTTTTGAATAA AGTTAACTACCAATTACCATAGCAATATTTTGAAAACAAGGTAAGCGTTG CTCATGACTTAGTTTATGTTATGATATTTACTGAATGTACGAGGTCTATT TGATTTGGTATTATTACTTTCTCTCTTCTTGGTGAACTGTACTACTTCAT GAAATCTCTTTGTTTTTAGACCTTTTTTGACCCTTTTTTTCAGGACCTTT ATGATAGTGACAATGAAATCTGGGTGAGTGCTTTTGTAAGATTTTTTTAT ATCAAACCCCTAAATTACAGTCTGGGATTTGGGTCAATATTTTACAGTCA GTATGTATGTTTCTCATTGTAGAAATGATATTTTATCGTATCCAAATTCT TAAAGTAGTATTAACTTGTAAATGGAGATAAACTTGCTTGACTTAGATAT CTAGATTGTTGGTTTGATTTTTCCACAGCAACTTTCTGAAGATGAAGACA GTGCTGAAGATGATGAAGCTCAACATTTGTATGATGAGGTTTCTGAAATA CAAAAACAACTAAAAAAGTTTACTGAAGTCAATCAATATGTCGAGGTAGG CAATATTTATTATTTAAACCTTTTGGTTACTCTTAAGTTAAATGTTACTG ATAATTAAAGATTAATAGTCCTCCAATGTAGAATGATCAACGGTCAGTCA AAATATTTTTTCAAGATTGTCTATCCTTTAGAAACAATCTTAAATTTCTT ATGGAGTTTTTGGTTTGTTTGAAATGAAACATATCTATGTTTAGAATATG TCGGCTGATTGGAAATTGTCTTTAGAAATTTGTTTTTGTTTATCGAAGGC AAAGTATCTCTTTTGTTCAAGGCATTCTATATTGTTGTTTTGCTTTGGAT TTGAATTTTTAATTTGTTTCAGGAGAAAGATTGGTTAAGAGAAAAAGTGG TCCCAGCATATTGGATAGAGAGTGAAAAGTCAACTTTTCCTTTTCATGTA CAAGGAATGAAATACATCAACTCTAACAATCAGATGTGCAATAATTGGTA AGCTTCTCAGAGATTCATACTATTTCTTGAAAAGAATACAGTGGTGGATA GTACGCATTATCAAACTTCTAAAATGATCTGAGGGTCTATTTTTCCAAAA TTGCCAGAAAAAGATATATACATTCCAGATTAATCATAAGAGTCACTCGA CTTTCCAATACTTTTTCACTAATAAGGAGTTTAAACCTGTTTTTCTCCAG TTTTTGCCACTTTTATGTGTTTTAGTAGTCAAAACAAAGTTGAGCTTTTG AATAAAATTTTTAAAGGCAATGGAAAATTCTAAAAAAATTTCAATTTCCT TTTTAAGAACCTATTATATTGTTAATTTCAAATTAGCAGGCTATAGTGAT TAATCGCCCGCTGAACTTAGAACTTTTACAATAAGTAGAAATTAGTTGTA AGATTGCATGTGCTATGGAGCCCCCCTCTTAGGTAAAAAAGGATTGCAGC TCAAATATGCGAGCTCAGAGACAGTGGTACCTACAAAGCTAACTCAATGT CAAAAAGGATAAATGCTTACATATCGTTAAAACTGATATGTTTTTGAAAA ATTATACTTTTAAAGAGATTTTCCTATGATTGAATCTATTCCGACCAGGG GGGGGGTCGGTACTAAAATGTCAGACATATATGAGTACTAAAAGGATTTT CAAGAATTTCTTGCATACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNGCAATTTAACATAGATACCACCCATTTTT TGCCCTTTTACGAGTTTAAATTTACCAAAATGGGGTCATTGTTACAAACC TAGTCGAATTTAGCGCATCAATCTGCGAAATGATATAATTTTATTACTAA ACTGTGCTAAACTGTACATAAAAATATTTTAAAAAAAATATTTAAAAAAT TGGAAAAATTTTGAAAGATTGTTTCGAAAATTCCTGAAAAAAAAATCAAA TTTTTTCCAAAATTGTTAAAAAAATGCTCCATTTTGGCTGATTTTAGAAC AAATACTAAGATTTTTCAAATATTTCTTTAAGGGACCACCTTTTTGGTAT TTTAGTACACATGGTACTAAAATTATTTTTGAGCTTTTTTGCAGTACCAC CACGTCACTAAATGTCATGATGTCTGAAATTTTAGTACCGACCCCCCCTG TTCCGAAAACCAAACAAAGAACCCATTATTATAATTTTTACTTGTATCTC TCACAGGGAACTTTACAAGAATCAATTCACCAAAGTATCTAATGACCCTC AACTGCTGTCTGAAAAAATATTGGTCAGAGAAACAGTTTGGTATGAATAT TATTAATTTAGACGATGGTCAGTATGTGACATCTAGGTTTTGGAAGCCAA TGCTCTCGCACATTAGGGAGAAGACACTACATTGACTTTTTTNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTT GTATTGTTTAGACCTGACGAAGACCTGCACCAAGCAGGTCGAAATATTGT TTACACGAAAAATATATACAGAATGACCATTAAAATGTTATTTAAATTAT GAATATTATTGTATTGTATTGAATTCAAATCATTTTGTTTTAGTATGAAT TCACATGATAGAAAGTTTACAAAATCCAAATACCTTCTCAGCAATACTTT AAACGGGCTGAATCATTTGAGTTGTGTGTTAGCATGCATTCATGTCTCTG CATGCATCTAAAATCTCCGAGGAGTTTGATTAACCATACACCTTAAATTT AGACTTTACTTTTAAATAAGGTGGATAGTACGCCTTATCGCATGTCTAAA TTAGCAAAATTTCAGATTTTAATTTTGGGAGTGTGATTGATCACATGCCT ATATTTTTAAAAATTACTCTTTAAGCAGGCTTATTGACTTAGGTTCATAC AGTGTTATACTTTGACTTTTCTCTACAAGCATTTCAACTCCTAATTTTCC AAAACAAATTGGGCTGCTAAAGGAAGACAGTAATTACCATTTGTGTGATT TTTATTTTGAACATTTTAAGGTAAAAGCTTATGCAACTTTTCATTTCATA GGATGCTGTTAGGACTTGAAAATCTGCATGTTTATAAATTCACTGGAACT AAATATGATGTGAATGAAGACATTGTTATAACACATTTGACAAAGGTAGG TATACTCCATCAGGTTGTTGGTTAGGACCTTCAAGTCTCAAGACCTGTCT GAAAATGACCAAAATTCAAAGACATTCAGGACAATAAAACTTAAACACTT GACTCAGCTGAAAAGGGGTGTGGTCTTTTAGAGTCTTAGTTCTAATTTGT TTTCTTTTACATAAAAATAAAAATTTATCGATGTTTGTTCTCATTGCCTT CTTCAAGATGATTATAATTGATTCCAATGTTAAAAGGATTGTTTTGATTG ATTGTTTTCACCATTCTTTAGGAAACGCTGAGTAAATTCTTAACAAGTTT CACAGAAGTTGGGACAAAAGTTGTGTTATTGAAACGTTTCACTGAACTTT GTGCACAGAAATATTCAGAAATACCGAAAACTATTCAAGCCTTTGGATAC ACTATATCCAAATACTTATCTGTAAGCTAATTTCCATTTTTTGAATTTAG CTTTTTCTACATCATTTTTTTTTGACTGTTAAAAAAGCCTGATCTTGTCA AAGAATTGTGAGTTGGGATTACTTTGCAGTACATCATTAGTAATTCAAAA CTTTCTCATTATTTTTATTATTTTTTAGAATCGAAGAGAAACTTTAATCG ACCTAGAGAAAACGCTCATGGAAAAAGGTTATTCAAATAAGTTTGTAAAT GTGTTTTGAGGAATTGAATTTTCACTTAAACCTAAGCTCTTTGCCATCCA ATAACATGTGCTCAACATTTTTATTAATATTTTTATTCACATAGTAAGGA ACTCGAGATACTTAGATAGGAAACAAAAAGAAGAAACATTTTTTCTTGTA CAAGATATATATAATATGCACCACTCATCAGAATCAAATATTCGATCCAT TGTCATAATTAGCACAACACATCTTGAGGCTGCATCTGTTATTTTCTAGG AAAAGTAAAAGATCTATTTGTTGGCCTTTCAGAGCTTTAAACCAAATGGT TCAACACTGAAAGCAACCAAATAATGTCAAATGTGATCCTCCAAGCGATT TTAAGTACATGAAAATCTTTCCGGCAAACATCGGAAAATGATCCGCCAAT TTGCCGGCAATAGTANNAGCCGTGACGTCTATTTTTAGAAGGGTGTTTGA TANNNNNNATTTGCCGACAATTTGCCGGCCTTATGGATGCCGGTAGACGA AGAATAAAAACATTCTAACATTACGTAATCAATATATGGTACATATTCCT ATATTCCTATATAACTATGTATCTACATATCCACGTATCTGTGTATCTAT GTATCTACATATCTACGCATCCATGTATCTATGTATCTATGTATCTATAT ATCTACATATCCATGTATCTATATATCTACGTATCTGTGTATCTATGTAT CTAAATATCTACGCATCCATGTATCTATGTATCTATGTATCTATATATCT ACGCATCCATGTATCTATGTATATACATATCTACGCATCCATGTATCTAT GTATCTATGCATCTACGCATCCATGTATCTACATATCTACATATCTACGC ATCCATGTATCTATGTATCTAAATATCTACGCATCCATATATCTATGTAT CTATGTATCTATATATCTACGCATCCATGTATCTATGTATCTATTTATCT ACGCATCCATGTATCTATGTATTCATGTATCTATGTACCTACATATCTAC GCATCCATGTATCCATGTATCTACATATCTACGCATCCATGTATCTATGT ATCTATGCATCTACGCATCCATGTATCTACATATCTACATATCTACGCAT CCATGTATCTATGTATCTACATATCTACGCATCCATATATCTATGTATCT ATGTATCTATATATCTACGCATCCATGTATCTNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCATCCATGTATCTATGT ATCCATGTATCTATGTATCTACATATCTACGCATCCATGTATCTATGTAT CCATGTATCTATGTATCTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATATCTA CGCATCCATGTATCTATGTATCTATGTATCTATATATCTACGCATCCATG TATCTATGTATCTATGTATCTACGCATCCATGTATCTATGTATATACATA TCTACGCATCCATGTATCTATGTATCTATGCATCTACGCATCCATGTATC TACATATCTACATATCTACGCATCCATGTATCTATGTATCTAGATATCTA CGCATCCATGTATCTATGTATTCATGTATCTATGTATCTACATATCTACG CATCCATGTATCCATGTATCTATGTATCTACATATCTACGCATCCATGTA TCTCTGTATCCATGTATCTATGTATCTAGATATCTACGCATCCATGTATC TCTGTATCCATGTATCTATGTATCTAGATATCTACGCATCCATGTATCTC TGTATCCATGTATCTATGTATCTAGATATCTACGCATCCATGTATCTCTG TATCCATGTATCTATGTATCTAGATATCTACGCATCCATGTATCTCTGTA TCCATGTATCTATGTATCTAGATATCTACGCATCCATGTATCTCTGTATC CATGTATCTATGTATCTAGATATCTACGCATCCATGTATCTCTGTATCCA TGTATCTATGTATCTAGATATCTACGCATCCATGTATCTCTGTATCCATG TATCTATGTATCTAGATATCTACGCATCCATGTATCTCTGTATCCATGTA