Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000261 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000261
Unique NameTCONS_00000261
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3968

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000261 ID=TCONS_00000261|Name=TCONS_00000261|organism=Clytia hemisphaerica|type=transcript|length=3968bp
TAaaagaataataattttttgGAATGGCGCCAATTTCACTAAAGAAAGGA
GCAGTTGACATACTTGCTGGTGAACTTATAATGCATATCCTACAAATCGA
GAGAaagagtgaaaatttcaagataTCAATGGAATATGTCATGTCAAATT
TCAGatTCAACAGATTTCTTGATGTGAATTCTTTGGATGTCTCAAGATCG
TTAACTGGACTTTGTTCAAAGTTTAGAGTAAACTCCTTCGATAAAAAAGC
AGACTATTTAGAAAAGAAAGTAGAAGAGTTTATAAATCTACCTCTTCTTG
AAATCGATGAGAAAGATAACAGAGAAGTTCAGACAGATGCACATTATGCa
ttattggcatttttgatGAAGCTCTCCAATAACCCTCTCAACTGTGAGTT
TAAACCTAAAGAAGAACCAAAGCCTGTCAAagaggaaAATACATTTAATT
GGACCAAATATCTTCTTTTGGGAGAAGAACCATTGGAAATTGGTGCCAAC
ATTGACTCAGACCTAGAAGATGACCTTTATGATAGTGACAATGAAATCTG
GCAACTTTCTGAAGATGAAGACAGTGCTGAAGATGATGAAGCTCAACATT
TGTATGATGAGGTTTCTGAAAtacaaaaacaactaaaaaagtTTACTGAA
GTCAATCAATATGTCGAGGAGAAAGATTGGTTAAGAGAAAAAGTGGTCCC
AGCATATTGGATAGAGAGTGAAAAGTCAACTTTTCCTTTTCATGTACAAG
GAATGAAATACATCAACTCTAACAATCAGATGTGCAATAATTGGGAACTT
TACAAGAATCAATTCACCAAAGTATCTAATGACCCTCAACTGCTGTCTGA
AAAAATATTGGTCAGAGAAACAGTTTGGATGCTGTTAGGACTTGAAAATC
TGCATGTTTATAAATTCACTGGAACTAAATATGATGTGAATGAAGACATT
GTTATAACACATTTGACAAAGGAAACGCTGAGTAAATTCTTAACAAGTTT
CACAGAAGTTGGGACAAAAGTTGTGTTATTGAAACGTTTCACTGAACTTT
GTGCACAGAAATATTCAGAAATACCGAAAACTATTCAAGCCTTTGGATAC
ACTATATCCAAATACTTATCTaatcgAAGAGAAACTTTAATCGACCTAGA
GAAAACGCTCATGGAAAAAGACAATGCGACAACCCTGTTAACTCTAAAAG
ATGATCTTGCTGATGATATCTCAAAGGTCAATTTCATCTACAAGATATAC
AACCATGCTGTTGTAGAGGGACATGAAAAGTATTTCACTGTGACAGAGcg
agttgttcattttttggacgtattttatgattttgtttgtACTCTTGACA
ATATGGGTGATTCTGGTACTGAAAAGATGATGTTAGTGCTACCAATGTTT
CTTGAAGTCTGTCGACCGTACTTGGAAGATGTTGGGTGTTGGATGGCCAC
TGGGCAGTTACCAAGAGATGAAGAATTTATGATTTACAGgacTCAAAATC
AAGTTCAAGGTGAAACGCGGTATTGGCATGAACTATTCTTAATAAGAGAA
AATAGATCCACTGATGGAAAATCAAGTAAACTTGTACCCAGATTCCTTGA
GAAACTTCAAAAACAGattttaGTTTCTGGAAAGTCGCTTGGTCTTTTGG
AAGAATTTGTCGAGTTCACCTCGACTGTCGTTGCTACCGACTCCTTATAT
GAAGAATTTAAACGCAGTTTGAAAATCAACATCCAAAAATCGAACGAACG
TTACCGCCACACCCATGCACTTGATAGTACCGATCATATACCTGGAGACG
CCGTATCGGAATATATTTCTGACAGTGGTATCGATCCGTTGTTGAGAGCC
AATTTTCACATCATGTTTAATAATGTTTATCAAAGAATGAAAACGAACAA
AGAACAAATCGCTGTCGAAAGTGGAAAAGAAGAGATTCAAGACCTTGCTA
TTCTACTAAGAGATTGTTCCTGTAGGCCACCAATGAAGCGAATTATTGAT
CAAAGTTTATCACCTGTCGTTCTTGGTCGTTATGGAAAGGCTTGCGTGGT
ATTATTAGAACTTTTCaagaaagaaatgaagttcCTTGATCATCTAGCTG
TAATGAAGGCTACTGGAGAAATGTATGAATTTTACACAGACATTTTTGAA
AAGGCAAAGCATGGTCGATATTGGAGGGACATGTCTTACTTAAACATTGT
ACTCCAAGATGCACTACAAGTCAACTATCCAAAACTTATGGGAAATCTGA
CAGTGGATTATTATTCATCCAAAAACAATCTATCGAACGCTCAATTATTC
GATGGTTTGTCACTACACTATAAGGTTCCTTGGCCAGTGTCTATTGTTCT
GGATCAACATGCTGAAGATAAATATAATGAAGTCTTCCGATTCTTATTCA
AAGTCAAACGAGCTATATGGGTTCTGGAGCAGCTCAGATTTCAAGAACTC
GTATACCAGGGCTCATATTCGCAAGACCATAGCGATTCTGAGGACGAAGG
AATTGACTACAACACGACAACATCCACTACAAGGAGAGGCTTAAAACAAC
ACGTGCTGAAAGATATGATACTGAGTGGTGCCcatcaaaaattgaagaat
agGATATTAGTATTGAGAATGAAGATGTTACATGTTGTACGAAGTTTCCA
TTTCTACCTCATGACAAGGATCGACGATAGTATCCATCAAGAGTTTCGTG
TTGAATCGGCAAGAGATTTGGACGAGATTCTGGAGTTCcatcaaaagttt
ttgttttctttgagaCAAAGATGCTTCTTACACGAAAAGGTTGCTCGTAC
CAAAGATGCTCTCGTGCGAATTTTGAATCTTTCTTTTGAGCTGGAAGAAC
TTTGGAGATCAAGCGTTGCTGTATTAAACGTGAACCAACTGATGGCGTTA
GAAAAAGAATTCTTCCGATGCACATCGTTTTTACATTCATTCTTTACAAC
TTTGTCCAAGAGAGGCTCCTTTCCACATTTTGAATTTCTGGCAACAACGA
TGAAATTTGAGTCAAGGTGAAAGGAATACTTTATCAACTCGATTGGTAGA
TGTTTTTAGTGAGAAAAGTGGTGACAAAAGATGTTGTTTTAACTCTCAGA
CAACGTTGTCTGAAAAGATGTCTTTGATAATAATAACTGTTTTCAACTAA
TCGAACGGTTTAATGGACGTTATGGACGCTGGTTTGATGGCATATAACGA
ACGGCGGGCGCTCTTGGTATTTTTGGCATATTTAATAGACGTTATGGACG
TAAGATGGACGCTGGTTTGATAGTATATAACGAACGGGGGGCGCTCGTGG
TATATTTGCGTATTGAGGCTTGTGTACTGAAGAGAGGGTAAACCACAATG
TGTGCGTTTAATCCCAGACTTTTAcaggactgaaattccaaaggTTGGAA
ATATTGGTAATCCAAGAAAAAGTGCACGGCCATTGAGCTCTATTTATCAT
TACAGGGCCGAAACGTTATTTCGCTGTGAAAGGCTACGAAAACGTGTCCA
AAGACGTTACAATGAGTTTGTCTTTTcatcattagcgagtttatgtattt
gcgcttttgaggacggtaaagtgattgaagcaatttagaataacccgcag
ttctgacccgcattATCGAGGACGGTAAAGGTGCTGATTCACTGTCGTCC
TCAGATGGTCAGTTTCtaatcaaattagaaccttaccgtctccgtcgcag
aaaaacacacatacataaattCGGTATTAAAGGATGCTGAAACGTCGTGT
CGTTATGAAAGAACattgaagaaatcttttttgagaAATCGTAAAAGTAC
AAAGACCACTTTTGTTAAATCGAATTCATTCTCATTCGTTTTGTTTCAAT
AGCACACCGtggtgaatctaaaaatagacatcacTTTCTTTATTTGCCCG
AGTTTCAATCCCATCGTTCATTGCGTTAATTTCTTGTGCACATTAATTAC
ACTTATAACAAAGAAAAT
Run BLAST on NCBI

transcript from alignment at sc0000001:2492688..2527330-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000261 ID=TCONS_00000261|Name=TCONS_00000261|organism=Clytia hemisphaerica|type=transcript|length=34643bp|location=Sequence derived from alignment at sc0000001:2492688..2527330- (Clytia hemisphaerica)
TAAAAGAATAATAATTTTTTGGAATGGCGCCAATTTCACTAAAGAAAGGA GCAGTTGACATACTTGCTGGTGAACTTATAATGCATATCCTACAAATCGA GGTATTGAATTTGGAGTAATGATGTATTTTCCTTTCAAATGTAAACTTTT GTTATAATAAAGATCTTTCACCTTCTTAAAATTAAAGAAAGTTTCATTAT GTTAGGGGAAGGGGTTAGGTTTCTTTAGGTTCTTTGGGTTCTTTGGGTTG TCATCTTTTTCAATTTGTAGTACAGATTGTAGTAGTGTACCAGATTGAAT GAATAGTTTCAACTGTTTGAAATTCTTTTTTTTTACATTCCAGAGAAAGA GTGAAAATTTCAAGATATCAATGGAATATGTCATGTCAAATTTCAGGTAT TATTTTAAAATAAAACTTTTAGCTACAATCATTTTCCCTGTTTTAACATG TTCTTGGCTTTTTAGAAAAACAGTTATAACTTTTGATCTAAGGCTGGACT TAAAAAATTATTGATTTGCCGTCACCCGACCCTAGATTTTGAAGGTGGGT CGGTTGGTCGGAATATTTTTTTATTTTGGTCATTCATGGAATTTTAGTTT ACATTTTGTAATTTTTGAAGAAAAAAATTATCTTTGTCAAAATGGCAATA AAAAATCTTTAGGTCGGCAAGTTTAGCGAAGAGTCGGTTGGCTGACGGCA AACCAACATTTTTATGTCCAGCCTAATCATAAATTTTCTTGCTTTTTTAA CATCCAGTTATCTTCGGTTTTGATTGGATGCTACCCTGCCTTTTTAAGAT ATGATATGCTATTCTAGAGATTTGATCCGAATAATCTGAAATCAGGCAGA CTCAAAGGTTCAGGATTGTTTTATATGATAGAACGCCATTCTTCATTCTA CTTGTGTCAGCTTTTGTAATTCAAACAATTCTTCAATTTTTTAGATTCAA CAGATTTCTTGATGTGAATTCTTTGGATGTCTCAAGATCGTTAACTGGAC TTTGTTCAAAGTTTAGAGTAAACTCCTTCGATAAAAAAGCAGACTATTTA GAAAAGAAAGTAGAAGAGTTTATAAATCTACCTCTTCTTGAAATCGATGA GAAAGATAACAGAGAAGTTCAGGTATGTATCAGGTGTCCCAGAAAAAGTC CCCCCTCTTTGAAGTGAATTATCATGCGATACAGTAATGTATCTTTGTCT TGAAAATAAATTTGATACTCTATTCTTTTTTAAAAAATAGTGTTTTTGAA TTTAGACTATAACTTTTGATCTAGTTTGCCAAATTTTACAATTAATTATC CCTCAAAATTTAAGTTTACCCTTTACCATCCCTTTTATTGCAAAAGATTT GATTCTTTAAAAATCAGAGAACTCGAGAAAATTCACTTCAAAGATGGGGA CTTTTTTTCTGGGACACCCTGTATCAATGAATGGTGTTTTTCCTACAGAA AACTTTGCAATAACGAAATGCCACAAAACTTTTCTTTCTGTTGCACTAGG ATTTTCAAAACCATTTGCGACAGCCAACATTGGGTAAAAACAGACTTAAT TTCCTCATTTTTTGAAAGCTTTTCCAATCTGGATTCTCAAGATTGTTGAC AGATCAACCTTTTCTTCCTTTAGACAGATGCACATTATGCATTATTGGCA TTTTTGATGAAGCTCTCCAATAACCCTCTCAACTGTGAGTTTAAACCTAA AGAAGAACCAAAGCCTGTCAAAGGTAATAATATTTTTTTCTTTTTATATT CTGTAAATGCAAGATAAACAACAATAAAAAGAATATGTAGACCTTGTAGC AAGTTAACCATCAGTTTTAAGACTCAAATCTTTTTAAATGCTAGTGCCCA GGTCATAGTTCTTTGTGGTATTTTTTCTTAAGCCATAGTAACATTTTTAA GCTTTTTTTTTTCAGAGGAAAATACATTTAATTGGACCAAATATCTTCTT TTGGGAGAAGAACCATTGGAAATTGGTGCCAACATTGACTCAGACCTAGA