Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000254 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000254
Unique NameTCONS_00000254
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2262

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000254 ID=TCONS_00000254|Name=TCONS_00000254|organism=Clytia hemisphaerica|type=transcript|length=2262bp
CCAATATCAAGTCAACTTCACCATGATTGATAAAATAATACAAACCAGCG
AAGAAAGATGCCATCgttaccaaaatcgatttatcaATGGTCAATCGCTG
ATGTCCTTCATTGGTTGACTGAAAATGGTTTCGAACAAGAAACAGAAAGC
TTCAAAACTCATCAAATCGATGGTCGTGCGCTTGCTCTGCTTTATCGATG
CGATCTGAAAGAAGTCATCAGGAGGGTTGGACCGAGAGTGAAATTTCGCG
CCAAATTATCACAATTGTTGACGTCACGTGGTATGAAGAACAACATGGAA
CCTAAAGAAACAAGAAATAACAACAACAATAATACAACTTCGTTCTACGA
CCCTAATTTCGGACAGCACGTTGTCATGCCAATGTATGGTCAATACGGAC
AACGACCACCCTACCCTcaacaaaacaatggaatgaaaaAGAACCAATCG
AATGGCTTCTATCCACAACAAAACCAAATGCAACAAAGGAATTATtacca
acaaaaacaacaacaacaacaacaacaacaacaacagcaacagcaGCAAC
AGCAACAGCCAATGAGAATGAACTATTCTAATAATCAGCCAATGAGCGGC
TGTCAACAAAACATGCCATCCAATGGGAATACAGGAATGAATCATAACGG
ACCAATCAGAAATCCGCATTCGAACAATACCGCAAACAAAACATGCGATT
GCATGACGGTCAAAGCAAATGATTACCGTAGTGTAAAGCGCCCGCAACAA
ACACAAAATCAACCGGAAACTAACCAAATCAACGGAAGCTCAAGTGCGGA
AAACAAAACAGAGAAAATTCCCTACACAAAAGATGAAGTAGACATCACAA
AGTTTTTAGAGGGGTCTGGGTTTAAAAAAGAACCAATCGATTCGCTGGAA
AGCCCGAATCAACCAATCAGTGAGCACAAAGCAAATGGTTCCCACGGCTC
TCCCCCACTTTCGTTTTGCAGAAGCTCACCTAACAACAACGATGAAAACC
TTGATCCGACCCACTATACGAATACCCACGATGGAGGGAGCTTGAATGGA
AGTTATGATGGTGGAAATTCTCCATTGAATCCTGAAGAATCCGCGATGGA
GGACGATGAACACTTCCCCGTGTTGGATATTACAGAACGTACCGAAGAGC
TAGAGAATAAAATGCAGAACGACGGAATGAATGTTTTTCACAATGGTTTC
CATGGTAGTAACAACGGGATGAACAGTAAGCTGGGAATTGAAGCTGTGAC
CAATAGACTTGCGTTACGTGAACGTTCGAAGATTTTTCGACGTAGTGAAA
AGAAATGGCACGTCGCTGTTAACGAAACGGCATACCAACTCGTTTTAAAA
GATCCCAGTTTGCTGATGAGGAAAAAAGATTTACGAACAATGGCAGAAAC
TGAAGTTCGAAAGACCTATCGCTTTGCTAAAGGTAAATCACGTTCGATAG
CCATTCCAGAGAATCGAGCGGCAGCggaagagaagaagaaacagaAATTG
ACCAGAGAGAAAAtcgaagaaatgaaaagacaacTGAAAGCTGAAGGCGA
GGAGTTGAGTCGTCAAATGCGACAGTGTCAAGTGAACATACAACTGGCCA
ATCAACAATCAGATATGACGCGATCCGCAGAACTAAGAGACGAAATGCAA
AAACTCAACCAACAGCAGGCTAAAATCCATTTTTCAATGCACGAGCTGAT
CACTAAAGAACGTAAACTGGATGCCAGTGTAAATAAAATGATGCAAAACG
GACATGCACCCACAATGAGTATGGTCAACACTCAAGGACATCAAATGATG
GATTTATCTGATGAAGGGAACTCTTATTATAAcaacaatgaaaatataaa
cgatGACCCAACTTTAACCTCTCCTACCCAACTTGTCTCATTCGTTGCCT