TCTATGTATCTAGATATCTACGCATCCATGTATCTCTGTATCCATGTATC TATGTATCTAGATATCTACGCATCCATGTATCTCTGTATCCATGTATCTA TGTATCTAGATATCTACGCATCCATGTATCTATGTATCTATGTATCTACG CATCCATGTATCTATGTATATACATATCTACGCATCCATGTATCTATGTA TCTATTCATCTACGCATCCATGTATCTACATATCTACATATCTACGCATC CATGTATCTATGTATCTAAATATCTACGCATCCATGTATCTATGTATCTA CATATCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNCTACGCATCCATGTATCTATGTATTCATGTATCTATGTA TCTACATATCTACGCATCCATGTATCCATGTATCTATGTATCTACATATC TACGCATCCATGTATCTATGTATCCATGTATCTATGTNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGTATCTATGTATTCA TGTATCTATGTATCTACATATCTACGCATCCATGTATCCATGTATCTATG TATCTACATATCTAAGCATCCATGTATCTATGTATCCATGTATCTATGTA TCTACATATCTACGCATCCATGTATCTACTAGATGCGTAGATATATAGAT ACATAGATACATAATGCATAATACATAGATGCGTAGATACATAGATACAT GGATACATGGATGTGTAGATATGTAGATACATAGATACATGGATGCGTAG ATATGCAGATATATAGATACATAGATATATTGATACATGGATATGTAGAT ATATAGATACATAGATACATAGATACATGGATGCGTAGATACATAGATAC ATTGATACATGGATGCGTAGATATGTAGATACATAGATACATGGATGCGT AGATATATAGATACATAGATACATAGATACATGGATGCGTAGATACATAG ATACATTGATACATGGATGCGTAGATATGTAGATACATACATACATAGAT ACATGGATATGTATCTATATGGATACATAGATACATGGATACATAGATAC ATGGATGCGTAGATACATAGATACATAGATACATGGATGCATAGATACAT AGATACATGGATACATGGATGCGTAGATACATAGATACATAGATACATGG ATACATGGATGCGTAGATATATAGATACATAGATACATGGATGCGTAGAT ATATAGATACATAGATACATGGATGCGTAGATACATAGATACATAGATAC ATGGATGCGTAGATATGTAGATGNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNCATAGATACGTGGATATGTAGATACATAGATG TGTAGATATGTAGATATATAGATACATGGATGCGTAGATATGTAGATACA TAGATACATAGATACGTGGATGCGTAGATACGTAGATATATAGATACATG GATATGTAGATTATATAGATACATAGATACATGGATACATGGATGCGTAG ATATATAGATACATAGATACATGGATGCGTAGATACCTAGATACATAGAT ACATGGATATGTAGATATATAGATACATAGATACGTGGATATGTAGATAC ATAGATGTGTAGATATGTAGATATATAGATACATGGATGCGTAGATATGT AGATACATAGATACATAGATACGTGGATGCGTAGATACGTAGATATATAG ATACATGGATATGTAGATTATATAGATACATAGATACATAGATACATAGA TACGTGGATACGTGGATATGTAGATACATAGATATGTAGATTATATAGAT ACATAGATACATAGATACGTGGATATGTAGATACATAGATACATGGATGC GTAGATACATAGATACATAGATACATGGATACATGGATGCGTAGATATAT AGATACATAGATACATGGATGCGTAGATACATAGATACATAGATACATGG ATGCGTAGATATATAGATACATAGATACATGGATGCGTAGATACATAGAT ACATAGATACATGGATGCGTAGATACATAGATACATAGATACATGGATGC ATAGATATATAGATACATAGATACATGGATGCGTAGATACATAGATGNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCGTAGATATGTAGATAC ATAGATACATAGATACGTGGATACATAGATGTGTAGATGTGTAGATATGT AGATACATAGATACATGGATGCGTAGATACATGGATATTTAGATACATAC ATACATGGATGCGTAGATATATAGATACATATATACATGGATGCGTAGAT ACATAGATACATAGATACATAGATACATGGATGCGTAGATACATAGATAC ATAGATACATGGATGCGTAGATACATAGATACATGGATACATGGATGCAT AGATACATAGATACATGGATACATAGATGCGTTGATATATAGATACATGG ATGCGTAGATACATAGATACATAGATACATGGATGCGTAGATATGTAGAT ATATAGATACATAGATACATAGATACATGGATATTTAGATACATAGATAC ATAGATACATTGATATGTAGATACATAGATACATAGATACATAGATGCAT GGATGCGTAGATATGTAGATACATAGATACATGGATGCATAGATGTCTAA AATGGCTACTTTTCGTGAGACAAGGCAAACTATTCTCACGGCAGCCGAAA TAAGTGACGCAATCAGCTCGTGCCGATATTTTGCCGCTGTCAAAAATCTG AAGTCGCGCTGAAGATCGGCAATTTAGCCGGCAGATTGCCGGTCTACCAT TGAGCGGTAATTTGCCGGTAATTTGCCGGTGATGATTTAAACAAGATCGG CAAGATCGGTAAATTATACGCCAATTTGCCGGCAATAATGTTACCGCTTC TTTGCCGGTAACAATTTCGTGTCTTTGATATCGCTTGGAGGGTCACAAAT AACGGTCACATTTTTTACTACGCTATAACATTGTTTATTTCTCTTAGACA ATGCGACAACCCTGTTAACTCTAAAAGATGATCTTGCTGATGATATCTCA AAGGTAAAGTAAAAATAGCTTAATTAAAAAACCCTACAATAAAGGGTTTT CATCTTACTTAGCGTATAAAACTACCGGGTGGCCCAAAAAAAACTTGATT ATACTAAAAACATTACTCTGCCTAAATCTCTATCAATTTTTTTTTTGAAA GATGAAAAGACTAGACCGTTTTGACTGTTTGAAATAGTGTTTCTCAGATT AACAAAGTAGAATTTTTTACATTTACGTTTTAACATGAAATAAAAACATA CATTAAATTCACATAACAATGTACTCCTTCTTATTTACACTTCTTAATTG CAGGTCAATTTCATCTACAAGATATACAACCATGCTGTTGTAGAGGGACA TGAAAAGTATTTCACTGTGACAGAGGTATAATTCTTTTCACAATTTGTAG GTTGGTCCACAGATTTCTGTAAAGCCTGAAGGGCTATATAGAGTGCTTTG GTTGAAAAGTGTCACGTGACATTGTAAAAGAATTTCAGCAATTTGCTTGT TTTCAAAAACAATAGCTCAGCAATGTTTTTTGCGATATTCACCTTTTTTA TTGCTTGGAAAGGCTTATGGTATGTCATCCAGCCCTTCGGGCTTTATAGA AATGTGTGGGTTGGTTATGATGAAAAAGGACAAAAAAATGTAAACCTTGA TCAACTTGATAACTACAAAAGTTTTTGAGGTTCTATAGATGATAAACAAT ACCAATATCAGAATTTCAAATGCTGGCAGTCTTTAAATTTATGATGTAAT TTCAAGTAAGATGTTCTATCCCAATCAGTCTTATAATACACTCTCTTTCT TTTCTTTTCTTTTTTTTCAGCGAGTTGTTCATTTTTTGGACGTATTTTAT GATTTTGTTTGTACTCTTGACAATATGGGTGATTCTGGTACTGAAAAGGT TTGCCAAATTATTCCTGCCCAATTAGAATTTGCCTTAATTTAAATTATGT TCTGTTTTCTTTCTTCTGGACCAACAGCACGCATAAATTACTTGCTAGGG CTAATTTTGCAACTAATAAAGACTTGAAGTTTTGATTTTTGAGCATTGTT ATTATTTACTCTACCTGAAGTTTATTTTTTCTTCTTCGTTTTTCACCTTT ATTTTTAAATTTCTTTCAAAATTTTCACTCAAAATTATTTTTTCAACCAA AAAAAAAACCAAACTTTTTCAAACTCTATCAAAAGCTAAAATTCGATTTT AAATTTTATTGGAACTAATTAAAAAAAAGACTTGATCCACATTCCATTTT TTAATCGTGACCTTATCTTACCATCTTCATTCTCAGATGATGTTAGTGCT ACCAATGTTTCTTGAAGTCTGTCGACCGTACTTGGAAGATGTTGGGTGTT GGATGGCCACTGGGCAGTTACCAAGAGATGAAGAATTTATGATTTACAGG TAGTCTATTGAAAAGGATTAAACACAGAATTTGGCTTAGGATCAACTTCC AGTTGGGTGATATCAAAGGAAAAATGGTACTCGATATAAGTGGAAAATGA AAGTAGTGACACCCTCCCTTACCTTCAGGAAGACAGCCTCGACTGCGGAC GCAAACTTACATACTTTATTAGCAACATTAAAGCTCTGGTCTAGTTCCAA GTAATGGTGTTTAAAACCAAGCTCACTAATTAGGATTTAAGCTCGAATAT TTAAAGAGCGATGTCTACCGGCGCACAGCTTACCCGGTTGTCTACTAGAA CATGCATACTGACATTTTATATACTATCAATTTATTTTGAATAACTGATA TATTATGATATTTTTATTTTAGGACTCAAAATCAAGTTCAAGGTGAAACG CGGTATTGGCATGAACTATTCTTAATAAGAGGTATCAAATTTGAGTATCA AGTTTTGTTCTCTTAGACGATTTTTAAAAATTTCTTCATAATAATATGAT AACATTTTGTTTATTTGCCATAAAAGTAAAGTAATATAGTTAAGTAAAAT ATGTAAATTTTATAAGATAATTCACACATGTTTTTTTTTATAAGCATACA AAAATCCGAAAACAGGCTCAGAGATGCTTAGGTCGAAAGCTTAATAAGGC TGAAAAATGCTTGAGGGGATGCTTAAATCTAAAGCATAAATTTAGGGAAA TACTGTAAATCCGTAAAATTCCAGCCAAAAAAAGCCAAAATCAGGAAAAA AAACATTTTTCGTAGGCTCAAGTAATGCTTGCCATATGCTTAATTTTTCC CCATATCTGAGCCTAGATATGCTTATAAGTGCAACGATAAGTGCAAAAAA ACATGTATGTCGCCACTGTTTAAGGATTGGATTTTAATCTATGATATCTA TGACATCACTATTCGCCAATGCCAAAAAAGATCTTCACGGCTGTCTTTCA TTTTAGAAAATAGATCCACTGATGGAAAATCAAGTAAACTTGTACCCAGA TTCCTTGAGAAACTTCAAAAACAGGTAAATCTAGCTGAACATAATACTCA AGAGGAGGCCTGTACCCCCCTTTTAGAGCCACTCATCGCTTCTCGATTAC TCCCTTTTAACAGAACTTACCCCTCCCCGACGATACCTTTATTTATTGGA TTTAGCATATGAAGGCCAGAATTTACCACTAACACCAATCTTTTAACCTT TTAAAGCTTAAAGTGGCTCTAAAGAAGTTTTTTGCTAAATATAGAAAAAT CTTTTGAAAGATTTGAGAGCTCTGCTACAAATTGTTTTTAAAAGTCATTT