AGATGTAATAACCACATTAGATTCTGATTTTCTTTTTATGTGCAATAGGC CTTTTCATGAATTATTTTAAGTACAACGACTGCCTCATTTGAAACAATTA CCAAGGTGATCAAATCTCAAGGTGTCAAGTGTTACTTTTTGAATAAAGTT AACTACCAATTACCATAGCAATATTTTGAAAACAAGGTAAGCGTTGCTCA TGACTTAGTTTATGTTATGATATTTACTGAATGTACGAGGTCTATTTGAT TTGGTATTATTACTTTCTCTCTTCTTGGTGAACTGTACTACTTCATGAAA TCTCTTTGTTTTTAGACCTTTTTTGACCCTTTTTTTCAGGACCTTTATGA TAGTGACAATGAAATCTGGGTGAGTGCTTTTGTAAGATTTTTTTATATCA AACCCCTAAATTACAGTCTGGGATTTGGGTCAATATTTTACAGTCAGTAT GTATGTTTCTCATTGTAGAAATGATATTTTATCGTATCCAAATTCTTAAA GTAGTATTAACTTGTAAATGGAGATAAACTTGCTTGACTTAGATATCTAG ATTGTTGGTTTGATTTTTCCACAGCAACTTTCTGAAGATGAAGACAGTGC TGAAGATGATGAAGCTCAACATTTGTATGATGAGGTTTCTGAAATACAAA AACAACTAAAAAAGTTTACTGAAGTCAATCAATATGTCGAGGTAGGCAAT ATTTATTATTTAAACCTTTTGGTTACTCTTAAGTTAAATGTTACTGATAA TTAAAGATTAATAGTCCTCCAATGTAGAATGATCAACGGTCAGTCAAAAT ATTTTTTCAAGATTGTCTATCCTTTAGAAACAATCTTAAATTTCTTATGG AGTTTTTGGTTTGTTTGAAATGAAACATATCTATGTTTAGAATATGTCGG CTGATTGGAAATTGTCTTTAGAAATTTGTTTTTGTTTATCGAAGGCAAAG TATCTCTTTTGTTCAAGGCATTCTATATTGTTGTTTTGCTTTGGATTTGA ATTTTTAATTTGTTTCAGGAGAAAGATTGGTTAAGAGAAAAAGTGGTCCC AGCATATTGGATAGAGAGTGAAAAGTCAACTTTTCCTTTTCATGTACAAG GAATGAAATACATCAACTCTAACAATCAGATGTGCAATAATTGGTAAGCT TCTCAGAGATTCATACTATTTCTTGAAAAGAATACAGTGGTGGATAGTAC GCATTATCAAACTTCTAAAATGATCTGAGGGTCTATTTTTCCAAAATTGC CAGAAAAAGATATATACATTCCAGATTAATCATAAGAGTCACTCGACTTT CCAATACTTTTTCACTAATAAGGAGTTTAAACCTGTTTTTCTCCAGTTTT TGCCACTTTTATGTGTTTTAGTAGTCAAAACAAAGTTGAGCTTTTGAATA AAATTTTTAAAGGCAATGGAAAATTCTAAAAAAATTTCAATTTCCTTTTT AAGAACCTATTATATTGTTAATTTCAAATTAGCAGGCTATAGTGATTAAT CGCCCGCTGAACTTAGAACTTTTACAATAAGTAGAAATTAGTTGTAAGAT TGCATGTGCTATGGAGCCCCCCTCTTAGGTAAAAAAGGATTGCAGCTCAA ATATGCGAGCTCAGAGACAGTGGTACCTACAAAGCTAACTCAATGTCAAA AAGGATAAATGCTTACATATCGTTAAAACTGATATGTTTTTGAAAAATTA TACTTTTAAAGAGATTTTCCTATGATTGAATCTATTCCGACCAGGGGGGG GGTCGGTACTAAAATGTCAGACATATATGAGTACTAAAAGGATTTTCAAG AATTTCTTGCATACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNGCAATTTAACATAGATACCACCCATTTTTTGCC CTTTTACGAGTTTAAATTTACCAAAATGGGGTCATTGTTACAAACCTAGT CGAATTTAGCGCATCAATCTGCGAAATGATATAATTTTATTACTAAACTG TGCTAAACTGTACATAAAAATATTTTAAAAAAAATATTTAAAAAATTGGA AAAATTTTGAAAGATTGTTTCGAAAATTCCTGAAAAAAAAATCAAATTTT TTCCAAAATTGTTAAAAAAATGCTCCATTTTGGCTGATTTTAGAACAAAT ACTAAGATTTTTCAAATATTTCTTTAAGGGACCACCTTTTTGGTATTTTA GTACACATGGTACTAAAATTATTTTTGAGCTTTTTTGCAGTACCACCACG TCACTAAATGTCATGATGTCTGAAATTTTAGTACCGACCCCCCCTGTTCC GAAAACCAAACAAAGAACCCATTATTATAATTTTTACTTGTATCTCTCAC AGGGAACTTTACAAGAATCAATTCACCAAAGTATCTAATGACCCTCAACT GCTGTCTGAAAAAATATTGGTCAGAGAAACAGTTTGGTATGAATATTATT AATTTAGACGATGGTCAGTATGTGACATCTAGGTTTTGGAAGCCAATGCT CTCGCACATTAGGGAGAAGACACTACATTGACTTTTTTNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGTAT TGTTTAGACCTGACGAAGACCTGCACCAAGCAGGTCGAAATATTGTTTAC ACGAAAAATATATACAGAATGACCATTAAAATGTTATTTAAATTATGAAT ATTATTGTATTGTATTGAATTCAAATCATTTTGTTTTAGTATGAATTCAC ATGATAGAAAGTTTACAAAATCCAAATACCTTCTCAGCAATACTTTAAAC GGGCTGAATCATTTGAGTTGTGTGTTAGCATGCATTCATGTCTCTGCATG CATCTAAAATCTCCGAGGAGTTTGATTAACCATACACCTTAAATTTAGAC TTTACTTTTAAATAAGGTGGATAGTACGCCTTATCGCATGTCTAAATTAG CAAAATTTCAGATTTTAATTTTGGGAGTGTGATTGATCACATGCCTATAT TTTTAAAAATTACTCTTTAAGCAGGCTTATTGACTTAGGTTCATACAGTG TTATACTTTGACTTTTCTCTACAAGCATTTCAACTCCTAATTTTCCAAAA CAAATTGGGCTGCTAAAGGAAGACAGTAATTACCATTTGTGTGATTTTTA TTTTGAACATTTTAAGGTAAAAGCTTATGCAACTTTTCATTTCATAGGAT GCTGTTAGGACTTGAAAATCTGCATGTTTATAAATTCACTGGAACTAAAT ATGATGTGAATGAAGACATTGTTATAACACATTTGACAAAGGTAGGTATA CTCCATCAGGTTGTTGGTTAGGACCTTCAAGTCTCAAGACCTGTCTGAAA ATGACCAAAATTCAAAGACATTCAGGACAATAAAACTTAAACACTTGACT CAGCTGAAAAGGGGTGTGGTCTTTTAGAGTCTTAGTTCTAATTTGTTTTC TTTTACATAAAAATAAAAATTTATCGATGTTTGTTCTCATTGCCTTCTTC AAGATGATTATAATTGATTCCAATGTTAAAAGGATTGTTTTGATTGATTG TTTTCACCATTCTTTAGGAAACGCTGAGTAAATTCTTAACAAGTTTCACA GAAGTTGGGACAAAAGTTGTGTTATTGAAACGTTTCACTGAACTTTGTGC ACAGAAATATTCAGAAATACCGAAAACTATTCAAGCCTTTGGATACACTA TATCCAAATACTTATCTGTAAGCTAATTTCCATTTTTTGAATTTAGCTTT TTCTACATCATTTTTTTTTGACTGTTAAAAAAGCCTGATCTTGTCAAAGA ATTGTGAGTTGGGATTACTTTGCAGTACATCATTAGTAATTCAAAACTTT CTCATTATTTTTATTATTTTTTAGAATCGAAGAGAAACTTTAATCGACCT AGAGAAAACGCTCATGGAAAAAGGTTATTCAAATAAGTTTGTAAATGTGT TTTGAGGAATTGAATTTTCACTTAAACCTAAGCTCTTTGCCATCCAATAA CATGTGCTCAACATTTTTATTAATATTTTTATTCACATAGTAAGGAACTC GAGATACTTAGATAGGAAACAAAAAGAAGAAACATTTTTTCTTGTACAAG ATATATATAATATGCACCACTCATCAGAATCAAATATTCGATCCATTGTC ATAATTAGCACAACACATCTTGAGGCTGCATCTGTTATTTTCTAGGAAAA GTAAAAGATCTATTTGTTGGCCTTTCAGAGCTTTAAACCAAATGGTTCAA CACTGAAAGCAACCAAATAATGTCAAATGTGATCCTCCAAGCGATTTTAA GTACATGAAAATCTTTCCGGCAAACATCGGAAAATGATCCGCCAATTTGC CGGCAATAGTANNAGCCGTGACGTCTATTTTTAGAAGGGTGTTTGATANN NNNNATTTGCCGACAATTTGCCGGCCTTATGGATGCCGGTAGACGAAGAA TAAAAACATTCTAACATTACGTAATCAATATATGGTACATATTCCTATAT TCCTATATAACTATGTATCTACATATCCACGTATCTGTGTATCTATGTAT CTACATATCTACGCATCCATGTATCTATGTATCTATGTATCTATATATCT ACATATCCATGTATCTATATATCTACGTATCTGTGTATCTATGTATCTAA ATATCTACGCATCCATGTATCTATGTATCTATGTATCTATATATCTACGC ATCCATGTATCTATGTATATACATATCTACGCATCCATGTATCTATGTAT CTATGCATCTACGCATCCATGTATCTACATATCTACATATCTACGCATCC ATGTATCTATGTATCTAAATATCTACGCATCCATATATCTATGTATCTAT GTATCTATATATCTACGCATCCATGTATCTATGTATCTATTTATCTACGC ATCCATGTATCTATGTATTCATGTATCTATGTACCTACATATCTACGCAT CCATGTATCCATGTATCTACATATCTACGCATCCATGTATCTATGTATCT ATGCATCTACGCATCCATGTATCTACATATCTACATATCTACGCATCCAT GTATCTATGTATCTACATATCTACGCATCCATATATCTATGTATCTATGT ATCTATATATCTACGCATCCATGTATCTNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNGCATCCATGTATCTATGTATCC ATGTATCTATGTATCTACATATCTACGCATCCATGTATCTATGTATCCAT GTATCTATGTATCTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATATCTACGCA TCCATGTATCTATGTATCTATGTATCTATATATCTACGCATCCATGTATC TATGTATCTATGTATCTACGCATCCATGTATCTATGTATATACATATCTA CGCATCCATGTATCTATGTATCTATGCATCTACGCATCCATGTATCTACA TATCTACATATCTACGCATCCATGTATCTATGTATCTAGATATCTACGCA TCCATGTATCTATGTATTCATGTATCTATGTATCTACATATCTACGCATC CATGTATCCATGTATCTATGTATCTACATATCTACGCATCCATGTATCTC TGTATCCATGTATCTATGTATCTAGATATCTACGCATCCATGTATCTCTG TATCCATGTATCTATGTATCTAGATATCTACGCATCCATGTATCTCTGTA TCCATGTATCTATGTATCTAGATATCTACGCATCCATGTATCTCTGTATC CATGTATCTATGTATCTAGATATCTACGCATCCATGTATCTCTGTATCCA TGTATCTATGTATCTAGATATCTACGCATCCATGTATCTCTGTATCCATG TATCTATGTATCTAGATATCTACGCATCCATGTATCTCTGTATCCATGTA TCTATGTATCTAGATATCTACGCATCCATGTATCTCTGTATCCATGTATC TATGTATCTAGATATCTACGCATCCATGTATCTCTGTATCCATGTATCTA TGTATCTAGATATCTACGCATCCATGTATCTCTGTATCCATGTATCTATG TATCTAGATATCTACGCATCCATGTATCTCTGTATCCATGTATCTATGTA TCTAGATATCTACGCATCCATGTATCTATGTATCTATGTATCTACGCATC CATGTATCTATGTATATACATATCTACGCATCCATGTATCTATGTATCTA TTCATCTACGCATCCATGTATCTACATATCTACATATCTACGCATCCATG TATCTATGTATCTAAATATCTACGCATCCATGTATCTATGTATCTACATA TCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNCTACGCATCCATGTATCTATGTATTCATGTATCTATGTATCTA CATATCTACGCATCCATGTATCCATGTATCTATGTATCTACATATCTACG CATCCATGTATCTATGTATCCATGTATCTATGTNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGTATCTATGTATTCATGTA TCTATGTATCTACATATCTACGCATCCATGTATCCATGTATCTATGTATC TACATATCTAAGCATCCATGTATCTATGTATCCATGTATCTATGTATCTA