CGCAACCAACTACATTATCTCCTTTAAATGCAGTATTACCTCCGCAAAGT
GCCGTATTATCTCCCGAAGGATCGGCAACACAGGTCCACGTGGACAATGA
TGGACGTGTAATGCAATTCGGCAGCCAATCAGAAACACCGAATGGCGTAA
TGATTATAAATAATGATGAAATGACGTCATCGCCtcaaaatatgacgtca
tcacaacaTATGCCGCCGCCGATGGAGAATGGTGGGAATAATGCTTACAT
CAGCATGTAGAATGTATTCAAGAAGGTGTTGAGTGTTAGCTTGTTTTCgt
tgtagatttttttttataaactgtGTATTTATACTCTGAAATATCATTTT
Ggaataaaaatt
Run BLAST on NCBI

protein sequence of WegA-2 putative cnidarian restricted protein

>TCONS_00000254-protein ID=TCONS_00000254-protein|Name=WegA-2 putative cnidarian restricted protein|organism=Clytia hemisphaerica|type=polypeptide|length=700bp
MPSLPKSIYQWSIADVLHWLTENGFEQETESFKTHQIDGRALALLYRCDL
KEVIRRVGPRVKFRAKLSQLLTSRGMKNNMEPKETRNNNNNNTTSFYDPN
FGQHVVMPMYGQYGQRPPYPQQNNGMKKNQSNGFYPQQNQMQQRNYYQQK
QQQQQQQQQQQQQQQQQPMRMNYSNNQPMSGCQQNMPSNGNTGMNHNGPI
RNPHSNNTANKTCDCMTVKANDYRSVKRPQQTQNQPETNQINGSSSAENK
TEKIPYTKDEVDITKFLEGSGFKKEPIDSLESPNQPISEHKANGSHGSPP
LSFCRSSPNNNDENLDPTHYTNTHDGGSLNGSYDGGNSPLNPEESAMEDD
EHFPVLDITERTEELENKMQNDGMNVFHNGFHGSNNGMNSKLGIEAVTNR
LALRERSKIFRRSEKKWHVAVNETAYQLVLKDPSLLMRKKDLRTMAETEV
RKTYRFAKGKSRSIAIPENRAAAEEKKKQKLTREKIEEMKRQLKAEGEEL
SRQMRQCQVNIQLANQQSDMTRSAELRDEMQKLNQQQAKIHFSMHELITK
ERKLDASVNKMMQNGHAPTMSMVNTQGHQMMDLSDEGNSYYNNNENINDD
PTLTSPTQLVSFVASQPTTLSPLNAVLPPQSAVLSPEGSATQVHVDNDGR
VMQFGSQSETPNGVMIINNDEMTSSPQNMTSSQHMPPPMENGGNNAYISM
Run BLAST on NCBI

transcript from alignment at sc0000001:2419716..2443503-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000254 ID=TCONS_00000254|Name=TCONS_00000254|organism=Clytia hemisphaerica|type=transcript|length=23788bp|location=Sequence derived from alignment at sc0000001:2419716..2443503- (Clytia hemisphaerica)
CCAATATCAAGTCAACTTCACCAGTAAGTCTTATTTTTAAGCTCTACATT TTGTTCAACCTCTGGAAATTGTAGTATATCAGACACGATACCTTTGATTT AAAAAAATTCATGCTGATTAGAACGTACGTATTACTTTTTCTTTTGAAGT CCTTTGGAGCCCTTTGATGTTCTTAGCTACACTCAGTGGAACTCAATAAG AAAGTACTCAGATTTCTCGCTCAAATTTAGTCAAATTTAGCTAATTTTTC TCTACACTGTAAGGGGATGATTTCAAAGGTCTAATTTTAGGGGTACACAT ACGGCTGTTTTTAAATCGAGTGCTTCCCCCAGAAAGTAGAATTCGCATGT AACAATAGCCCACCCACGAGAAAAATAGACCGAAGAATCGTCCTCACTTG AAAGATACCCTGAGAATTCATTCACTTTTTAAAATGTAGGGGGGACTGTG GGTAGCCAGGAAAACACAGGATACATGCGGATCCCAAGGGTTTTAGTAAC ATAAATATACTGTGAAGTGGTATACTTTTGCATGTATTGATGATATAGCA GGGTTTGTTTTTCCTGAACGCACGAACAAAAAATACAAGCTACGCTGTCT GGAATAGACGTTTTCAGGGGTCTTTATAAACAAAGTTCCTCAATCACTTG