ACCCTTCTCTTTTAAAATCTACCTTTCCTTTGTTACTAACCTCCCCTTTA TATTCTTTACCTCTACCCTTTATTGGTTTTTGTGATGGCTAAACCTTTTC TTTTAGAAATCAAACTGAAAATCCAAAGATAGGAAGAGACAGGCTACTGT ACTGTTAAAACTTTTTGGAACGATGAAATATACTTAATGTTCCCTCTAGA GATGGGAAAGAAGTGGTAGAAGAACAAAATAATAGTACCTGAAATTAAGT TTAAATTATTTTCTCTTTTTGTTTAGATTTTAGTTTCTGGAAAGTCGCTT GGTCTTTTGGAAGAATTTGTCGAGGTAATCCTTTAACAGCCTATAGTTTA AAACATAAATGAAGATTTTATCAAAAACATTCGATTTTATCAAAAACATT CGATTTTATCAAAAACATTCGATTTTATCAAAAACATTCGATTTTCGAAG GTCCTACGTTCGAATGACGTAATAAGATTGGAATGTCAGATACATCGTCA AGAAAATTGCAGATTCTTCTGCAACAAAATCAGTTCAAACTGATTTTGTT GCAGACACTTGCAATTTATTCTGCAATATTTTTATGGCGTTGCAGAGCAA TTGCAGAAAAAATTGACGTGCTACATTTTGCAATTTCTCGCGCGCTTGCA ACGCAACGCTAATTGCATTGCAGCCGCCTGAAAAAAACTATCAGTGTAGC CTTAGCTTTACTCAAAATTGATGCATGTATAATTAACTTTTTTCGTCCTA ATGATGACTAGAAAGCCAACTTTTAACATCACGTGTCATTCTTCTTTCTT GCTTTGAATTTGGAAGAGATACAAGATGCATTTACATTTGGAGTAACTTT CTAGTTACTTATTTTTAAGGTAAATTTATAACTCATCTTTTAGTTCACCT CGACTGTCGTTGCTACCGACTCCTTATATGAAGAATTTAAACGCAGTTTG AAAATCAACATCCAAAAATCGAACGAACGTTACCGCCACACCCATGCACT TGATAGTACCGATCATATACCTGGAGACGCCGTATCGGAATATATTTCTG ACAGTGGTATCGATCCGTTGTTGAGAGCCAATTTTCACATCATGTTTAAT AATGTTTATCAAAGAATGAAAACGAACAAAGAACAAATCGCTGTCGAAAG GTAATTGACAAGCTTTTAACGAGATTATTTACCTCCAATTAGGGCTTAAA GTAAAACTTAAGAAATTATTGAGTGCAATTTGAGAATGAGAGTAAAGTAT GAGTAAGGAGAATCCCTCATTTTCTACACTTCGTGATACAGTGTTATCTC TTTAACTCGAACCTCTATAACTCGAATGTCTCCTTAACTCGAACAAGTTT TCTATTCCCTTATAACCATAACCTTACTCTTTAACCCAAAATTTCCTAAA CTCGAACAAATTTATGTTCCCCGTGCGTGTTCGAGTCCACTGTAGTTGGA TAAAACTCGCTTACTTTTTTAGAATACGTCAACATGTTACAGCTCTTTAT TATTCTTGGACAAAGTTTATTTGTTAGTTAGAAACAAAGTTAGTCTCTAA ATTAGCCAATAAAATAGCTTCATTCACACCCCTTTCATGAAATAAACATT AAAATCGATTGATTTATTTGATTGTCTGCTTTTTAGTGGAAAAGAAGAGA TTCAAGACCTTGCTATTCTACTAAGTAAGTCCATCAATTTACTTTTTTAT CATCCTGGTTACAGCATAGCTTCAGCCCCCCCTGCTAGTTGGGGGGGGGT TGCACCCTCCAAAAAGCCAAAAAAGGGTGGGTGCTTAAGGTGTTTCAAAT ATTTGGGGGGACCTAATGTACTTTGGGGGGGGGAGCTGAAATCTCATCAT TTAACGTGGGGGCTGAATACTTCATCTTAATGGTTGGCTTCAATTACTCA AATTAAAGCTCACGAAGCTGAAAACTTTAAAACCAGGCTGACGCTATGTT ACATTGTTACGATATGCAGTGTTCCCGAAAAAAGCATCTTTACATTAAGT AATCTTCATAATTTATGCCCAATGTATGACTTGAATACTTAATATTTTAA TCTCAAAAACCTAATTATTGAACAGAGAATTGTTCCTGTAGGCCACCCAT GAAACAACTCATTTTTGTTAAATTTCTTTTTCCCCTTTTTATTGGACCTA CCTCGGAGGTCCTTTAATTTAACCTTTGTCCGTCCGTCCGTCCGTCCGTC TGTTACCAGCTTGTCTCGAAATTGGATCATTAGTTTTTTCTGATTTTTGG CACAAAGTTGCAAAATGGCAATGCCCAAAATGTGACGGAGCCCGATTTTC GAAAAAAAAAAATTTCCGGCCAAAAATACCGGAAATATGCCGGAAAAACT GTTTTTTTGGCATTTTCTCGAGATTTTATCATTAGTTTTTTCTGATTTTT TGCTCAAAGATGCGTATTAACAATGCTTAAAGCATGGTCGAGTCCGATTT TTGAGAGTAATTTTTTTCCTACCGAAAATGCCGGAAATCGCCGTTTTTCT GGATTTCATTGGACTTTTTCCTTATAATTGGGTGTTTTTTCATTCAAAAA CATTATTAATAGCAATGCCCACCATCAAGTATATTTTAATTTTCAATAAA ATTGATTTTTGAAGCTGGAACTATTTATAAATCGCCGGAACAACCTATTT TCGCCGGAAAGACAGTATTTCTTGAATTTCTCGAGCTGTACTTTATATTT TTTTATGAAATTTTGCACACTGATGCAAAATGACAATACCTAAAATGTGA CCGAGCCCGATTTTCTAAAACAATTTTTTTCCGGCCGAAAATGCCGGAAA TATGCTGGAAAAACCGGTTTTTTGACATTTTCTCGAATTTTCATCCTTAG TTTTTTCTGATTTTTTGCACAGTGATGCAAAATGGTGATTCCCGAAAAGT GAATTAGCTCGATTTTCGAAAAAAAGATTTTCCCGCAGAAAATGTCGGAA TATGCCAGAATAACCGGTTCTTTGGCACTTTCTCAAGATTTCATCATTAT AGTTTTTTCTGATTTTTTGCACAAAGATGCGTATTAGCAATGCCCAAAAC ATAACCTATTCGGATTTTTGAGCAAATTTTTTTCCGGCCGAAAATGCCAG AAATATGCCGGAAATTGTCGTTTTTTCAGATTTTTATTGGACTTTTTCCT CATATTTTTTTGTTTTTTTTTTCACACAAAAACATTATTGATAATAATGC CCACCATCAAGCATGATTCAGTTGTCATTAAAACTGATTTTTGCAACCGG AGCTTTCTATTTTTTCCCTACTCCCCTTCCCTCTCCCCCAATCAACAATC AATGATAAAATTTGCTAAACGCTATATTTTCTGACTGATGGTTTTCATTT TTCTCCTCGCATTGCTATCTAACTTTCATCATCAAGTAGGTCCATTCAGC ATCTAGCTTGTTTTCATTAGGAGATTGTTCCTGTAGGCCACCAATGAAGC GAATTATTGATCAAAGTTTATCACCTGTCGTTCTTGGTCGTTATGGAAAG GTATCGTGTCATTTCTAATTGCTATCCCAAGTGTTATCCTTCGCAACTAG GGTTTCAAAGATCAAAACAGTATCTAAAAAGTCGAACAATTTCTGCCACT GACAAAAAGTTTTATATTTTCGACGATTAAAATTTGTCTTAGCTTTTTAA TGTGCAAGCTTCTCTGGATTTTCCAAACTTTGTATTTACTCTTTATTATT TAACAGGCTTGCGTGGTATTATTAGAACTTTTCAAGAAAGAAATGAAGTT CCTTGATCATCTAGCTGTAATGAAGGTGGGATGTTATATCCATATCCGAT AAAATACATCTATTAACCACAAAGAGGTTTGGGTCAAATTAAACTTCCCA TCATTTGGTCTGTTAGACAGCCACCTCAGATAAAAGTGAAAGTCAATAAC TCTCTCTAATCCTCAAGGGACTAAGATTTTTCTTCGGATTAGAGAAAGAT TTGAATTATAGAGAGCGTTTAAGACTACTTCTAGCTATGGAGACCAATAT TTTAGTTTAAATTATAGAAAGATTCTAATCGTCTCGAATCTCGAATTAAT GGGATTCGACTTATTAAAATATGTGAGCTGTTGCTATACACTTCTACAAA TAATTACAAACTTTCCATTAAGTATGAAAACATGTCAATATTGCTCCTTT CAAGACAGGTCTCCGTGAAGAAACAAATCTTCTTTTTTTCGTATTATCAA TCATCATTCATCAATTAATTGAAAGAAATTTTTTTTATCATTTACAGAAT TTCTTCTTGATGCAGGCTACTGGAGAAATGTATGAATTTTACACAGACAT TTTTGAAAAGGTAAGGCCGAACGAAATTTAGGTAGAGTTGATTTTTTTAC GTGGATAGCCCAGTAATCCAAGACTTTAGGAGAGTCTTTGATCAGCCAGT TCGGCTATCTATGAACTGGACAGGACATTGGAAGGAGTGGGAATTTGAGC TCTCCCCTGGTTTATCGATTTGACGATTCGGCTATTTTCCCCTATTTTAT TTTCTCTTCCTCTCAAATTTTTATTGAAGCATGTTAATAATTTTACAATA TTTTTCAGGCAAAGCATGGTCGATATTGGAGGGACATGTCTTACTTAAAC ATTGTACTCCAAGATGCACTACAAGTCAACTATCCAAAACTTATGGGAAA GTAAGTAGAGTCTACATTGGAGTCTTCAAAACATGAACCTCTATAACTCG AACGAACAAATTTATTGATCCTTTGAGTTGAAAACCTCCATAACTCGAAA CTTCCACAATTCGAACAAATTTGTCTTCCCCTTGTGTGTTCGAGTTATGA AGACTCCACTGAAGATTTTATGTTAGTCAGTTCAACCATTTTCTGATATT TTTTTCATAGTGAAATATTATAGTCAAAAGTGTGTTTTACCCAAGAACAA TTTCAAGAAACATTTCAAGTTTTGATTTGATTAAACAGGTTTCATTGATT TGTTATTGGAAATTTATGAAACATGGACCCATTAAAATTTATTTTATTGG CAGCACTACATAAGTCTTTATTTTTGATTTCCTATAGTCTGACAGTGGAT TATTATTCATCCAAAAACAATCTATCGAACGCTCAATTATTCGATGGTTT GTCACTACACTATAAGGTAAGACTATTGAAAACCCTGTCTTCTTAACAAC GGTTACAAGCCTATACTTCTTAAGTCAACCTTCCACTCAATGGCGAATTC CCTAAATGTGCCTGCTAAACAACAGGTACTCTATACGAAAACGACACTCG CCAATATATTGCCGACACTCACCAATATATTGCCAACACTCACCAATATA TTTCCGACACTCGCCAACATATTGTGCAGTGTATGTATACCTTTGCGATA TTTACTCTCCATCTTAGGTTCCTTGGCCAGTGTCTATTGTTCTGGATCAA CATGCTGAAGATAAATATAATGAAGTCTTCCGATTCTTATTCAAAGTCAA ACGAGCTATATGGGTTCTGGAGCAGCTCAGATTTCAAGGTTTGTAAGCTA ACCTGGTTTCTCTAATTCTGTTTATGATATGTCTTGCTCATAAAGTTTTC CTTAAATATCCAAATCAAATTTCCATAATATACAGTATTGAGTTTTATAC TCACAAGACCAGAGCGATGATCTTAAGGGTCTTTAGGCTAATGAAACAAT TCAATTAGCGTTGATGACCGGACAAGTACCACCTTCACTCACATGTTTCT ATTAAATTGCTTAAAATCTACACATATAGAACTCGTATACCAGTGCTCAG ATTCGCAAGGTCATAGCGAGTCTTAGGGTGAGGCTATCGGATAGAATCTC TTGGCAAACTCAATCAATTTATCTTATGACTGAATAGGTTATGTACGCCA