CATATCTACGCATCCATGTATCTACTAGATGCGTAGATATATAGATACAT AGATACATAATGCATAATACATAGATGCGTAGATACATAGATACATGGAT ACATGGATGTGTAGATATGTAGATACATAGATACATGGATGCGTAGATAT GCAGATATATAGATACATAGATATATTGATACATGGATATGTAGATATAT AGATACATAGATACATAGATACATGGATGCGTAGATACATAGATACATTG ATACATGGATGCGTAGATATGTAGATACATAGATACATGGATGCGTAGAT ATATAGATACATAGATACATAGATACATGGATGCGTAGATACATAGATAC ATTGATACATGGATGCGTAGATATGTAGATACATACATACATAGATACAT GGATATGTATCTATATGGATACATAGATACATGGATACATAGATACATGG ATGCGTAGATACATAGATACATAGATACATGGATGCATAGATACATAGAT ACATGGATACATGGATGCGTAGATACATAGATACATAGATACATGGATAC ATGGATGCGTAGATATATAGATACATAGATACATGGATGCGTAGATATAT AGATACATAGATACATGGATGCGTAGATACATAGATACATAGATACATGG ATGCGTAGATATGTAGATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNCATAGATACGTGGATATGTAGATACATAGATGTGTA GATATGTAGATATATAGATACATGGATGCGTAGATATGTAGATACATAGA TACATAGATACGTGGATGCGTAGATACGTAGATATATAGATACATGGATA TGTAGATTATATAGATACATAGATACATGGATACATGGATGCGTAGATAT ATAGATACATAGATACATGGATGCGTAGATACCTAGATACATAGATACAT GGATATGTAGATATATAGATACATAGATACGTGGATATGTAGATACATAG ATGTGTAGATATGTAGATATATAGATACATGGATGCGTAGATATGTAGAT ACATAGATACATAGATACGTGGATGCGTAGATACGTAGATATATAGATAC ATGGATATGTAGATTATATAGATACATAGATACATAGATACATAGATACG TGGATACGTGGATATGTAGATACATAGATATGTAGATTATATAGATACAT AGATACATAGATACGTGGATATGTAGATACATAGATACATGGATGCGTAG ATACATAGATACATAGATACATGGATACATGGATGCGTAGATATATAGAT ACATAGATACATGGATGCGTAGATACATAGATACATAGATACATGGATGC GTAGATATATAGATACATAGATACATGGATGCGTAGATACATAGATACAT AGATACATGGATGCGTAGATACATAGATACATAGATACATGGATGCATAG ATATATAGATACATAGATACATGGATGCGTAGATACATAGATGNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNTGCGTAGATATGTAGATACATAG ATACATAGATACGTGGATACATAGATGTGTAGATGTGTAGATATGTAGAT ACATAGATACATGGATGCGTAGATACATGGATATTTAGATACATACATAC ATGGATGCGTAGATATATAGATACATATATACATGGATGCGTAGATACAT AGATACATAGATACATAGATACATGGATGCGTAGATACATAGATACATAG ATACATGGATGCGTAGATACATAGATACATGGATACATGGATGCATAGAT ACATAGATACATGGATACATAGATGCGTTGATATATAGATACATGGATGC GTAGATACATAGATACATAGATACATGGATGCGTAGATATGTAGATATAT AGATACATAGATACATAGATACATGGATATTTAGATACATAGATACATAG ATACATTGATATGTAGATACATAGATACATAGATACATAGATGCATGGAT GCGTAGATATGTAGATACATAGATACATGGATGCATAGATGTCTAAAATG GCTACTTTTCGTGAGACAAGGCAAACTATTCTCACGGCAGCCGAAATAAG TGACGCAATCAGCTCGTGCCGATATTTTGCCGCTGTCAAAAATCTGAAGT CGCGCTGAAGATCGGCAATTTAGCCGGCAGATTGCCGGTCTACCATTGAG CGGTAATTTGCCGGTAATTTGCCGGTGATGATTTAAACAAGATCGGCAAG ATCGGTAAATTATACGCCAATTTGCCGGCAATAATGTTACCGCTTCTTTG CCGGTAACAATTTCGTGTCTTTGATATCGCTTGGAGGGTCACAAATAACG GTCACATTTTTTACTACGCTATAACATTGTTTATTTCTCTTAGACAATGC GACAACCCTGTTAACTCTAAAAGATGATCTTGCTGATGATATCTCAAAGG TAAAGTAAAAATAGCTTAATTAAAAAACCCTACAATAAAGGGTTTTCATC TTACTTAGCGTATAAAACTACCGGGTGGCCCAAAAAAAACTTGATTATAC TAAAAACATTACTCTGCCTAAATCTCTATCAATTTTTTTTTTGAAAGATG AAAAGACTAGACCGTTTTGACTGTTTGAAATAGTGTTTCTCAGATTAACA AAGTAGAATTTTTTACATTTACGTTTTAACATGAAATAAAAACATACATT AAATTCACATAACAATGTACTCCTTCTTATTTACACTTCTTAATTGCAGG TCAATTTCATCTACAAGATATACAACCATGCTGTTGTAGAGGGACATGAA AAGTATTTCACTGTGACAGAGGTATAATTCTTTTCACAATTTGTAGGTTG GTCCACAGATTTCTGTAAAGCCTGAAGGGCTATATAGAGTGCTTTGGTTG AAAAGTGTCACGTGACATTGTAAAAGAATTTCAGCAATTTGCTTGTTTTC AAAAACAATAGCTCAGCAATGTTTTTTGCGATATTCACCTTTTTTATTGC TTGGAAAGGCTTATGGTATGTCATCCAGCCCTTCGGGCTTTATAGAAATG TGTGGGTTGGTTATGATGAAAAAGGACAAAAAAATGTAAACCTTGATCAA CTTGATAACTACAAAAGTTTTTGAGGTTCTATAGATGATAAACAATACCA ATATCAGAATTTCAAATGCTGGCAGTCTTTAAATTTATGATGTAATTTCA AGTAAGATGTTCTATCCCAATCAGTCTTATAATACACTCTCTTTCTTTTC TTTTCTTTTTTTTCAGCGAGTTGTTCATTTTTTGGACGTATTTTATGATT TTGTTTGTACTCTTGACAATATGGGTGATTCTGGTACTGAAAAGGTTTGC CAAATTATTCCTGCCCAATTAGAATTTGCCTTAATTTAAATTATGTTCTG TTTTCTTTCTTCTGGACCAACAGCACGCATAAATTACTTGCTAGGGCTAA TTTTGCAACTAATAAAGACTTGAAGTTTTGATTTTTGAGCATTGTTATTA TTTACTCTACCTGAAGTTTATTTTTTCTTCTTCGTTTTTCACCTTTATTT TTAAATTTCTTTCAAAATTTTCACTCAAAATTATTTTTTCAACCAAAAAA AAAACCAAACTTTTTCAAACTCTATCAAAAGCTAAAATTCGATTTTAAAT TTTATTGGAACTAATTAAAAAAAAGACTTGATCCACATTCCATTTTTTAA TCGTGACCTTATCTTACCATCTTCATTCTCAGATGATGTTAGTGCTACCA ATGTTTCTTGAAGTCTGTCGACCGTACTTGGAAGATGTTGGGTGTTGGAT GGCCACTGGGCAGTTACCAAGAGATGAAGAATTTATGATTTACAGGTAGT CTATTGAAAAGGATTAAACACAGAATTTGGCTTAGGATCAACTTCCAGTT GGGTGATATCAAAGGAAAAATGGTACTCGATATAAGTGGAAAATGAAAGT AGTGACACCCTCCCTTACCTTCAGGAAGACAGCCTCGACTGCGGACGCAA ACTTACATACTTTATTAGCAACATTAAAGCTCTGGTCTAGTTCCAAGTAA TGGTGTTTAAAACCAAGCTCACTAATTAGGATTTAAGCTCGAATATTTAA AGAGCGATGTCTACCGGCGCACAGCTTACCCGGTTGTCTACTAGAACATG CATACTGACATTTTATATACTATCAATTTATTTTGAATAACTGATATATT ATGATATTTTTATTTTAGGACTCAAAATCAAGTTCAAGGTGAAACGCGGT ATTGGCATGAACTATTCTTAATAAGAGGTATCAAATTTGAGTATCAAGTT TTGTTCTCTTAGACGATTTTTAAAAATTTCTTCATAATAATATGATAACA TTTTGTTTATTTGCCATAAAAGTAAAGTAATATAGTTAAGTAAAATATGT AAATTTTATAAGATAATTCACACATGTTTTTTTTTATAAGCATACAAAAA TCCGAAAACAGGCTCAGAGATGCTTAGGTCGAAAGCTTAATAAGGCTGAA AAATGCTTGAGGGGATGCTTAAATCTAAAGCATAAATTTAGGGAAATACT GTAAATCCGTAAAATTCCAGCCAAAAAAAGCCAAAATCAGGAAAAAAAAC ATTTTTCGTAGGCTCAAGTAATGCTTGCCATATGCTTAATTTTTCCCCAT ATCTGAGCCTAGATATGCTTATAAGTGCAACGATAAGTGCAAAAAAACAT GTATGTCGCCACTGTTTAAGGATTGGATTTTAATCTATGATATCTATGAC ATCACTATTCGCCAATGCCAAAAAAGATCTTCACGGCTGTCTTTCATTTT AGAAAATAGATCCACTGATGGAAAATCAAGTAAACTTGTACCCAGATTCC TTGAGAAACTTCAAAAACAGGTAAATCTAGCTGAACATAATACTCAAGAG GAGGCCTGTACCCCCCTTTTAGAGCCACTCATCGCTTCTCGATTACTCCC TTTTAACAGAACTTACCCCTCCCCGACGATACCTTTATTTATTGGATTTA GCATATGAAGGCCAGAATTTACCACTAACACCAATCTTTTAACCTTTTAA AGCTTAAAGTGGCTCTAAAGAAGTTTTTTGCTAAATATAGAAAAATCTTT TGAAAGATTTGAGAGCTCTGCTACAAATTGTTTTTAAAAGTCATTTACCC TTCTCTTTTAAAATCTACCTTTCCTTTGTTACTAACCTCCCCTTTATATT CTTTACCTCTACCCTTTATTGGTTTTTGTGATGGCTAAACCTTTTCTTTT AGAAATCAAACTGAAAATCCAAAGATAGGAAGAGACAGGCTACTGTACTG TTAAAACTTTTTGGAACGATGAAATATACTTAATGTTCCCTCTAGAGATG GGAAAGAAGTGGTAGAAGAACAAAATAATAGTACCTGAAATTAAGTTTAA ATTATTTTCTCTTTTTGTTTAGATTTTAGTTTCTGGAAAGTCGCTTGGTC TTTTGGAAGAATTTGTCGAGGTAATCCTTTAACAGCCTATAGTTTAAAAC ATAAATGAAGATTTTATCAAAAACATTCGATTTTATCAAAAACATTCGAT TTTATCAAAAACATTCGATTTTATCAAAAACATTCGATTTTCGAAGGTCC TACGTTCGAATGACGTAATAAGATTGGAATGTCAGATACATCGTCAAGAA AATTGCAGATTCTTCTGCAACAAAATCAGTTCAAACTGATTTTGTTGCAG ACACTTGCAATTTATTCTGCAATATTTTTATGGCGTTGCAGAGCAATTGC AGAAAAAATTGACGTGCTACATTTTGCAATTTCTCGCGCGCTTGCAACGC AACGCTAATTGCATTGCAGCCGCCTGAAAAAAACTATCAGTGTAGCCTTA GCTTTACTCAAAATTGATGCATGTATAATTAACTTTTTTCGTCCTAATGA TGACTAGAAAGCCAACTTTTAACATCACGTGTCATTCTTCTTTCTTGCTT TGAATTTGGAAGAGATACAAGATGCATTTACATTTGGAGTAACTTTCTAG TTACTTATTTTTAAGGTAAATTTATAACTCATCTTTTAGTTCACCTCGAC TGTCGTTGCTACCGACTCCTTATATGAAGAATTTAAACGCAGTTTGAAAA TCAACATCCAAAAATCGAACGAACGTTACCGCCACACCCATGCACTTGAT AGTACCGATCATATACCTGGAGACGCCGTATCGGAATATATTTCTGACAG TGGTATCGATCCGTTGTTGAGAGCCAATTTTCACATCATGTTTAATAATG TTTATCAAAGAATGAAAACGAACAAAGAACAAATCGCTGTCGAAAGGTAA TTGACAAGCTTTTAACGAGATTATTTACCTCCAATTAGGGCTTAAAGTAA AACTTAAGAAATTATTGAGTGCAATTTGAGAATGAGAGTAAAGTATGAGT AAGGAGAATCCCTCATTTTCTACACTTCGTGATACAGTGTTATCTCTTTA ACTCGAACCTCTATAACTCGAATGTCTCCTTAACTCGAACAAGTTTTCTA TTCCCTTATAACCATAACCTTACTCTTTAACCCAAAATTTCCTAAACTCG AACAAATTTATGTTCCCCGTGCGTGTTCGAGTCCACTGTAGTTGGATAAA ACTCGCTTACTTTTTTAGAATACGTCAACATGTTACAGCTCTTTATTATT