CAACAAAAAGAAAATATACTAGAAACTCTTTCATGCACGACCCCCTGAAA ACTTTTCTATTTGTGTTTGCGGCCAACCTTTTTATTATGCCACATGCGGT TCTACCTCCTGGGGGGCTCCTTCGATAAAAATCCTTTTCGAGGGGAGGGG GCCTCCCATCAGGGGGTAACATGAAAATGTCAAAAAAGAAACATAGAAAC GACAAAATAGTGTTTTACAATGTAGAAGCTTTTTTTCTCGTATATCAAGT TTTATCCAGTATTTATTTAACTTATTGTGGAGTGTGTGTAGGGATATCTT TCTGCTTTTGTGAAGGGAATTCTTAATGTTGAATTTACCGTATTGTATAC GATAACCTGTTTCAATGTTTCAAACGGTTTTTGTTGTAAATAAGAAACGA TCTTATGTGCTGTTCGCTTACTTGGCTCGAATTAAACATTCAAAAATCTT TCCTAGGTTTGCCTTTAGTTTTATGCTGCACTTTTTTACGGATCGAATCT AACGTTGTCTGCGTTGTCCTGTTTTCAGGCGTTACCATGGCGTTCTAAAT TAGAAATTTTTTATTCGAATTTTGTTTTTCGTCCTTTTTAGGGCCTTTGG GTATATTACCCTAAAGGGCGTTTTTGTAGAGTCTCCCAGCTACTAATAAT CACCAAAACCACTCGAATTTAAGAGGCTTAACCAATGAGATAGATATAGT TAAATGTTTTAGAGAGGGATCTTCGACCTTTCCTAAGGCTACAAGAACAG CTACCTGCAGATTTTTTGAAATATCTGTTATTTTTTTCCAGGAGAGTAAA TTTTATGGATAAATCTAGGAGAGACTTTCCCCAAAACACCAAGGTAAAAT CCAGGGGTCACCTTAAAGACACCTGTTCTTAAAATCCAGAAGCTAAATTG TGAAAAACACAACCAGATGCCAGATCTTTTTTCCAGGGAGCTTCATAATT TTCTTAAAAGGTCTCATTTTCTAGGAGCATTTTAACTTTCTTAGAGAATA GCTGTTCTATAATAGCATAATATTTCTAGAGAACAGATATACATTTTCCA GGAGTCCCATTTTTTCCCAGAACAGATGATATAATCCAGGAGAGCCCAGG ATACAGAACAGATAGTTTTTTTCCAGGAGAAAGGGACGTCAAGAACAGAT ATTTCATACTTCCTAGCCGGTGGCTGCTCTTGAAAGCTAAAGCGATGCCT TAAAATTTGCGCCACATTTCAGATGACGGATTGAATCTAGTACTTTCTTG TTTTCTTGTTTTACACACTTCAAATTTTGGCGGTAAATGTTACTTCCAAT CCCGCGAAAATGAAAATTATTTAATGTAGGAAATAAGTTGCTTCATTTCT TACATTGGCGATACGACTCTACGTCTAGCCTTCGTCCTTTATTCTATCGG GGTCACCCCCTCGTGCTGACAATGTCATAAAAAGGCGTGTACCATGTACC AATATGCTTATAGTATCAAAAACCAAGAGCAATGCGAGAAAAAAAGGTGT TTCTTTTAAAATACAGTCTGGTGAAAATTGATACTTTAATAATAGCGACA TTGCGCTAAACCCCCTCCCCCAGCAAGCAACCGACCTCCCACTCAAACTG AACTTTAAGAAAGAAATTTTTATTAACTCCCCACCATCGCGGTGCTTTTT ACTTAGTAGGGTTCTAAAGAATCTTGTCGAAAGCATCAAGGAAGGAGGGC CAGTCTAAATTGCGCCCTCCTTATATTTTTCTTATCAGTTTTATTTAATC AGATTTCAAATTTAAGATCTTTTTGTTTTCTTAATTTTTTCAAAGGCCCC TCATGTAGGGGGATTTATAAATGTGTGTCATGTTAGTGTAGGTTTGTGTG ATTTTGAGAGGCAAATATTAGAAATTATGTAGATTTTATTTTTGATGGCA TAAGTGATCTACTCGGTGGTACAGGTCACTCGAAAATTGTAGGGTTCTTT CAACCAGTCAGAATATATTATGTCATATCACAGTGGACAAGCTTATACAC TTTTATTTTTATGATTTCTAGAAGTTTCCTATTTTAACCTTGACGCCCGC CCCTTGAATAGCTACTAGAATTAGAAACGGGTCCCTAATTAACAGTAACT GTAATTACCCTATTACTAATTAATTTATTATTAAGATAGCAGTTTTTGAC ATGCTTTTTTTAATACTGTACAAAAATCAGGGAAGATCAGTGGCTTTGGA TGTTCTTAACGTTTTAGGTTATCAGTCTGAATGCAGGATGAATAAAAAAC