AATTGTANATAGAATCTCTTGGCAAACTTAATCAATTTATCTTATGACTG AATAGGTTCTGTACGCCAAATTGTTCAAAATCTACACGTTTAGAACTTGT ATACCCGTGCTCAGATTCGCAAGGTCATAGCGAGTCTTAGGGTGAGGCTA TCGGATAGAATCTCTTGACAAACTCAATCAATTTACTTCATGACTAGAAT TGATATGTACCGTACATGAACTTCCGTTAACTTGTTCAAAATCTACACAT TTAGAACTCGTATACCAGGGCTCATATTCGCAAGACCATAGCGATTCTGA GGACGAAGGAATTGACTACAACACGACAACATCCACTACAAGGAGAGGCT TAAAACAACACGTGCTGAAAGATATGATACTGAGTGGTGCCCATCAAAAA TTGAAGAATAGGATATTAGTATTGAGAATGAAGATGTTACATGTTGTACG AAGTTTCCATTTCTACCTCATGACAAGGGTGAGAAAGTTTTCTCCAATGG ATCTTCTAGTTTTTCTCAGCACACATTGGGCTTCTCCAGAAAAAAATTGA ATATGCAGGGGGTGGAGGATATAACAATTTTCAGTGATTTACCCCCAGAA AAAGTGACTTTTGGCCCCGGACAACGGGTTTTACCCGTAGACAAGCCAAA TTACCCCCGGACAGAGCAAATTTACCCCCCGGATAAGACAAATTTTATGA TTTTTCGCTACCCCAGGGACAATGATTCCTACACCCCCCCCCAATTTTTC AGAGGAATGGGAACGGTTTGTTACTTGTTGACTGATTTGTCTTCAAAGTT AGGTAACTCAGTCGACATTTTTTACAGTGATGATTAATAAGATTGGGCCT TCGTAAACTTCGTAAAACCTACCGTATTTTGCCTTCAGGGAAGGGCGTTT ATTCGAGAGGGCGTTTAAAAGAAGGGGGTATTTATTCAAAGTAATGCGAT AACTAAATATAAAGAAATTAGAGATCTGTAGAACTTCGCCCTCTTTATTG AAGAACTTTCATGTATGTTGTTGTTTCTTAGATCGACGATAGTATCCATC AAGAGTTTCGTGTTGAATCGGTGAGTATGCTTGTTATCTGAGATTTAATA GTAATATCACTTACACAGAAACGTTATTGCATCATACGACGAAGAATTGA TTTTACTTGTTGTAAATAGTTTTGCCGTGTTCTCCATCAAGCCCAGATCT ACTCTTAACATGGTTTGTATTTTAAACTGTGTACAATATTATTTCGTTTT CTTTTAGGCAAGAGATTTGGACGAGATTCTGGAGTTCCATCAAAAGTTTT TGTTTTCTTTGAGACAAAGATGCTTCTTACACGAAAAGGTTTGACTTTCA GCACTGACATGAAAAAGACTTTTACTTCGAAAAATCTTTTGATTTTAGGT ATAATGTCAGTTGTCCTTTTTGGACCTCACCCCTCATTTTTCCAAATGGA TCCCTAGCTGAAATGAGAATTTGAATGACAGCAAAGTCAATTTCCATATG GAACTAAAAATTTTTGTGATTATCCCAACGGCGACGAAATTGTGGCCAAA TAATAACAAAAAATCGAAATTTTTGATGGTATTTTGTTTTTTTATTTTTT GATGTTATGTATTATATGGAATGGGTTTGCTAATGGACTTATTCCCACCA CTCGGATGGCTGGAAGTGGTGGCCGTTTGGGTAGATTTTAGTGATGTCTT GTTGTCGTCCATTGATAATACAGATGTGTAACTTGTTCTTCCCATTCTTA ACACGAACATCTTGAGACGGTCTTGGAACTTGTTCGTCTACAACTAATTT TGCTGTCTGCACTACTTGATTTTGTGCAACTTTTTCCTCATTCGGTTTTT TCGTTGTCAACCAAGGATGTGTCAAAACTTCATCCAAGCAAGGATGCTCT TTTCGCTGGATCCTTTTCCAAAAGGCGACCGAGAAGATGAAGACATTCTA AAGTGAAAATGAAACAAAATGTATTTTTGATCATTTAAAACACTTTTGCC TATAGAATCTGAATTCTTGATATTCATAATGCAATCTTTTACACGGAAAA ACTCGAAAAACACCGAGCCAAACGTTTTATTTTGTTTAGAATCTCAAAAG TGTTGGCAAACGCTTGTTTTCTTGTTGACTAGATATCACCAGAAGGTCAC TAAAAACGCCGTGGCCCACGCGCTCCAGAGGCGTTTCAATCGGGCATATT TATACTACAACTGTTTGATGTTTTTCTTGTGTAGCCTTACAGAATCAAGG CGAGCCTCAAAGGAAAGAAAAAGAACTGTTTGTGTTTACCTTGGGACAAC GAAACTTCTGCTGGTAGTCTCCCCGCGAAACTTTTTTTCTCAATCAAGTT GCTCAGTATTCTCCATTCAAATGCTGGGTATGGTCGCTTACCAGTCAGCA GCTCAAACAGGATGATACCGCTAAAAATTGTAAATTTCGATAAGATAATA AGATTTTATAGGAACCAGTAATTTTTGGTTCAAACTCTTCTGTTTTGTGA TGATTTTCAGACTTGATGTTTTTAAAATCCTCTAATTACGTTTACTTTAT CATCTTATTATCTGAGAAGGGGCATATTTTAAATTGTTCTTAGGTTTTTG TTAAAATCGAGCCTCATATTCTTATAAAATGGTCCACTAAGAAGAAATAA CACGAAAAAGAATAGAATTGTCAAATTTGAAATCAACTTACAGACTCAAA TTGCCATCATAGCGGATTCCGTCTCCAAGATAACCTCGAATCATTTCAGG TGCCATGTAAGACGCTGTCCCACAGTAGCTACTCAAAAGACCATCAAGGC TATCTTCAAAGAATTCGGAGACTCCAAAGGAAATAGAATATAGAAATTTG ATAAGCAAAGGAAATAGAATTACAAAAAAGAATTTTGCAAAATGTCGCAT CAAAACGATGTTCAAATAACGTCTATAAGAAGCTCAAAAGGGTGAGTTTA TTGCGGAGTTGAAACGGTATAAAGTATTGCATTCATTAAACTGTTGCAAT TGAAAGAAATGTTCTTGAAATCATACACTGTTATAGTTGGGCAATTTCGT TGACATAACTCTCAAAAAGTTATGTTATAAAATGCGGATGTTTTATTTGG TATAAAAAACCTTACCAGCTATTTTCAATTCGCCATTTTTGTCAACAAAG ATGTTCTCCATCTTTAAGTCGCTGAAAAAAAGTGAAAATATTAACATCAA CTTCGACCGCAGCAGAATCTGATAGGCGGAATCATAACTAGTGAGATAAA TCGAATGGCTGTCTAAACCGAATGACTGTCTAAAATCCTAAATTAGAGTG AAACATCTAAATAAATAAAATAAATGGTAAAGATCGTAATATAACTTTAT TATCAACCTACCGATGACAAATTCCAAGTTGGTGACATTCGTTGACACCT TTGACAAGAATTTTGAACAATTCCTTTGCTTTTTGCTCCTCGACGAATGG AGCTGATGATAAGTAATGGCTTAAAACACCATTGTGACAATATTCCATTA CTATGTAGGAATTCTTTTTTCCGTCAAATCTGGTGTAAACTTCAACCTGG AGATTATGAATGAATATAAAGTGTGATTTTCAAGCTAACCAATTTAACGG AATCAACTTTCGTTTTTGGCGTATGTTTAGCCGTCAATAATATTCCTCTA ATATTTTTTTGAATTATTAGAAATTATAAATACCACTCGTAAAAACGTTC ATAGTCTTTCATATAATCAGGTGATGATCGTACTTTGCCTAGATTAGGGT TAAACTGTTCAAGTTTTAAAACTCATTGAAACTATTGAGGCGTTTGTGGT TTAGTAGTCATTGACCTTGGTTGCTACATAGGCGACTGAAGTTTGATTCC CACTCGACAAGTGAACGTACCTTTGACGTACCTTTGACAAAACTAATTAA AAGACATTGACTTACGACATTGGACGATGTCTTCGCTCTAAGCATGGCTT CGTACTCCTTACGGATAAGGTTTTTGTTTTTTCGTGGCATGATTTTAATG GCCACCTAAAGAATGATAGAGAAAACCGTACTTGAGAATTTCTTATAACA ATGATGTCTAGAGATGATGAAAGTTAGCCAAAGCCTAGTTTTTGGCAACG ATAGCCCGTATCCTAGTGGTATTCAGGAACGTTGATTTCGAACACGAAAT TTCTTACACTTTAAATCGGATCAGCCAAACATTTCATTAAACCAGAAATC CGCGAATAGTTGGGCGAGCCTAAGCTACTTATACTGTCAGTTGCGTTGAT CCATGGAGGTAATAAAAATATAACTATCTACATCCGCAGATAGTTGGGTT TTAGTAAGCGAGCCTAGGCTATTTATACTGTCAGTTGCGTTGAGCTAATA ATCATTATGAAAACAATTAACTTACTTTATTTGTACCCTTGGAACGAAGC TTTGCGGCAAGAGCGTCACCGGGAACATTCAAATTGACATAAGTTGCCAA CCGAACTTTCCCATAGGCACCTTCGCCCAAAGTCCGTCCCAAGCGGAAAC CTTGAAAGACACACTCTATTTCGTATGTGTTCATATTGTTTTATCGATTT TATCAGTGATTTACTTTTAGTTTTCTTTCCCTCTCTTTATTCGCTCTATG CGATCCTTTGAACCAGCTAGCTCAAAGGTTGGTCGGATTCGATAAGAAAT TCGCTTTTCAAAATACTTTTAAAAAGTACTCAATTTTTATTTGACGTCAA ATGAAATGTAATATCTTTCAGAAAATGACGTCAAATTTGATAGCAGTGTA ACACGCTACGTAGCTTCTAAACTACTTTGTTGAAAGCTGAATACGCCTGC CTTATCATTGGTCACTTTTACAACCAGCACTCCATGAAACAATAGTTATC TTTTTGATTCCAGAAAAGTAAACTATACTAAAAAAAAGCTTCGGAATATA AGTGAAAATAGATACCTATATATATACATGGATTCATGTATAAAACACTA AATTTGGTCATTTAGTTCTGTTATTACGGGATTATTAGGTTTTGCCTGGA AAGGCTTATGATGACGTCATCACTAAACTTTCAATCTCCATAACTTTTAA TAGGAAGATTTTCAAGGCATGTTTTATATCTCAACTTTCATTAGCATTTC ATGTTCTTTCCGCTGAAACCGTCAGATTTCTTTCCGCTGAAACCATCAGA TTTTGAATATTTTCAAAAAAATAAATTTTTGCCCAGCCACCTGATGACGT CATCTGGCAGGTGACCAGGAAGGACAATTTGGTGTTACTGTTTAAAATTA AGTTTTAGACTCTTTAAGGATCGTCTGTGCCAAATTTCATGCTTTTATCA CAATCTGAAGTATTTTTGTGCTAACAGACCTCACTATGAATATTTCTTGC CTGTACAATAAAAAATTGCTGTTAGAAAGTTTCAATACACCTTTTCAAAG CAAGGTCGAGGGCAAGGTTCTCTAAAAAGTGGCTGAAGCAGTTTCTCTAA AAAGTGGCTGAAGCAGTTTTTTTCGAAAAATTTTTTTTGGTCGTAAAAAT TGGATTTTCTTATTTTGGGAAATTCCCTATGTCATTTTGAGTGAAAAAGA TCTTTCTCGCGATTGGATTGATATTTTTTGCATAGTGATATAAAATGGTA ATAATATTTAATTGTTGGAGCCCGATTTTCGATATTAATTTGAGCTGTGA TACTCACGGCAATCTATTCAAGCTGCTCACTACACTTTTTTACTCTCTTG CTTTTGTCCTATTTTTGCCTGATTCTCATCATCAGGTAGGTCTATTCAGC ATGTTGCTCTTTTATCCTTTCTGTCCAGAATTTATTTTTAGCAAGTTCTA GTCCTAACGTTATCGAAATTATGTTTAAATTAAAATATCGGAATATCTTT CGCACACGAAATTTCACGACTGTTCATTTCCCATTCAGGTTGCTCGTACC