CTTGGACAAAGTTTATTTGTTAGTTAGAAACAAAGTTAGTCTCTAAATTA GCCAATAAAATAGCTTCATTCACACCCCTTTCATGAAATAAACATTAAAA TCGATTGATTTATTTGATTGTCTGCTTTTTAGTGGAAAAGAAGAGATTCA AGACCTTGCTATTCTACTAAGTAAGTCCATCAATTTACTTTTTTATCATC CTGGTTACAGCATAGCTTCAGCCCCCCCTGCTAGTTGGGGGGGGGTTGCA CCCTCCAAAAAGCCAAAAAAGGGTGGGTGCTTAAGGTGTTTCAAATATTT GGGGGGACCTAATGTACTTTGGGGGGGGGAGCTGAAATCTCATCATTTAA CGTGGGGGCTGAATACTTCATCTTAATGGTTGGCTTCAATTACTCAAATT AAAGCTCACGAAGCTGAAAACTTTAAAACCAGGCTGACGCTATGTTACAT TGTTACGATATGCAGTGTTCCCGAAAAAAGCATCTTTACATTAAGTAATC TTCATAATTTATGCCCAATGTATGACTTGAATACTTAATATTTTAATCTC AAAAACCTAATTATTGAACAGAGAATTGTTCCTGTAGGCCACCCATGAAA CAACTCATTTTTGTTAAATTTCTTTTTCCCCTTTTTATTGGACCTACCTC GGAGGTCCTTTAATTTAACCTTTGTCCGTCCGTCCGTCCGTCCGTCTGTT ACCAGCTTGTCTCGAAATTGGATCATTAGTTTTTTCTGATTTTTGGCACA AAGTTGCAAAATGGCAATGCCCAAAATGTGACGGAGCCCGATTTTCGAAA AAAAAAAATTTCCGGCCAAAAATACCGGAAATATGCCGGAAAAACTGTTT TTTTGGCATTTTCTCGAGATTTTATCATTAGTTTTTTCTGATTTTTTGCT CAAAGATGCGTATTAACAATGCTTAAAGCATGGTCGAGTCCGATTTTTGA GAGTAATTTTTTTCCTACCGAAAATGCCGGAAATCGCCGTTTTTCTGGAT TTCATTGGACTTTTTCCTTATAATTGGGTGTTTTTTCATTCAAAAACATT ATTAATAGCAATGCCCACCATCAAGTATATTTTAATTTTCAATAAAATTG ATTTTTGAAGCTGGAACTATTTATAAATCGCCGGAACAACCTATTTTCGC CGGAAAGACAGTATTTCTTGAATTTCTCGAGCTGTACTTTATATTTTTTT ATGAAATTTTGCACACTGATGCAAAATGACAATACCTAAAATGTGACCGA GCCCGATTTTCTAAAACAATTTTTTTCCGGCCGAAAATGCCGGAAATATG CTGGAAAAACCGGTTTTTTGACATTTTCTCGAATTTTCATCCTTAGTTTT TTCTGATTTTTTGCACAGTGATGCAAAATGGTGATTCCCGAAAAGTGAAT TAGCTCGATTTTCGAAAAAAAGATTTTCCCGCAGAAAATGTCGGAATATG CCAGAATAACCGGTTCTTTGGCACTTTCTCAAGATTTCATCATTATAGTT TTTTCTGATTTTTTGCACAAAGATGCGTATTAGCAATGCCCAAAACATAA CCTATTCGGATTTTTGAGCAAATTTTTTTCCGGCCGAAAATGCCAGAAAT ATGCCGGAAATTGTCGTTTTTTCAGATTTTTATTGGACTTTTTCCTCATA TTTTTTTGTTTTTTTTTTCACACAAAAACATTATTGATAATAATGCCCAC CATCAAGCATGATTCAGTTGTCATTAAAACTGATTTTTGCAACCGGAGCT TTCTATTTTTTCCCTACTCCCCTTCCCTCTCCCCCAATCAACAATCAATG ATAAAATTTGCTAAACGCTATATTTTCTGACTGATGGTTTTCATTTTTCT CCTCGCATTGCTATCTAACTTTCATCATCAAGTAGGTCCATTCAGCATCT AGCTTGTTTTCATTAGGAGATTGTTCCTGTAGGCCACCAATGAAGCGAAT TATTGATCAAAGTTTATCACCTGTCGTTCTTGGTCGTTATGGAAAGGTAT CGTGTCATTTCTAATTGCTATCCCAAGTGTTATCCTTCGCAACTAGGGTT TCAAAGATCAAAACAGTATCTAAAAAGTCGAACAATTTCTGCCACTGACA AAAAGTTTTATATTTTCGACGATTAAAATTTGTCTTAGCTTTTTAATGTG CAAGCTTCTCTGGATTTTCCAAACTTTGTATTTACTCTTTATTATTTAAC AGGCTTGCGTGGTATTATTAGAACTTTTCAAGAAAGAAATGAAGTTCCTT GATCATCTAGCTGTAATGAAGGTGGGATGTTATATCCATATCCGATAAAA TACATCTATTAACCACAAAGAGGTTTGGGTCAAATTAAACTTCCCATCAT TTGGTCTGTTAGACAGCCACCTCAGATAAAAGTGAAAGTCAATAACTCTC TCTAATCCTCAAGGGACTAAGATTTTTCTTCGGATTAGAGAAAGATTTGA ATTATAGAGAGCGTTTAAGACTACTTCTAGCTATGGAGACCAATATTTTA GTTTAAATTATAGAAAGATTCTAATCGTCTCGAATCTCGAATTAATGGGA TTCGACTTATTAAAATATGTGAGCTGTTGCTATACACTTCTACAAATAAT TACAAACTTTCCATTAAGTATGAAAACATGTCAATATTGCTCCTTTCAAG ACAGGTCTCCGTGAAGAAACAAATCTTCTTTTTTTCGTATTATCAATCAT CATTCATCAATTAATTGAAAGAAATTTTTTTTATCATTTACAGAATTTCT TCTTGATGCAGGCTACTGGAGAAATGTATGAATTTTACACAGACATTTTT GAAAAGGTAAGGCCGAACGAAATTTAGGTAGAGTTGATTTTTTTACGTGG ATAGCCCAGTAATCCAAGACTTTAGGAGAGTCTTTGATCAGCCAGTTCGG CTATCTATGAACTGGACAGGACATTGGAAGGAGTGGGAATTTGAGCTCTC CCCTGGTTTATCGATTTGACGATTCGGCTATTTTCCCCTATTTTATTTTC TCTTCCTCTCAAATTTTTATTGAAGCATGTTAATAATTTTACAATATTTT TCAGGCAAAGCATGGTCGATATTGGAGGGACATGTCTTACTTAAACATTG TACTCCAAGATGCACTACAAGTCAACTATCCAAAACTTATGGGAAAGTAA GTAGAGTCTACATTGGAGTCTTCAAAACATGAACCTCTATAACTCGAACG AACAAATTTATTGATCCTTTGAGTTGAAAACCTCCATAACTCGAAACTTC CACAATTCGAACAAATTTGTCTTCCCCTTGTGTGTTCGAGTTATGAAGAC TCCACTGAAGATTTTATGTTAGTCAGTTCAACCATTTTCTGATATTTTTT TCATAGTGAAATATTATAGTCAAAAGTGTGTTTTACCCAAGAACAATTTC AAGAAACATTTCAAGTTTTGATTTGATTAAACAGGTTTCATTGATTTGTT ATTGGAAATTTATGAAACATGGACCCATTAAAATTTATTTTATTGGCAGC ACTACATAAGTCTTTATTTTTGATTTCCTATAGTCTGACAGTGGATTATT ATTCATCCAAAAACAATCTATCGAACGCTCAATTATTCGATGGTTTGTCA CTACACTATAAGGTAAGACTATTGAAAACCCTGTCTTCTTAACAACGGTT ACAAGCCTATACTTCTTAAGTCAACCTTCCACTCAATGGCGAATTCCCTA AATGTGCCTGCTAAACAACAGGTACTCTATACGAAAACGACACTCGCCAA TATATTGCCGACACTCACCAATATATTGCCAACACTCACCAATATATTTC CGACACTCGCCAACATATTGTGCAGTGTATGTATACCTTTGCGATATTTA CTCTCCATCTTAGGTTCCTTGGCCAGTGTCTATTGTTCTGGATCAACATG CTGAAGATAAATATAATGAAGTCTTCCGATTCTTATTCAAAGTCAAACGA GCTATATGGGTTCTGGAGCAGCTCAGATTTCAAGGTTTGTAAGCTAACCT GGTTTCTCTAATTCTGTTTATGATATGTCTTGCTCATAAAGTTTTCCTTA AATATCCAAATCAAATTTCCATAATATACAGTATTGAGTTTTATACTCAC AAGACCAGAGCGATGATCTTAAGGGTCTTTAGGCTAATGAAACAATTCAA TTAGCGTTGATGACCGGACAAGTACCACCTTCACTCACATGTTTCTATTA AATTGCTTAAAATCTACACATATAGAACTCGTATACCAGTGCTCAGATTC GCAAGGTCATAGCGAGTCTTAGGGTGAGGCTATCGGATAGAATCTCTTGG CAAACTCAATCAATTTATCTTATGACTGAATAGGTTATGTACGCCAAATT GTANATAGAATCTCTTGGCAAACTTAATCAATTTATCTTATGACTGAATA GGTTCTGTACGCCAAATTGTTCAAAATCTACACGTTTAGAACTTGTATAC CCGTGCTCAGATTCGCAAGGTCATAGCGAGTCTTAGGGTGAGGCTATCGG ATAGAATCTCTTGACAAACTCAATCAATTTACTTCATGACTAGAATTGAT ATGTACCGTACATGAACTTCCGTTAACTTGTTCAAAATCTACACATTTAG AACTCGTATACCAGGGCTCATATTCGCAAGACCATAGCGATTCTGAGGAC GAAGGAATTGACTACAACACGACAACATCCACTACAAGGAGAGGCTTAAA ACAACACGTGCTGAAAGATATGATACTGAGTGGTGCCCATCAAAAATTGA AGAATAGGATATTAGTATTGAGAATGAAGATGTTACATGTTGTACGAAGT TTCCATTTCTACCTCATGACAAGGGTGAGAAAGTTTTCTCCAATGGATCT TCTAGTTTTTCTCAGCACACATTGGGCTTCTCCAGAAAAAAATTGAATAT GCAGGGGGTGGAGGATATAACAATTTTCAGTGATTTACCCCCAGAAAAAG TGACTTTTGGCCCCGGACAACGGGTTTTACCCGTAGACAAGCCAAATTAC CCCCGGACAGAGCAAATTTACCCCCCGGATAAGACAAATTTTATGATTTT TCGCTACCCCAGGGACAATGATTCCTACACCCCCCCCCAATTTTTCAGAG GAATGGGAACGGTTTGTTACTTGTTGACTGATTTGTCTTCAAAGTTAGGT AACTCAGTCGACATTTTTTACAGTGATGATTAATAAGATTGGGCCTTCGT AAACTTCGTAAAACCTACCGTATTTTGCCTTCAGGGAAGGGCGTTTATTC GAGAGGGCGTTTAAAAGAAGGGGGTATTTATTCAAAGTAATGCGATAACT AAATATAAAGAAATTAGAGATCTGTAGAACTTCGCCCTCTTTATTGAAGA ACTTTCATGTATGTTGTTGTTTCTTAGATCGACGATAGTATCCATCAAGA GTTTCGTGTTGAATCGGTGAGTATGCTTGTTATCTGAGATTTAATAGTAA TATCACTTACACAGAAACGTTATTGCATCATACGACGAAGAATTGATTTT ACTTGTTGTAAATAGTTTTGCCGTGTTCTCCATCAAGCCCAGATCTACTC TTAACATGGTTTGTATTTTAAACTGTGTACAATATTATTTCGTTTTCTTT TAGGCAAGAGATTTGGACGAGATTCTGGAGTTCCATCAAAAGTTTTTGTT TTCTTTGAGACAAAGATGCTTCTTACACGAAAAGGTTTGACTTTCAGCAC TGACATGAAAAAGACTTTTACTTCGAAAAATCTTTTGATTTTAGGTATAA TGTCAGTTGTCCTTTTTGGACCTCACCCCTCATTTTTCCAAATGGATCCC TAGCTGAAATGAGAATTTGAATGACAGCAAAGTCAATTTCCATATGGAAC TAAAAATTTTTGTGATTATCCCAACGGCGACGAAATTGTGGCCAAATAAT AACAAAAAATCGAAATTTTTGATGGTATTTTGTTTTTTTATTTTTTGATG TTATGTATTATATGGAATGGGTTTGCTAATGGACTTATTCCCACCACTCG GATGGCTGGAAGTGGTGGCCGTTTGGGTAGATTTTAGTGATGTCTTGTTG TCGTCCATTGATAATACAGATGTGTAACTTGTTCTTCCCATTCTTAACAC GAACATCTTGAGACGGTCTTGGAACTTGTTCGTCTACAACTAATTTTGCT GTCTGCACTACTTGATTTTGTGCAACTTTTTCCTCATTCGGTTTTTTCGT TGTCAACCAAGGATGTGTCAAAACTTCATCCAAGCAAGGATGCTCTTTTC GCTGGATCCTTTTCCAAAAGGCGACCGAGAAGATGAAGACATTCTAAAGT GAAAATGAAACAAAATGTATTTTTGATCATTTAAAACACTTTTGCCTATA GAATCTGAATTCTTGATATTCATAATGCAATCTTTTACACGGAAAAACTC GAAAAACACCGAGCCAAACGTTTTATTTTGTTTAGAATCTCAAAAGTGTT GGCAAACGCTTGTTTTCTTGTTGACTAGATATCACCAGAAGGTCACTAAA AACGCCGTGGCCCACGCGCTCCAGAGGCGTTTCAATCGGGCATATTTATA CTACAACTGTTTGATGTTTTTCTTGTGTAGCCTTACAGAATCAAGGCGAG CCTCAAAGGAAAGAAAAAGAACTGTTTGTGTTTACCTTGGGACAACGAAA