AAAGATGCTCTCGTGCGAATTTTGAATCTTTCTTTTGAGCTGGAAGAACT TTGGAGATCAAGCGTTGCTGTATTAAAGTAAGTTCGAATCAATTTAACAA GGCAAGACGTTCACTGAATACAACGTTCACTCAAACAGATAGATACTCAA CCCAACCCAAAAAATTTAATTGGGTGTTGAGGATAATAGATATTGAGTCT TTATACCCCTCCCTGTACAACTTAAAAAGATGTGATATCTCGATGAATAG ATTCCGTATTACTTCGAATAAGCGCCCCTATTTGAATCAATTAGTTGTAA GTGAGCGAGAATCATATAGAGGAAAACGTAAATATGTGTTCATAATTGTA TTCAATTAGTATTTTAACTAAGTTTGACCCATCTCTAAAATGACATATTT GAACTGAAAAATAACGAAAAGGCAAAACAAGGTTCCCATTCCCTTTACTA AAGTGACCTTTGCTAAAGATTATTTTAATAAACGCTCCCGCGATTAAACA CCCCTCCTAAAATCCAAAAAAGGCGTTTATTCGAAGTAATACAGTATCTA TAAAACTGATTAAAATTTTACTCTCTACTTCTTCTTCAGCGTGAACCAAC TGATGGCGTTAGAAAAAGAATTCTTCCGATGCACATCGTTTTTACATTCA TTCTTTACAACTTTGTCCAAGAGAGGCTCCTTTCCACATTGTAAGTACAT TTTGTAAGTCTGCTCAAATAAACGTTCTCTCTTTTTTGACTTTCCTGTGT CTATTCGTGATGTTCATGACGTAGTGTTTTATACGAAAGCACCTAAAAAA GACTCCCAGACGGCACACAACGTCAAAACAACGTCCATGTGACATTCATA ACGTCCAAATAACGTTATTTGAACGTTAAAACAACGTTGTGTGTCAGCTG GGCTGGGCGTTTACCACTAATTGGTCAGCCCTGGTGGCCCTTCAAATCCC TTCCACAATTTTTCTCCCGGATGTCGTCCATAAGACTTTTCATTCTAAAT CCGATTCTTCTACGTTTTCGGTAAAACGATCCCGAACGGGTTTCTAGAAC GGATTAACGCTAATGGCTATCCCTAAATAAGTATTAGTTATTACTCCTAT CGGAATACACGTATGATTTCCTATTCCGTTTTCATTGTAGTAAGACAGCA AAAATATATTCAGTTTAAAAAAAGTACCCACAATGCCTCGTTTTTTAAAA CGCTTCGTGAATGAGGCGGAAAAACGAAAGTGGAATTTTTGAAACTCTCA GCGTCCAAATTACTGCTAAGTGATCCTTTAAATCTGTTTATTTTCACTCA CATCTTAGCTCTAATTACTCTTTAGGATTAATTTTAAAACTTATTTTAGC GAGAAGACACAGTTGCACTACTCTGTACCAGAGTGTATCTCACGATTATC GAAGACACAGTTAACAAAACTGTTTTTGGACCTACCTGGAGGTCCTATAA ATTAACCGTTGTCCGTTCGTTCGTCCGTCCGTCCGTTCGTCTGTTACCAG CTTTTCTTGAGATTGGCTCATTAGTTTTTTCTGATTTTTGGCATTTAATC CTTTTAATTGGTTGTTTTTTTCTTTCAAAAACATTATTAATAGCAATGCC CACCATCAAGCATGTTTCGATTTTCAATAAAATTGATTTTTGAAGCCGGA ACTATTTAAAAATCGCCGGAACAACCTATTTTCGCTGGAAAGACAGTATT TCTTGAATTTCTCGAGCTGTGCTTTATTTTATTTTTTTTATGAAATTTTG CACACTGATGCAAAATGACAATACCTAAAATGTCATGGTGCCCAATTTTC GAAAAACATTTTTTCCGGCCGAAAATGCCGGAAATATGCCGGAAAAACCG GTTTTTTGACATTTTCTCGAATTTTCATCCTTAGTTTTTTGCTGATTGTT TGAAGAAAGATGCGTATTCGCAATGCTCAAAACATGACCGAGTTTGATTT TTTGAGAAAAATTTTTTTCCGGCCGAAAATGCCGGAAATATGCCAGAAAT CGCCGTTTGTGCAGATTTTTATTGGGCTTTTTGTTTTTCCTTATATTTCT TTGTTTTTTCACATAAAACATTATTGATAACAATGCCACCATCAAGCATG TTTCAATTGTCAATAAAACTGATTTTTGTAACCGGAACTTTCTATTTCTT TTTTCCTTACAACCCTTCCCTCTTCCCCCATCAACAATCAATAATGAAAT TTAATTCAATTTCGCTAACCGCTATATTTTCTGATTGATCGTTTTTATGT TTCTCCTTATTGCTATCTAATTTTCATCATTAGGTAAGTCCATTCAGCAT CTAGCTTGTTAGATTAAAATGCTACTGTTTGATCGCCATCTATCTTTTTA GGTAAATGACACTTTTCAAGTGCAGCTGAAAATAATAATTTTACAACATA TAGTTACTCATTATCTTAATCATTTAGTGCGAGCATGCGATTGTTTCTAG TTTTATTATCTCCTTAATAATCGTTACTGGAGATCCCTTCCATAACACCA CCATTTAGCCCTTCCAATATCCTTTGTTATTTATTAGGTGTAATTTGTTT GATGGCAATTTCCACATTGCCATAGTACTGGACATAACTCCAGGGGAGGG AGGAGTTAGGAGGGGAGAGGCTGATTTTTGGAGTTTCACATTTTCCTCCT CCCCAGTAAGCAAACTGAAATCGACTACTGTTGAAGCAGTGTTCACAAAT CCCCCTTGTCATGCGAAGGAAAGCTAATAACGTCCTTTATCTTCTATGTT CACTGGCGAGCAACCAATAAATGATCGGTGCACCATCTGTATTTAAAGGC ACATAAAAGTACTGACGAAATTTGTAAACGAACCGTATGCAGCGGGATAC AAAATCAAAACAAGTGTCACATGTCAAAATAAAAAATAAAAACAAATATG GCTGATTTTGATTGTTTCAATTGTTTTACAAGTTTGTTTTGGACTACGTG AATTTAATTTCTTTTTAATGACACGTGGTTCCCGCAATGTTTACATTTTA CTACTTTTATGTCCCTTTAAACGAATCTCTTTGAAATCTGTGTGAGTCAG ATTGCTTTTATAATTGGTCAGCCTAAGCTGAGCATTCAAATAGGTAAAAT TCGGTTCCATAAGACGGCAAAAAAAAAATCCGATTTCCCGAGCTCACTTT GATTTCAAAAGCGAGTTTAAAGCAAAACAGGGGAAAAATGAGCTTCCCCG CATAGTTATGAATTTTAAGTTTTGCTTTCGATTATCATTTGCGACCAGCA AAGTCTTCAAGATGGTTGTGTGCATGTTGTGNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAATTAGCGG GGGGGGGGCAGCTATTAGGTACCCGAGAGTAACCTGTGTTCGTTCGTCCG TCCGTTCGTCTGTTACCAACTTTTCTTGGGATTGAATCATAGGAATTTTT AGACTTTTGGTACAAAGGTGCAAAATGGTAGTGTCCAAAATGTGACGGAG CCCGATTTTCGAAAAAAAAAATTTAGGGCTAATTTGGGCCCAAAAATGCC CAAAAAAAGGGTTTTTTGGACTTTGTGAAAAGTCCATTCATTATATTTTC CTGATGTTTTGTACAGAGATGTAGAATAACATTGTTCAAAATATGAATTA GTTCATTTTTCGAAAAAAAAAATTTGGGGGCCAATTTGGGCCCAAAAATG TCCAAAAATAGGGCTTTTTGGACTTTGTGAAAAAACTCTTCATTTTAGTT TTTCCTGATTTTTTGTACGAAGACGTGGAATTACAGTGTGCTAAATATAA AAAAGTTGATTTTTCAAGAAAATTTTTTTTTTGGGCCAAATTAGGCCCAA AAATAGGGTTTTGTAGAAAATCTGTTCATGAGATTCTCCTGAATTTTTGT ATAGAGAGGTAGAATAACAATGTGCTAAATATAATATAATGCATATCCAC TCCACGTTTTTTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN TCAAATGTTTCACATTTTGTACATTATTCAACATTTTTAGTCTACTCTGT TTCAGTACATCTCTTACATCTGTTAACCCACTTATTAAAGCTATCTAGCC AAGCTCTATTGGCTGACCTTCCAGCCTCGGCTGGTTTATTTTGTTTTTGT TTTAGCCAAAACTCAGCCTCGTATTCTTGTAAAAAGAGATAGCAAAATAC ACTTTTTTTATACAAGGTTTTGTTTTTAAATAAGAGTGATATCGTACTCA GCGGCTGTATTTCTTTGTGTGTTTTATTCAGAGAGTTGTTGTAATGGAAT TTTTTGCTCAAAATTTCATGCTCTTTCTGATGGTACCAATCATTTTCAAT TATTTTGACTTTTTAAAACCAGCTATTTTACCCCTTATTTTCCCTTGCAG TTTTGCCTATGGCGTCACTATTTTGGTCATAGAAAGTTTTGGCAGGCCTA ATCCGCGTCCTCCCTCTCAAAAATATCTTAAAATATACTGTTCTTTGGAA TAGACTAAAAATGGATAGGTCGTAAAAAAGATGTCACAGGACCCCAGGCT TGGCCCCTAATATTTAGCTTTAAAGGATTCTATGATTCTTTGACGTGAAA ATAAAATCCCAAAATACTTTTTTAGTTGGAAGATACAACTCCAAGTCTAT CACTGATTGACTAAAATTCAATAAAAGCAAAAGAAAAGAGCCTGTTTTAA GAGTCAGCTAGACAATTAAGTTTTATGCTGTGTTTTTTGACGAATTCTTT TTTGACAGTGATGATGTTCTAAGATTGAAGATTTTTTTATGAAAAAATGT TGATTATAGAAAGGTCTAAGTGGCATAAAGGCCCAGCAGTGTTCGTAATA TCAACATATTTTCCCGTTGCAGAGTCACCATACAATTTAATTTTACACAT GCGCACAATAGTTGTTCAGATAATTTGATTTTTTGCCGGGACTCATCAAT TGATGATTGCACGCATAGGCCCTGACAAAGTCTAATCTTTTCGACCAGTT GTGTTTTAAAGTCCCATTTCGCTGCGCGCTGGGCCAACTACATGTTTTTT TTATAAGCAAATGTATGCCCCTTGGTCAGGCTCGTGTATGCTTAAGTTCT TAAAGCATCCAGGCATAGCTTATGCTTATTATATGCTTATGAATCATGCT TATGATTCACCCCGAGTCAAGTTTTTATAGTGAAATTTCAGAAATTTTGT GAAAATTCGTTCAGATTTTGGGAGCAGTGGAATGTAGCTAGCCGTGGAAT GTCTTTTTTTACTTGACCTCTACCAAACCTTTTTAAACAGATAAAAAATG ACAACTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNTCCAGGCTGACATATATGCTTATGTTATGCGTAGGAATTC TGCAAATCTGAGCCTTCATATGCTTATAAGCGTTATGCTTATAAAAAAAA CATGTAGTTGCAAACGCCCAGGCTATTTTGGATGCTTCCGTATAAAACAT TACGTCATAAATATCATGAATATTGGAGAGTGGTTCCCACATGGTAGCAA CAAAAGTCTCTCACTTATAATGATCAAAGTGGTGGATCTTTCTGGTTGAA TCCTTTTTTCATTATCTCGCTATAGAACTCGGTGTAAACCAATCGAGTTT GTAGATAATGATTATTCTTCCCCCTTTTTGATTAATTTCATTCTTCTTTT TTTTGTAGTTGAATTTCTGGCAACAACGATGAAATTTGAGTCAAGGTGAA AGGAATACTTTATCAACTCGATTGGTAGATGTTTTTAGTGAGAAAAGTGG TGACAAAAGATGTTGTTTTAACTCTCAGACAACGTTGTCTGAAAAGATGT CTTTGATAATAATAACTGTTTTCAACTAATCGAACGGTTTAATGGACGTT ATGGACGCTGGTTTGATGGCATATAACGAACGGCGGGCGCTCTTGGTATT TTTGGCATATTTAATAGACGTTATGGACGTAAGATGGACGCTGGTTTGAT AGTATATAACGAACGGGGGGCGCTCGTGGTATATTTGCGTATTGAGGCTT GTGTACTGAAGAGAGGGTAAACCACAATGTGTGCGTTTAATCCCAGACTT TTACAGGACTGAAATTCCAAAGGTTGGAAATATTGGTAATCCAAGAAAAA GTGCACGGCCATTGAGCTCTATTTATCATTACAGGGCCGAAACGTTATTT CGCTGTGAAAGGCTACGAAAACGTGTCCAAAGACGTTACAATGAGTTTGT CTTTTCATCATTAGCGAGTTTATGTATTTGCGCTTTTGAGGACGGTAAAG TGATTGAAGCAATTTAGAATAACCCGCAGTTCTGACCCGCATTATCGAGG ACGGTAAAGGTGCTGATTCACTGTCGTCCTCAGATGGTCAGTTTCTAATC AAATTAGAACCTTACCGTCTCCGTCGCAGAAAAACACACATACATAAATT CGGTATTAAAGGATGCTGAAACGTCGTGTCGTTATGAAAGAACATTGAAG AAATCTTTTTTGAGAAATCGTAAAAGTACAAAGACCACTTTTGTTAAATC GAATTCATTCTCATTCGTTTTGTTTCAATAGCACACCGTGGTGAATCTAA AAATAGACATCACTTTCTTTATTTGCCCGAGTTTCAATCCCATCGTTCAT TGCGTTAATTTCTTGTGCACATTAATTACACTTATAACAAAGAAAAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000142XLOC_000142Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000262-exon-sc0000001-1575043694:2532840..2532984TCONS_00000262-exon-sc0000001-1575043694:2532840..2532984Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2527230..2527331TCONS_00000262-exon-sc0000001-1575043694:2527230..2527331Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2526935..2526987TCONS_00000262-exon-sc0000001-1575043694:2526935..2526987Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2526209..2526386TCONS_00000262-exon-sc0000001-1575043694:2526209..2526386Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2525608..2525707TCONS_00000262-exon-sc0000001-1575043694:2525608..2525707Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2525327..2525415TCONS_00000262-exon-sc0000001-1575043694:2525327..2525415Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2524962..2524991TCONS_00000262-exon-sc0000001-1575043694:2524962..2524991Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2524640..2524756TCONS_00000262-exon-sc0000001-1575043694:2524640..2524756Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2524188..2524312TCONS_00000262-exon-sc0000001-1575043694:2524188..2524312Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2522745..2522828TCONS_00000262-exon-sc0000001-1575043694:2522745..2522828Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2521790..2521883TCONS_00000262-exon-sc0000001-1575043694:2521790..2521883Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2521364..2521513TCONS_00000262-exon-sc0000001-1575043694:2521364..2521513Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2521158..2521206TCONS_00000262-exon-sc0000001-1575043694:2521158..2521206Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2514932..2514987TCONS_00000262-exon-sc0000001-1575043694:2514932..2514987Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2514560..2514631TCONS_00000262-exon-sc0000001-1575043694:2514560..2514631Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2514037..2514114TCONS_00000262-exon-sc0000001-1575043694:2514037..2514114Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2513536..2513648TCONS_00000262-exon-sc0000001-1575043694:2513536..2513648Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2513104..2513162TCONS_00000262-exon-sc0000001-1575043694:2513104..2513162Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2512511..2512578TCONS_00000262-exon-sc0000001-1575043694:2512511..2512578Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2511911..2511958TCONS_00000262-exon-sc0000001-1575043694:2511911..2511958Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2511085..2511341TCONS_00000262-exon-sc0000001-1575043694:2511085..2511341Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2510561..2510598TCONS_00000262-exon-sc0000001-1575043694:2510561..2510598Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2508735..2508814TCONS_00000262-exon-sc0000001-1575043694:2508735..2508814Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2508460..2508528TCONS_00000262-exon-sc0000001-1575043694:2508460..2508528Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2507925..2507987TCONS_00000262-exon-sc0000001-1575043694:2507925..2507987Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2507585..2507676TCONS_00000262-exon-sc0000001-1575043694:2507585..2507676Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2507119..2507197TCONS_00000262-exon-sc0000001-1575043694:2507119..2507197Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2506747..2506867TCONS_00000262-exon-sc0000001-1575043694:2506747..2506867Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2505907..2506130TCONS_00000262-exon-sc0000001-1575043694:2505907..2506130Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2505315..2505353TCONS_00000262-exon-sc0000001-1575043694:2505315..2505353Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2505047..2505127TCONS_00000262-exon-sc0000001-1575043694:2505047..2505127Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2500408..2500496TCONS_00000262-exon-sc0000001-1575043694:2500408..2500496Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2499795..2499895TCONS_00000262-exon-sc0000001-1575043694:2499795..2499895Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1575043694:2492688..2493676TCONS_00000262-exon-sc0000001-1575043694:2492688..2493676Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2532840..2532984TCONS_00000262-exon-sc0000001-1510915933:2532840..2532984Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2527230..2527331TCONS_00000262-exon-sc0000001-1510915933:2527230..2527331Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2526935..2526987TCONS_00000262-exon-sc0000001-1510915933:2526935..2526987Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2526209..2526386TCONS_00000262-exon-sc0000001-1510915933:2526209..2526386Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2525608..2525707TCONS_00000262-exon-sc0000001-1510915933:2525608..2525707Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2525327..2525415TCONS_00000