CTTCTGCTGGTAGTCTCCCCGCGAAACTTTTTTTCTCAATCAAGTTGCTC AGTATTCTCCATTCAAATGCTGGGTATGGTCGCTTACCAGTCAGCAGCTC AAACAGGATGATACCGCTAAAAATTGTAAATTTCGATAAGATAATAAGAT TTTATAGGAACCAGTAATTTTTGGTTCAAACTCTTCTGTTTTGTGATGAT TTTCAGACTTGATGTTTTTAAAATCCTCTAATTACGTTTACTTTATCATC TTATTATCTGAGAAGGGGCATATTTTAAATTGTTCTTAGGTTTTTGTTAA AATCGAGCCTCATATTCTTATAAAATGGTCCACTAAGAAGAAATAACACG AAAAAGAATAGAATTGTCAAATTTGAAATCAACTTACAGACTCAAATTGC CATCATAGCGGATTCCGTCTCCAAGATAACCTCGAATCATTTCAGGTGCC ATGTAAGACGCTGTCCCACAGTAGCTACTCAAAAGACCATCAAGGCTATC TTCAAAGAATTCGGAGACTCCAAAGGAAATAGAATATAGAAATTTGATAA GCAAAGGAAATAGAATTACAAAAAAGAATTTTGCAAAATGTCGCATCAAA ACGATGTTCAAATAACGTCTATAAGAAGCTCAAAAGGGTGAGTTTATTGC GGAGTTGAAACGGTATAAAGTATTGCATTCATTAAACTGTTGCAATTGAA AGAAATGTTCTTGAAATCATACACTGTTATAGTTGGGCAATTTCGTTGAC ATAACTCTCAAAAAGTTATGTTATAAAATGCGGATGTTTTATTTGGTATA AAAAACCTTACCAGCTATTTTCAATTCGCCATTTTTGTCAACAAAGATGT TCTCCATCTTTAAGTCGCTGAAAAAAAGTGAAAATATTAACATCAACTTC GACCGCAGCAGAATCTGATAGGCGGAATCATAACTAGTGAGATAAATCGA ATGGCTGTCTAAACCGAATGACTGTCTAAAATCCTAAATTAGAGTGAAAC ATCTAAATAAATAAAATAAATGGTAAAGATCGTAATATAACTTTATTATC AACCTACCGATGACAAATTCCAAGTTGGTGACATTCGTTGACACCTTTGA CAAGAATTTTGAACAATTCCTTTGCTTTTTGCTCCTCGACGAATGGAGCT GATGATAAGTAATGGCTTAAAACACCATTGTGACAATATTCCATTACTAT GTAGGAATTCTTTTTTCCGTCAAATCTGGTGTAAACTTCAACCTGGAGAT TATGAATGAATATAAAGTGTGATTTTCAAGCTAACCAATTTAACGGAATC AACTTTCGTTTTTGGCGTATGTTTAGCCGTCAATAATATTCCTCTAATAT TTTTTTGAATTATTAGAAATTATAAATACCACTCGTAAAAACGTTCATAG TCTTTCATATAATCAGGTGATGATCGTACTTTGCCTAGATTAGGGTTAAA CTGTTCAAGTTTTAAAACTCATTGAAACTATTGAGGCGTTTGTGGTTTAG TAGTCATTGACCTTGGTTGCTACATAGGCGACTGAAGTTTGATTCCCACT CGACAAGTGAACGTACCTTTGACGTACCTTTGACAAAACTAATTAAAAGA CATTGACTTACGACATTGGACGATGTCTTCGCTCTAAGCATGGCTTCGTA CTCCTTACGGATAAGGTTTTTGTTTTTTCGTGGCATGATTTTAATGGCCA CCTAAAGAATGATAGAGAAAACCGTACTTGAGAATTTCTTATAACAATGA TGTCTAGAGATGATGAAAGTTAGCCAAAGCCTAGTTTTTGGCAACGATAG CCCGTATCCTAGTGGTATTCAGGAACGTTGATTTCGAACACGAAATTTCT TACACTTTAAATCGGATCAGCCAAACATTTCATTAAACCAGAAATCCGCG AATAGTTGGGCGAGCCTAAGCTACTTATACTGTCAGTTGCGTTGATCCAT GGAGGTAATAAAAATATAACTATCTACATCCGCAGATAGTTGGGTTTTAG TAAGCGAGCCTAGGCTATTTATACTGTCAGTTGCGTTGAGCTAATAATCA TTATGAAAACAATTAACTTACTTTATTTGTACCCTTGGAACGAAGCTTTG CGGCAAGAGCGTCACCGGGAACATTCAAATTGACATAAGTTGCCAACCGA ACTTTCCCATAGGCACCTTCGCCCAAAGTCCGTCCCAAGCGGAAACCTTG AAAGACACACTCTATTTCGTATGTGTTCATATTGTTTTATCGATTTTATC AGTGATTTACTTTTAGTTTTCTTTCCCTCTCTTTATTCGCTCTATGCGAT CCTTTGAACCAGCTAGCTCAAAGGTTGGTCGGATTCGATAAGAAATTCGC TTTTCAAAATACTTTTAAAAAGTACTCAATTTTTATTTGACGTCAAATGA AATGTAATATCTTTCAGAAAATGACGTCAAATTTGATAGCAGTGTAACAC GCTACGTAGCTTCTAAACTACTTTGTTGAAAGCTGAATACGCCTGCCTTA TCATTGGTCACTTTTACAACCAGCACTCCATGAAACAATAGTTATCTTTT TGATTCCAGAAAAGTAAACTATACTAAAAAAAAGCTTCGGAATATAAGTG AAAATAGATACCTATATATATACATGGATTCATGTATAAAACACTAAATT TGGTCATTTAGTTCTGTTATTACGGGATTATTAGGTTTTGCCTGGAAAGG CTTATGATGACGTCATCACTAAACTTTCAATCTCCATAACTTTTAATAGG AAGATTTTCAAGGCATGTTTTATATCTCAACTTTCATTAGCATTTCATGT TCTTTCCGCTGAAACCGTCAGATTTCTTTCCGCTGAAACCATCAGATTTT GAATATTTTCAAAAAAATAAATTTTTGCCCAGCCACCTGATGACGTCATC TGGCAGGTGACCAGGAAGGACAATTTGGTGTTACTGTTTAAAATTAAGTT TTAGACTCTTTAAGGATCGTCTGTGCCAAATTTCATGCTTTTATCACAAT CTGAAGTATTTTTGTGCTAACAGACCTCACTATGAATATTTCTTGCCTGT ACAATAAAAAATTGCTGTTAGAAAGTTTCAATACACCTTTTCAAAGCAAG GTCGAGGGCAAGGTTCTCTAAAAAGTGGCTGAAGCAGTTTCTCTAAAAAG TGGCTGAAGCAGTTTTTTTCGAAAAATTTTTTTTGGTCGTAAAAATTGGA TTTTCTTATTTTGGGAAATTCCCTATGTCATTTTGAGTGAAAAAGATCTT TCTCGCGATTGGATTGATATTTTTTGCATAGTGATATAAAATGGTAATAA TATTTAATTGTTGGAGCCCGATTTTCGATATTAATTTGAGCTGTGATACT CACGGCAATCTATTCAAGCTGCTCACTACACTTTTTTACTCTCTTGCTTT TGTCCTATTTTTGCCTGATTCTCATCATCAGGTAGGTCTATTCAGCATGT TGCTCTTTTATCCTTTCTGTCCAGAATTTATTTTTAGCAAGTTCTAGTCC TAACGTTATCGAAATTATGTTTAAATTAAAATATCGGAATATCTTTCGCA CACGAAATTTCACGACTGTTCATTTCCCATTCAGGTTGCTCGTACCAAAG ATGCTCTCGTGCGAATTTTGAATCTTTCTTTTGAGCTGGAAGAACTTTGG AGATCAAGCGTTGCTGTATTAAAGTAAGTTCGAATCAATTTAACAAGGCA AGACGTTCACTGAATACAACGTTCACTCAAACAGATAGATACTCAACCCA ACCCAAAAAATTTAATTGGGTGTTGAGGATAATAGATATTGAGTCTTTAT ACCCCTCCCTGTACAACTTAAAAAGATGTGATATCTCGATGAATAGATTC CGTATTACTTCGAATAAGCGCCCCTATTTGAATCAATTAGTTGTAAGTGA GCGAGAATCATATAGAGGAAAACGTAAATATGTGTTCATAATTGTATTCA ATTAGTATTTTAACTAAGTTTGACCCATCTCTAAAATGACATATTTGAAC TGAAAAATAACGAAAAGGCAAAACAAGGTTCCCATTCCCTTTACTAAAGT GACCTTTGCTAAAGATTATTTTAATAAACGCTCCCGCGATTAAACACCCC TCCTAAAATCCAAAAAAGGCGTTTATTCGAAGTAATACAGTATCTATAAA ACTGATTAAAATTTTACTCTCTACTTCTTCTTCAGCGTGAACCAACTGAT GGCGTTAGAAAAAGAATTCTTCCGATGCACATCGTTTTTACATTCATTCT TTACAACTTTGTCCAAGAGAGGCTCCTTTCCACATTGTAAGTACATTTTG TAAGTCTGCTCAAATAAACGTTCTCTCTTTTTTGACTTTCCTGTGTCTAT TCGTGATGTTCATGACGTAGTGTTTTATACGAAAGCACCTAAAAAAGACT CCCAGACGGCACACAACGTCAAAACAACGTCCATGTGACATTCATAACGT CCAAATAACGTTATTTGAACGTTAAAACAACGTTGTGTGTCAGCTGGGCT GGGCGTTTACCACTAATTGGTCAGCCCTGGTGGCCCTTCAAATCCCTTCC ACAATTTTTCTCCCGGATGTCGTCCATAAGACTTTTCATTCTAAATCCGA TTCTTCTACGTTTTCGGTAAAACGATCCCGAACGGGTTTCTAGAACGGAT TAACGCTAATGGCTATCCCTAAATAAGTATTAGTTATTACTCCTATCGGA ATACACGTATGATTTCCTATTCCGTTTTCATTGTAGTAAGACAGCAAAAA TATATTCAGTTTAAAAAAAGTACCCACAATGCCTCGTTTTTTAAAACGCT TCGTGAATGAGGCGGAAAAACGAAAGTGGAATTTTTGAAACTCTCAGCGT CCAAATTACTGCTAAGTGATCCTTTAAATCTGTTTATTTTCACTCACATC TTAGCTCTAATTACTCTTTAGGATTAATTTTAAAACTTATTTTAGCGAGA AGACACAGTTGCACTACTCTGTACCAGAGTGTATCTCACGATTATCGAAG ACACAGTTAACAAAACTGTTTTTGGACCTACCTGGAGGTCCTATAAATTA ACCGTTGTCCGTTCGTTCGTCCGTCCGTCCGTTCGTCTGTTACCAGCTTT TCTTGAGATTGGCTCATTAGTTTTTTCTGATTTTTGGCATTTAATCCTTT TAATTGGTTGTTTTTTTCTTTCAAAAACATTATTAATAGCAATGCCCACC ATCAAGCATGTTTCGATTTTCAATAAAATTGATTTTTGAAGCCGGAACTA TTTAAAAATCGCCGGAACAACCTATTTTCGCTGGAAAGACAGTATTTCTT GAATTTCTCGAGCTGTGCTTTATTTTATTTTTTTTATGAAATTTTGCACA CTGATGCAAAATGACAATACCTAAAATGTCATGGTGCCCAATTTTCGAAA AACATTTTTTCCGGCCGAAAATGCCGGAAATATGCCGGAAAAACCGGTTT TTTGACATTTTCTCGAATTTTCATCCTTAGTTTTTTGCTGATTGTTTGAA GAAAGATGCGTATTCGCAATGCTCAAAACATGACCGAGTTTGATTTTTTG AGAAAAATTTTTTTCCGGCCGAAAATGCCGGAAATATGCCAGAAATCGCC GTTTGTGCAGATTTTTATTGGGCTTTTTGTTTTTCCTTATATTTCTTTGT TTTTTCACATAAAACATTATTGATAACAATGCCACCATCAAGCATGTTTC AATTGTCAATAAAACTGATTTTTGTAACCGGAACTTTCTATTTCTTTTTT CCTTACAACCCTTCCCTCTTCCCCCATCAACAATCAATAATGAAATTTAA TTCAATTTCGCTAACCGCTATATTTTCTGATTGATCGTTTTTATGTTTCT CCTTATTGCTATCTAATTTTCATCATTAGGTAAGTCCATTCAGCATCTAG CTTGTTAGATTAAAATGCTACTGTTTGATCGCCATCTATCTTTTTAGGTA AATGACACTTTTCAAGTGCAGCTGAAAATAATAATTTTACAACATATAGT TACTCATTATCTTAATCATTTAGTGCGAGCATGCGATTGTTTCTAGTTTT ATTATCTCCTTAATAATCGTTACTGGAGATCCCTTCCATAACACCACCAT TTAGCCCTTCCAATATCCTTTGTTATTTATTAGGTGTAATTTGTTTGATG GCAATTTCCACATTGCCATAGTACTGGACATAACTCCAGGGGAGGGAGGA GTTAGGAGGGGAGAGGCTGATTTTTGGAGTTTCACATTTTCCTCCTCCCC AGTAAGCAAACTGAAATCGACTACTGTTGAAGCAGTGTTCACAAATCCCC CTTGTCATGCGAAGGAAAGCTAATAACGTCCTTTATCTTCTATGTTCACT GGCGAGCAACCAATAAATGATCGGTGCACCATCTGTATTTAAAGGCACAT AAAAGTACTGACGAAATTTGTAAACGAACCGTATGCAGCGGGATACAAAA TCAAAACAAGTGTCACATGTCAAAATAAAAAATAAAAACAAATATGGCTG ATTTTGATTGTTTCAATTGTTTTACAAGTTTGTTTTGGACTACGTGAATT TAATTTCTTTTTAATGACACGTGGTTCCCGCAATGTTTACATTTTACTAC TTTTATGTCCCTTTAAACGAATCTCTTTGAAATCTGTGTGAGTCAGATTG CTTTTATAATTGGTCAGCCTAAGCTGAGCATTCAAATAGGTAAAATTCGG TTCCATAAGACGGCAAAAAAAAAATCCGATTTCCCGAGCTCACTTTGATT TCAAAAGCGAGTTTAAAGCAAAACAGGGGAAAAATGAGCTTCCCCGCATA GTTATGAATTTTAAGTTTTGCTTTCGATTATCATTTGCGACCAGCAAAGT CTTCAAGATGGTTGTGTGCATGTTGTGNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAATTAGCGGGGGG GGGGCAGCTATTAGGTACCCGAGAGTAACCTGTGTTCGTTCGTCCGTCCG TTCGTCTGTTACCAACTTTTCTTGGGATTGAATCATAGGAATTTTTAGAC TTTTGGTACAAAGGTGCAAAATGGTAGTGTCCAAAATGTGACGGAGCCCG ATTTTCGAAAAAAAAAATTTAGGGCTAATTTGGGCCCAAAAATGCCCAAA AAAAGGGTTTTTTGGACTTTGTGAAAAGTCCATTCATTATATTTTCCTGA TGTTTTGTACAGAGATGTAGAATAACATTGTTCAAAATATGAATTAGTTC ATTTTTCGAAAAAAAAAATTTGGGGGCCAATTTGGGCCCAAAAATGTCCA AAAATAGGGCTTTTTGGACTTTGTGAAAAAACTCTTCATTTTAGTTTTTC CTGATTTTTTGTACGAAGACGTGGAATTACAGTGTGCTAAATATAAAAAA GTTGATTTTTCAAGAAAATTTTTTTTTTGGGCCAAATTAGGCCCAAAAAT AGGGTTTTGTAGAAAATCTGTTCATGAGATTCTCCTGAATTTTTGTATAG AGAGGTAGAATAACAATGTGCTAAATATAATATAATGCATATCCACTCCA CGTTTTTTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCAA ATGTTTCACATTTTGTACATTATTCAACATTTTTAGTCTACTCTGTTTCA GTACATCTCTTACATCTGTTAACCCACTTATTAAAGCTATCTAGCCAAGC TCTATTGGCTGACCTTCCAGCCTCGGCTGGTTTATTTTGTTTTTGTTTTA GCCAAAACTCAGCCTCGTATTCTTGTAAAAAGAGATAGCAAAATACACTT TTTTTATACAAGGTTTTGTTTTTAAATAAGAGTGATATCGTACTCAGCGG CTGTATTTCTTTGTGTGTTTTATTCAGAGAGTTGTTGTAATGGAATTTTT TGCTCAAAATTTCATGCTCTTTCTGATGGTACCAATCATTTTCAATTATT TTGACTTTTTAAAACCAGCTATTTTACCCCTTATTTTCCCTTGCAGTTTT GCCTATGGCGTCACTATTTTGGTCATAGAAAGTTTTGGCAGGCCTAATCC GCGTCCTCCCTCTCAAAAATATCTTAAAATATACTGTTCTTTGGAATAGA CTAAAAATGGATAGGTCGTAAAAAAGATGTCACAGGACCCCAGGCTTGGC CCCTAATATTTAGCTTTAAAGGATTCTATGATTCTTTGACGTGAAAATAA AATCCCAAAATACTTTTTTAGTTGGAAGATACAACTCCAAGTCTATCACT GATTGACTAAAATTCAATAAAAGCAAAAGAAAAGAGCCTGTTTTAAGAGT CAGCTAGACAATTAAGTTTTATGCTGTGTTTTTTGACGAATTCTTTTTTG ACAGTGATGATGTTCTAAGATTGAAGATTTTTTTATGAAAAAATGTTGAT TATAGAAAGGTCTAAGTGGCATAAAGGCCCAGCAGTGTTCGTAATATCAA CATATTTTCCCGTTGCAGAGTCACCATACAATTTAATTTTACACATGCGC ACAATAGTTGTTCAGATAATTTGATTTTTTGCCGGGACTCATCAATTGAT GATTGCACGCATAGGCCCTGACAAAGTCTAATCTTTTCGACCAGTTGTGT TTTAAAGTCCCATTTCGCTGCGCGCTGGGCCAACTACATGTTTTTTTTAT AAGCAAATGTATGCCCCTTGGTCAGGCTCGTGTATGCTTAAGTTCTTAAA GCATCCAGGCATAGCTTATGCTTATTATATGCTTATGAATCATGCTTATG ATTCACCCCGAGTCAAGTTTTTATAGTGAAATTTCAGAAATTTTGTGAAA ATTCGTTCAGATTTTGGGAGCAGTGGAATGTAGCTAGCCGTGGAATGTCT TTTTTTACTTGACCTCTACCAAACCTTTTTAAACAGATAAAAAATGACAA CTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNTCCAGGCTGACATATATGCTTATGTTATGCGTAGGAATTCTGCA AATCTGAGCCTTCATATGCTTATAAGCGTTATGCTTATAAAAAAAACATG TAGTTGCAAACGCCCAGGCTATTTTGGATGCTTCCGTATAAAACATTACG TCATAAATATCATGAATATTGGAGAGTGGTTCCCACATGGTAGCAACAAA AGTCTCTCACTTATAATGATCAAAGTGGTGGATCTTTCTGGTTGAATCCT TTTTTCATTATCTCGCTATAGAACTCGGTGTAAACCAATCGAGTTTGTAG ATAATGATTATTCTTCCCCCTTTTTGATTAATTTCATTCTTCTTTTTTTT GTAGTTGAATTTCTGGCAACAACGATGAAATTTGAGTCAAGGTGAAAGGA ATACTTTATCAACTCGATTGGTAGATGTTTTTAGTGAGAAAAGTGGTGAC AAAAGATGTTGTTTTAACTCTCAGACAACGTTGTCTGAAAAGATGTCTTT GATAATAATAACTGTTTTCAACTAATCGAACGGTTTAATGGACGTTATGG ACGCTGGTTTGATGGCATATAACGAACGGCGGGCGCTCTTGGTATTTTTG GCATATTTAATAGACGTTATGGACGTAAGATGGACGCTGGTTTGATAGTA TATAACGAACGGGGGGCGCTCGTGGTATATTTGCGTATTGAGGCTTGTGT ACTGAAGAGAGGGTAAACCACAATGTGTGCGTTTAATCCCAGACTTTTAC AGGACTGAAATTCCAAAGGTTGGAAATATTGGTAATCCAAGAAAAAGTGC ACGGCCATTGAGCTCTATTTATCATTACAGGGCCGAAACGTTATTTCGCT GTGAAAGGCTACGAAAACGTGTCCAAAGACGTTACAATGAGTTTGTCTTT TCATCATTAGCGAGTTTATGTATTTGCGCTTTTGAGGACGGTAAAGTGAT TGAAGCAATTTAGAATAACCCGCAGTTCTGACCCGCATTATCGAGGACGG TAAAGGTGCTGATTCACTGTCGTCCTCAGATGGTCAGTTTCTAATCAAAT TAGAACCTTACCGTCTCCGTCGCAGAAAAACACACATACATAAATTCGGT ATTAAAGGATGCTGAAACGTCGTGTCGTTATGAAAGAACATTGAAGAAAT CTTTTTTGAGAAATCGTAAAAGTACAAAGACCACTTTTGTTAAATCGAAT TCATTCTCATTCGTTTTGTTTCAATAGCACACCGTGGTGAATCTAAAAAT AGACATCACTTTCTTTATTTGCCCGAGTTTCAATCCCATCGTTCATTGCG TTAATTTCTTGTGCACATTAATTACACTTATAACAAAGAAAAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000142XLOC_000142Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000261-exon-sc0000001-1575043694:2527230..2527330TCONS_00000261-exon-sc0000001-1575043694:2527230..2527330Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2526935..2526987TCONS_00000261-exon-sc0000001-1575043694:2526935..2526987Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2526209..2526386TCONS_00000261-exon-sc0000001-1575043694:2526209..2526386Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2525608..2525707TCONS_00000261-exon-sc0000001-1575043694:2525608..2525707Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2525327..2525415TCONS_00000261-exon-sc0000001-1575043694:2525327..2525415Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2524962..2524991TCONS_00000261-exon-sc0000001-1575043694:2524962..2524991Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2524640..2524756TCONS_00000261-exon-sc0000001-1575043694:2524640..2524756Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2524188..2524312TCONS_00000261-exon-sc0000001-1575043694:2524188..2524312Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2522745..2522828TCONS_00000261-exon-sc0000001-1575043694:2522745..2522828Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2521790..2521883TCONS_00000261-exon-sc0000001-1575043694:2521790..2521883Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2521364..2521513TCONS_00000261-exon-sc0000001-1575043694:2521364..2521513Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2521158..2521206TCONS_00000261-exon-sc0000001-1575043694:2521158..2521206Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2514932..2514987TCONS_00000261-exon-sc0000001-1575043694:2514932..2514987Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2514560..2514631TCONS_00000261-exon-sc0000001-1575043694:2514560..2514631Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2514037..2514114TCONS_00000261-exon-sc0000001-1575043694:2514037..2514114Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2513536..2513648TCONS_00000261-exon-sc0000001-1575043694:2513536..2513648Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2513104..2513162TCONS_00000261-exon-sc0000001-1575043694:2513104..2513162Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2512511..2512578TCONS_00000261-exon-sc0000001-1575043694:2512511..2512578Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2511911..2511958TCONS_00000261-exon-sc0000001-1575043694:2511911..2511958Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2511085..2511341TCONS_00000261-exon-sc0000001-1575043694:2511085..2511341Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2510561..2510598TCONS_00000261-exon-sc0000001-1575043694:2510561..2510598Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2508735..2508814TCONS_00000261-exon-sc0000001-1575043694:2508735..2508814Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2508460..2508528TCONS_00000261-exon-sc0000001-1575043694:2508460..2508528Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2507925..2507969TCONS_00000261-exon-sc0000001-1575043694:2507