262-exon-sc0000001-1510915933:2525327..2525415Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2524962..2524991TCONS_00000262-exon-sc0000001-1510915933:2524962..2524991Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2524640..2524756TCONS_00000262-exon-sc0000001-1510915933:2524640..2524756Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2524188..2524312TCONS_00000262-exon-sc0000001-1510915933:2524188..2524312Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2522745..2522828TCONS_00000262-exon-sc0000001-1510915933:2522745..2522828Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2521790..2521883TCONS_00000262-exon-sc0000001-1510915933:2521790..2521883Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2521364..2521513TCONS_00000262-exon-sc0000001-1510915933:2521364..2521513Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2521158..2521206TCONS_00000262-exon-sc0000001-1510915933:2521158..2521206Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2514932..2514987TCONS_00000262-exon-sc0000001-1510915933:2514932..2514987Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2514560..2514631TCONS_00000262-exon-sc0000001-1510915933:2514560..2514631Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2514037..2514114TCONS_00000262-exon-sc0000001-1510915933:2514037..2514114Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2513536..2513648TCONS_00000262-exon-sc0000001-1510915933:2513536..2513648Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2513104..2513162TCONS_00000262-exon-sc0000001-1510915933:2513104..2513162Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2512511..2512578TCONS_00000262-exon-sc0000001-1510915933:2512511..2512578Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2511911..2511958TCONS_00000262-exon-sc0000001-1510915933:2511911..2511958Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2511085..2511341TCONS_00000262-exon-sc0000001-1510915933:2511085..2511341Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2510561..2510598TCONS_00000262-exon-sc0000001-1510915933:2510561..2510598Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2508735..2508814TCONS_00000262-exon-sc0000001-1510915933:2508735..2508814Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2508460..2508528TCONS_00000262-exon-sc0000001-1510915933:2508460..2508528Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2507925..2507987TCONS_00000262-exon-sc0000001-1510915933:2507925..2507987Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2507585..2507676TCONS_00000262-exon-sc0000001-1510915933:2507585..2507676Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2507119..2507197TCONS_00000262-exon-sc0000001-1510915933:2507119..2507197Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2506747..2506867TCONS_00000262-exon-sc0000001-1510915933:2506747..2506867Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2505907..2506130TCONS_00000262-exon-sc0000001-1510915933:2505907..2506130Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2505315..2505353TCONS_00000262-exon-sc0000001-1510915933:2505315..2505353Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2505047..2505127TCONS_00000262-exon-sc0000001-1510915933:2505047..2505127Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2500408..2500496TCONS_00000262-exon-sc0000001-1510915933:2500408..2500496Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2499795..2499895TCONS_00000262-exon-sc0000001-1510915933:2499795..2499895Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1510915933:2492688..2493676TCONS_00000262-exon-sc0000001-1510915933:2492688..2493676Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2532840..2532984TCONS_00000262-exon-sc0000001-1491911889:2532840..2532984Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2527230..2527331TCONS_00000262-exon-sc0000001-1491911889:2527230..2527331Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2526935..2526987TCONS_00000262-exon-sc0000001-1491911889:2526935..2526987Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2526209..2526386TCONS_00000262-exon-sc0000001-1491911889:2526209..2526386Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2525608..2525707TCONS_00000262-exon-sc0000001-1491911889:2525608..2525707Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2525327..2525415TCONS_00000262-exon-sc0000001-1491911889:2525327..2525415Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2524962..2524991TCONS_00000262-exon-sc0000001-1491911889:2524962..2524991Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2524640..2524756TCONS_00000262-exon-sc0000001-1491911889:2524640..2524756Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2524188..2524312TCONS_00000262-exon-sc0000001-1491911889:2524188..2524312Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2522745..2522828TCONS_00000262-exon-sc0000001-1491911889:2522745..2522828Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2521790..2521883TCONS_00000262-exon-sc0000001-1491911889:2521790..2521883Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2521364..2521513TCONS_00000262-exon-sc0000001-1491911889:2521364..2521513Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2521158..2521206TCONS_00000262-exon-sc0000001-1491911889:2521158..2521206Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2514932..2514987TCONS_00000262-exon-sc0000001-1491911889:2514932..2514987Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2514560..2514631TCONS_00000262-exon-sc0000001-1491911889:2514560..2514631Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2514037..2514114TCONS_00000262-exon-sc0000001-1491911889:2514037..2514114Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2513536..2513648TCONS_00000262-exon-sc0000001-1491911889:2513536..2513648Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2513104..2513162TCONS_00000262-exon-sc0000001-1491911889:2513104..2513162Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2512511..2512578TCONS_00000262-exon-sc0000001-1491911889:2512511..2512578Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2511911..2511958TCONS_00000262-exon-sc0000001-1491911889:2511911..2511958Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2511085..2511341TCONS_00000262-exon-sc0000001-1491911889:2511085..2511341Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2510561..2510598TCONS_00000262-exon-sc0000001-1491911889:2510561..2510598Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2508735..2508814TCONS_00000262-exon-sc0000001-1491911889:2508735..2508814Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2508460..2508528TCONS_00000262-exon-sc0000001-1491911889:2508460..2508528Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2507925..2507987TCONS_00000262-exon-sc0000001-1491911889:2507925..2507987Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2507585..2507676TCONS_00000262-exon-sc0000001-1491911889:2507585..2507676Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2507119..2507197TCONS_00000262-exon-sc0000001-1491911889:2507119..2507197Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2506747..2506867TCONS_00000262-exon-sc0000001-1491911889:2506747..2506867Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2505907..2506130TCONS_00000262-exon-sc0000001-1491911889:2505907..2506130Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2505315..2505353TCONS_00000262-exon-sc0000001-1491911889:2505315..2505353Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2505047..2505127TCONS_00000262-exon-sc0000001-1491911889:2505047..2505127Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2500408..2500496TCONS_00000262-exon-sc0000001-1491911889:2500408..2500496Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2499795..2499895TCONS_00000262-exon-sc0000001-1491911889:2499795..2499895Clytia hemisphaericaexon
TCONS_00000262-exon-sc0000001-1491911889:2492688..2493676TCONS_00000262-exon-sc0000001-1491911889:2492688..2493676Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2492688..2532984 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.397558 1.24475 0.373721 0 1.56225 2.76635 4.83969 4.1678 4.13332 4.68262 0.880382 3.49368 3.61317 3.21651 1.9474 3.30565 3.51219 0.834681 0.30924 2.30083 2.62031 1.34481 1.81515 2.39302 8.85817 9.03838 0.153599 2.71273e-05 0 0.385252
Blast
BLAST of TCONS_00000262 vs. Swiss-Prot (Human)
Match: GCP5 (Gamma-tubulin complex component 5 OS=Homo sapiens GN=TUBGCP5 PE=1 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 1.179e-109
Identity = 303/1046 (28.97%), Postives = 525/1046 (50.19%), Query Frame = 2
Query:  218 ELIMHILQIERKSE-NFKISMEYVMSNFRFNRFLDVNSLDVSRSLTGLCSKFRVNSFDKKADYLEKKVEEFINLPLLEIDEKDNREVQTDAHYALLAFLMKLSNNPLNCEFXXXXXXXXXXXXNTFNWTKYLLLGEEPLEIGANIXXXXXXXXXXXXNEIWQLXXXXXXXXXXXXQHLYDEVSEIQKQLKKFTEVNQYVEEKD---WLREKVVPAYWIESEKSTFPFHVQGMKYINSNNQMCNNWELYKNQFTKVSNDPQLLSEKILVRETVWMLLGLENLHVYKFTGTKYDVNEDIVITHLTKETLSKFLTSFTEVGTKVVLLKRFTE---------------LCAQKYSEIP-KTIQAFGYTISKYLSNRRETLIDLEKTLMEXXXXXXXXXXXXXXXXXISKVNFIYKIYNHAVVEGHEKYFTVTERVVHFLDVFYDFVCTLDNMGDSGTEKMMLVLPMFLEVCRPYLEDVGCWMATGQL-PRDEEFMIYRTQNQVQGETRYWHELFLI------RENR------------STDGKSSK--LVPRFLEKLQKQILVSGKSLGLLEEFVEFTSTVVATDSLYEEFKRSLKINIQKSNERYRHTHALDSTDHIPGDAVS--------EYISDSGI------DPLLRANFHIMF---NNVYQRMKTNKEQIAVESGKEEIQDLAILLRDCSCRPPMKRIIDQSLSPVVLGRYGKACVVXXXXXXXXXXXXDHLAVMKNFFLMQATGEMYEFYTDIFEKAKHGRYWRDMSYLNIVLQDALQVNYPKLMGNLTVDYY---SSKNNLSNAQLFDGLSLHYKVPWPVSIVLDQHAEDKYNEVFRFLFKVKRAIWVLEQLRFQELVYQGSYSQDHSDSEDEGIDYNTTTSTTRRGLKQHVLKDMILSGAHQKLKNRILVLRMKMLHVVRSFHFYLMTRIDDSIHQEF--RVESARDLDEILEFHQKFLFSLRQRCFLHEKVARTKDALVRILNLSFELEELWRSSVAVLNVNQLMALEKEFFRCTSFLHSFFTTLSKRGSFPHFEFLATTM 3166
            EL+  +  ++ +++ NF++++ +  SNFRF+RFLDVNS  + +++ G+  KF ++S   KA   ++  EEF+N PL  I     +E++TDAHY++L+ L+ LS++P N  +      K V++++ F+W KYL+  EE ++IG  +D+    +  + +N+   LS ++   + D          E Q Q +K      + +E D   WL   VV  YW  +  S FP  +    +++SN     +  LY +    V +D  L++E  ++RET+W+L G++ L +++    K  V  +I++THLT   L   L      G  V  L+ F +                  +K +E P +T QAF + + KY  + +E L ++EK ++  D   TL  + D LA  +S++  ++K+++  V E       V  R  H L+  Y  +   DN+G++  + + L+  +++E  RPYL+ V  W+  G L     EF+I R +N       +W+  + +       EN             S  G SS+   +  FL+ + KQI+++GKS+ LL+      ST     +   E K    + ++    R RH    DST  +  +  +        + I++S +      DPLL  NF  M+   ++ +++       +   S     Q   + LR C             L P +  +Y   C  L++  KK+ + +++L  M+NFFLM+    MY+FYT IF+K +    W+++S+LN+ LQ+A+   YP+    L++ +    ++K  L    + DGL+L YKVPWPV IV+    +  YN+VF  L ++K A + L+ L F ELV     S        EG+ +   T   + G ++  ++  I         +R+ +LR+K++H V S H Y+MTRI  S   EF  +VE A+DLD++++ H ++L ++  RC L EKV+  K+A++++LNL+    + W++ +    +  +  +E +F  C  FL +       RGSFPH E LA ++
Sbjct:   21 ELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLDVNSHKIEKTIEGIYEKFVIHSDLSKAASWKRLTEEFLNAPLPSI-----KEIKTDAHYSILSLLLCLSDSPSNSSYVETPRNKEVEKKDDFDWGKYLMEDEE-MDIGPYMDTPNWSEESEEENDQQPLSREDSGIQVDRTP------LEEQDQNRKLDPCISWKDEPDDRSWLEHHVVHQYWT-ARPSQFPHSL----HLHSNLAAVWDQHLYSSDPLYVPDDRVLVTETQVIRETLWLLSGVKKLFIFQLIDGKVTVRNNIIVTHLTHSCLRSVLEQIAAYGQVVFRLQEFIDEVMGHSSESMLPGSGSVPKKSTEAPFRTYQAFMWALYKYFISFKEELAEIEKCIINNDTTITLAIVVDKLAPRLSQLKVLHKVFSTGVAEVPPDTRNVV-RASHLLNTLYKAILEYDNVGEASEQTVSLLFSLWVETVRPYLQTVDEWIVHGHLWDGAREFIIQRNKNVPVNHRDFWYATYTLYSVSEKTENEEKMSDNASASSGSDQGPSSRQHTMVSFLKPVLKQIIMAGKSMQLLKNLQCAESTTCQAGARDAERKSLYTLFLESVQSRLRHGE--DSTPQVLTEQQATKENLMKMQSIAESHLELDDVHDPLLAINFARMYLEQSDFHEKFAGGDVCVDRSSESVTCQTFELTLRSC-------------LYPHIDKQYLDCCGNLMQTLKKDYRLVEYLQAMRNFFLMEGGDTMYDFYTSIFDKIREKETWQNVSFLNVQLQEAVGQRYPEDSSRLSISFENVDTAKKKLP-VHILDGLTLSYKVPWPVDIVISLECQKIYNQVFLLLLQIKWAKYSLDVLLFGELV-----STAEKPRLKEGLIHEQDT-VAQFGPQKEPVRQQI---------HRMFLLRVKLMHFVNSLHNYIMTRILHSTGLEFQHQVEEAKDLDQLIKIHYRYLSTIHDRCLLREKVSFVKEAIMKVLNLALMFADGWQAGLGTWRMESIEKMESDFKNCHMFLVTILNKAVCRGSFPHLESLALSL 1017          
The following BLAST results are available for this feature:
BLAST of TCONS_00000262 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GCP51.179e-10928.97Gamma-tubulin complex component 5 OS=Homo sapiens ... [more]
back to top