925..2507969Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2507585..2507676TCONS_00000261-exon-sc0000001-1575043694:2507585..2507676Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2507119..2507197TCONS_00000261-exon-sc0000001-1575043694:2507119..2507197Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2506747..2506867TCONS_00000261-exon-sc0000001-1575043694:2506747..2506867Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2505907..2506130TCONS_00000261-exon-sc0000001-1575043694:2505907..2506130Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2505315..2505353TCONS_00000261-exon-sc0000001-1575043694:2505315..2505353Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2505047..2505127TCONS_00000261-exon-sc0000001-1575043694:2505047..2505127Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2500408..2500496TCONS_00000261-exon-sc0000001-1575043694:2500408..2500496Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2499795..2499895TCONS_00000261-exon-sc0000001-1575043694:2499795..2499895Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1575043694:2492688..2493676TCONS_00000261-exon-sc0000001-1575043694:2492688..2493676Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2527230..2527330TCONS_00000261-exon-sc0000001-1510915933:2527230..2527330Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2526935..2526987TCONS_00000261-exon-sc0000001-1510915933:2526935..2526987Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2526209..2526386TCONS_00000261-exon-sc0000001-1510915933:2526209..2526386Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2525608..2525707TCONS_00000261-exon-sc0000001-1510915933:2525608..2525707Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2525327..2525415TCONS_00000261-exon-sc0000001-1510915933:2525327..2525415Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2524962..2524991TCONS_00000261-exon-sc0000001-1510915933:2524962..2524991Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2524640..2524756TCONS_00000261-exon-sc0000001-1510915933:2524640..2524756Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2524188..2524312TCONS_00000261-exon-sc0000001-1510915933:2524188..2524312Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2522745..2522828TCONS_00000261-exon-sc0000001-1510915933:2522745..2522828Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2521790..2521883TCONS_00000261-exon-sc0000001-1510915933:2521790..2521883Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2521364..2521513TCONS_00000261-exon-sc0000001-1510915933:2521364..2521513Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2521158..2521206TCONS_00000261-exon-sc0000001-1510915933:2521158..2521206Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2514932..2514987TCONS_00000261-exon-sc0000001-1510915933:2514932..2514987Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2514560..2514631TCONS_00000261-exon-sc0000001-1510915933:2514560..2514631Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2514037..2514114TCONS_00000261-exon-sc0000001-1510915933:2514037..2514114Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2513536..2513648TCONS_00000261-exon-sc0000001-1510915933:2513536..2513648Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2513104..2513162TCONS_00000261-exon-sc0000001-1510915933:2513104..2513162Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2512511..2512578TCONS_00000261-exon-sc0000001-1510915933:2512511..2512578Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2511911..2511958TCONS_00000261-exon-sc0000001-1510915933:2511911..2511958Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2511085..2511341TCONS_00000261-exon-sc0000001-1510915933:2511085..2511341Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2510561..2510598TCONS_00000261-exon-sc0000001-1510915933:2510561..2510598Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2508735..2508814TCONS_00000261-exon-sc0000001-1510915933:2508735..2508814Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2508460..2508528TCONS_00000261-exon-sc0000001-1510915933:2508460..2508528Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2507925..2507969TCONS_00000261-exon-sc0000001-1510915933:2507925..2507969Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2507585..2507676TCONS_00000261-exon-sc0000001-1510915933:2507585..2507676Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2507119..2507197TCONS_00000261-exon-sc0000001-1510915933:2507119..2507197Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2506747..2506867TCONS_00000261-exon-sc0000001-1510915933:2506747..2506867Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2505907..2506130TCONS_00000261-exon-sc0000001-1510915933:2505907..2506130Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2505315..2505353TCONS_00000261-exon-sc0000001-1510915933:2505315..2505353Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2505047..2505127TCONS_00000261-exon-sc0000001-1510915933:2505047..2505127Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2500408..2500496TCONS_00000261-exon-sc0000001-1510915933:2500408..2500496Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2499795..2499895TCONS_00000261-exon-sc0000001-1510915933:2499795..2499895Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1510915933:2492688..2493676TCONS_00000261-exon-sc0000001-1510915933:2492688..2493676Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2527230..2527330TCONS_00000261-exon-sc0000001-1491911889:2527230..2527330Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2526935..2526987TCONS_00000261-exon-sc0000001-1491911889:2526935..2526987Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2526209..2526386TCONS_00000261-exon-sc0000001-1491911889:2526209..2526386Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2525608..2525707TCONS_00000261-exon-sc0000001-1491911889:2525608..2525707Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2525327..2525415TCONS_00000261-exon-sc0000001-1491911889:2525327..2525415Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2524962..2524991TCONS_00000261-exon-sc0000001-1491911889:2524962..2524991Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2524640..2524756TCONS_00000261-exon-sc0000001-1491911889:2524640..2524756Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2524188..2524312TCONS_00000261-exon-sc0000001-1491911889:2524188..2524312Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2522745..2522828TCONS_00000261-exon-sc0000001-1491911889:2522745..2522828Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2521790..2521883TCONS_00000261-exon-sc0000001-1491911889:2521790..2521883Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2521364..2521513TCONS_00000261-exon-sc0000001-1491911889:2521364..2521513Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2521158..2521206TCONS_00000261-exon-sc0000001-1491911889:2521158..2521206Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2514932..2514987TCONS_00000261-exon-sc0000001-1491911889:2514932..2514987Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2514560..2514631TCONS_00000261-exon-sc0000001-1491911889:2514560..2514631Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2514037..2514114TCONS_00000261-exon-sc0000001-1491911889:2514037..2514114Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2513536..2513648TCONS_00000261-exon-sc0000001-1491911889:2513536..2513648Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2513104..2513162TCONS_00000261-exon-sc0000001-1491911889:2513104..2513162Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2512511..2512578TCONS_00000261-exon-sc0000001-1491911889:2512511..2512578Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2511911..2511958TCONS_00000261-exon-sc0000001-1491911889:2511911..2511958Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2511085..2511341TCONS_00000261-exon-sc0000001-1491911889:2511085..2511341Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2510561..2510598TCONS_00000261-exon-sc0000001-1491911889:2510561..2510598Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2508735..2508814TCONS_00000261-exon-sc0000001-1491911889:2508735..2508814Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2508460..2508528TCONS_00000261-exon-sc0000001-1491911889:2508460..2508528Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2507925..2507969TCONS_00000261-exon-sc0000001-1491911889:2507925..2507969Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2507585..2507676TCONS_00000261-exon-sc0000001-1491911889:2507585..2507676Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2507119..2507197TCONS_00000261-exon-sc0000001-1491911889:2507119..2507197Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2506747..2506867TCONS_00000261-exon-sc0000001-1491911889:2506747..2506867Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2505907..2506130TCONS_00000261-exon-sc0000001-1491911889:2505907..2506130Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2505315..2505353TCONS_00000261-exon-sc0000001-1491911889:2505315..2505353Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2505047..2505127TCONS_00000261-exon-sc0000001-1491911889:2505047..2505127Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2500408..2500496TCONS_00000261-exon-sc0000001-1491911889:2500408..2500496Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2499795..2499895TCONS_00000261-exon-sc0000001-1491911889:2499795..2499895Clytia hemisphaericaexon
TCONS_00000261-exon-sc0000001-1491911889:2492688..2493676TCONS_00000261-exon-sc0000001-1491911889:2492688..2493676Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2492688..2527330 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.486499 0.716764 0.478077 1.10394 1.22498 0.975882 0.0112997 0.944025 1.30438 0.000106251 3.7144 0.750777 1.08524 3.48232 1.09488 1.99464 5.40816e-05 3.55057 2.36598 0.024023 3.63107 2.25395 0.670513 2.19104 1.92795 0.0412536 1.32868 0.717294 2.01336 1.39532
Blast
BLAST of TCONS_00000261 vs. Swiss-Prot (Human)
Match: GCP5 (Gamma-tubulin complex component 5 OS=Homo sapiens GN=TUBGCP5 PE=1 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 1.252e-103
Identity = 298/1046 (28.49%), Postives = 519/1046 (49.62%), Query Frame = 3
Query:   72 ELIMHILQIERKSE-NFKISMEYVMSNFRFNRFLDVNSLDVSRSLTGLCSKFRVNSFDKKADYLEKKVEEFINLPLLEIDEKDNREVQTDAHYALLAFLMKLSNNPLNCEFXXXXXXXXXXXXNTFNWTKYLLLGEEPLEIGANIXXXXXXXXXXXXNEIWQLXXXXXXXXXXXXQHLYDEVSEIQKQLKKFTEVNQYVEEKD---WLREKVVPAYWIESEKSTFPFHVQGMKYINSNNQMCNNWELYKNQFTKVSNDPQLLSEKILVRETVWMLLGLENLHVYKFTGTKYDVNEDIVITHLTKETLSKFLTSFTEVGTKVVLLKRFTE---------------LCAQKYSEIP-KTIQAFGYTISKYLSNRRETLIDLEKTLMEXXXXXXXXXXXXXXXXXISKVNFIYKIYNHAVVEGHEKYFTVTERVVHFLDVFYDFVCTLDNMGDSGTEKMMLVLPMFLEVCRPYLEDVGCWMATGQL-PRDEEFMIYRTQNQVQGETRYWHELFLI------RENR------------STDGKSSK--LVPRFLEKLQKQILVSGKSLGLLEEFVEFTSTVVATDSLYEEFKRSLKINIQKSNERYRHTHALDSTDHIPGDAVS--------EYISDSGI------DPLLRANFHIMF---NNVYQRMKTNKEQIAVESGKEEIQDLAILLRDCSCRPPMKRIIDQSLSPVVLGRYGKACVVXXXXXXXXXXXXDHLAVMK------ATGEMYEFYTDIFEKAKHGRYWRDMSYLNIVLQDALQVNYPKLMGNLTVDYY---SSKNNLSNAQLFDGLSLHYKVPWPVSIVLDQHAEDKYNEVFRFLFKVKRAIWVLEQLRFQELVYQGSYSQDHSDSEDEGIDYNTTTSTTRRGLKQHVLKDMILSGAHQKLKNRILVLRMKMLHVVRSFHFYLMTRIDDSIHQEF--RVESARDLDEILEFHQKFLFSLRQRCFLHEKVARTKDALVRILNLSFELEELWRSSVAVLNVNQLMALEKEFFRCTSFLHSFFTTLSKRGSFPHFEFLATTM 3002
            EL+  +  ++ +++ NF++++ +  SNFRF+RFLDVNS  + +++ G+  KF ++S   KA   ++  EEF+N PL  I     +E++TDAHY++L+ L+ LS++P N  +      K V++++ F+W KYL+  EE ++IG  +D+    +  + +N+   LS ++   + D          E Q Q +K      + +E D   WL   VV  YW  +  S FP  +    +++SN     +  LY +    V +D  L++E  ++RET+W+L G++ L +++    K  V  +I++THLT   L   L      G  V  L+ F +                  +K +E P +T QAF + + KY  + +E L ++EK ++  D   TL  + D LA  +S++  ++K+++  V E       V  R  H L+  Y  +   DN+G++  + + L+  +++E  RPYL+ V  W+  G L     EF+I R +N       +W+  + +       EN             S  G SS+   +  FL+ + KQI+++GKS+ LL+      ST     +   E K    + ++    R RH    DST  +  +  +        + I++S +      DPLL  NF  M+   ++ +++       +   S     Q   + LR C             L P +  +Y   C  L++  KK+ + +++L  M+          MY+FYT IF+K +    W+++S+LN+ LQ+A+   YP+    L++ +    ++K  L    + DGL+L YKVPWPV IV+    +  YN+VF  L ++K A + L+ L F ELV     S        EG+ +   T   + G ++  ++  I         +R+ +LR+K++H V S H Y+MTRI  S   EF  +VE A+DLD++++ H ++L ++  RC L EKV+  K+A++++LNL+    + W++ +    +  +  +E +F  C  FL +       RGSFPH E LA ++
Sbjct:   21 ELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLDVNSHKIEKTIEGIYEKFVIHSDLSKAASWKRLTEEFLNAPLPSI-----KEIKTDAHYSILSLLLCLSDSPSNSSYVETPRNKEVEKKDDFDWGKYLMEDEE-MDIGPYMDTPNWSEESEEENDQQPLSREDSGIQVDRTP------LEEQDQNRKLDPCISWKDEPDDRSWLEHHVVHQYWT-ARPSQFPHSL----HLHSNLAAVWDQHLYSSDPLYVPDDRVLVTETQVIRETLWLLSGVKKLFIFQLIDGKVTVRNNIIVTHLTHSCLRSVLEQIAAYGQVVFRLQEFIDEVMGHSSESMLPGSGSVPKKSTEAPFRTYQAFMWALYKYFISFKEELAEIEKCIINNDTTITLAIVVDKLAPRLSQLKVLHKVFSTGVAEVPPDTRNVV-RASHLLNTLYKAILEYDNVGEASEQTVSLLFSLWVETVRPYLQTVDEWIVHGHLWDGAREFIIQRNKNVPVNHRDFWYATYTLYSVSEKTENEEKMSDNASASSGSDQGPSSRQHTMVSFLKPVLKQIIMAGKSMQLLKNLQCAESTTCQAGARDAERKSLYTLFLESVQSRLRHGE--DSTPQVLTEQQATKENLMKMQSIAESHLELDDVHDPLLAINFARMYLEQSDFHEKFAGGDVCVDRSSESVTCQTFELTLRSC-------------LYPHIDKQYLDCCGNLMQTLKKDYRLVEYLQAMRNFFLMEGGDTMYDFYTSIFDKIREKETWQNVSFLNVQLQEAVGQRYPEDSSRLSISFENVDTAKKKLP-VHILDGLTLSYKVPWPVDIVISLECQKIYNQVFLLLLQIKWAKYSLDVLLFGELV-----STAEKPRLKEGLIHEQDT-VAQFGPQKEPVRQQI---------HRMFLLRVKLMHFVNSLHNYIMTRILHSTGLEFQHQVEEAKDLDQLIKIHYRYLSTIHDRCLLREKVSFVKEAIMKVLNLALMFADGWQAGLGTWRMESIEKMESDFKNCHMFLVTILNKAVCRGSFPHLESLALSL 1017          
The following BLAST results are available for this feature:
BLAST of TCONS_00000261 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GCP51.252e-10328.49Gamma-tubulin complex component 5 OS=Homo sapiens ... [more]
back to top