TTTGAGCAATTTGTTGTGGCTTAATATATTTTTGTCATAATGTTTGTAAC CATCTTGGTAACTGATATGAAGACGCAATGATGTGATTCTTCTGGTCCTT TAGTCTTCTTGACTGAATATTGTCAGCACCCAATCATTAATCAACATCTG CTTAAACACCACTCCTCCTTCCTTTTACATCTCCCTTCATTAATTAATAA ACTTTAAATGACTTTTCCTTTTTCGAAATTAGCCTATAACGGAAGTTTTT TTCCTCCCATTTCTTTAGACTGGAAAAAATAAGAAGATTGAACCACTGCT GAGAGGCTAGTCATTTCTTAGAACTCTGCTTGAAATTTTGAATTTCATGT TGTTTCTTTAAAACCCCTGTATAAACCCTTTCCATTTCTTTTTAATCCCT GTTTTCATCATCTTCTTCCTGGTCTAGAGTTGGGGCTTCCTTTAAGCCTT GTTAGTTAATCATTTATAGGGATTTGAACTTGTTTTTTTACAAGCTTCCC TTCGAGTTCCTAGAAATATATACTTTTATCTCTGTCCTGTTTTTCTTGAT TTTTTGATAGGGGCTATTACAAGCTTAAAACTATACCAGACCCTGACATG GAGCTGAAATTAGTTTAATTAATTCAATACAGTCTTTTATAAGAAGTCAA AAAAACTTTAACAATACTTCACTGATTCTTCAAAAAAAGAAGGTATAATG GGCTCTTCCAGAAAAAAATCGACCATGGTGGAGGATATTTTGTCCGGGGG GTAGCAAAAAATCATCAAAATTTGCCTTGTCCGAGGGGGTNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNTGGGAACATATAAATAAATGAGCATTTCCAAAAATGC AATAAACAGAAAGAAAAATAAATGCAATCCCGCACGGGTCAGACATACAG AAATCTGTATGTTACTCCTTACGATTTTAGGTGAAGAAAAAAAGGCGTTG GAAGAAGCTTCTAGTTGGTTATTTTCCTTTTCTTTCACACGCGCTGAATA TTTAATTAGTGTTTACATTATTTGATTGACAGTTTTATAAACGACTAGTT TACTAGTCTACCCCAATCACAATGTCATGTTAAATAATAAAACTGCAGCC GATTTCAGTAACAGAGAACAGTGAGATACACCTGGTTCAGATTATTATAA GGGTTACCGGAACTTCAAAAGTTCTCGAGCGTTGAAACTTCTACATTTTC CCGAAATGGTAGACATCACCTAGCCCCGGTAACAATCTGATGAAGGGGAA TGGGACAATATTCAGATACAATTGTTTGCTTATGAGATGAGTCATTTTCA AGTTTTAACGCGTTTTTTTAGAAGAATTTTACGTTTTAAGTTTCTTCTAA TTAGGGCATTCTTATTTCAATACTGTACTCTGCCGCTATTTATTTTCTAC AAATTTCTACGTGGGACTCGTTTTTGAAAAAAGTAACCCAGAATGGGACT GAAATTACAAAATTTTCTTAAAATTTTCCAGATTTTTTTCAAATCCCCCG CCCCTTAAAAGGTACTACGGGGGACTGATTTCTCTATTTTGGTGTTTTTT GCGACCCTACCAACCTGGGACTCATAGAGGTGAAAAAAGGTACCCTGACC AGCGTCACATCCCCGTACCCCTTTTTGCCCAAGTATCCCCCCTCCGGGAC CCTGACCGTGAAACGAAGCCCTTTTAGTTGAAATCCTTTTGAGCTATACT TAATTGGGTTCAGTTACCACCAAGACCTTTCAAGCCATCCGCTTGTTATA TCTAAACACCAAACAACACTAGCGCCGTATATTGCAACGCCAAGAATTGA CACAAAGTGTAAGTATGACCTTGAAACTTGGCCTGTCCCCATTCTAGTAA TCTACAATAATATCTTTTTTTTTCCAGTTTGAATAGTTTAAAATAAAGAC AAAAATACTTAAAATAACTGGATAAATAACTCTGCTAAGGTTATCTTGAC CAAACACTAGTTCTAAGTATTATACACATCATACATATACATGTTTCTTA TAAAAGGATGATCTTTCTGTGACCTTAGCAACTATCGAGTAGAGGTGGGG CTATGTTGTTGACTTGACACCGCTTATAGTTTGAGGTCGAGTTTTTATGT CAATATTCAACAAAAATTTGATAAGTTCCTTATGTGGTGGGGAAATTTCT TGTGAGTAAAAGAACAGTATATGGAGAGAAAACTTTCGAACATAGAGCTG GTAGAGGCAGTGATTCAGCTAGAAAAGTGGATAATTTAAGGGCTCAATGA GTTGAATTTTTTTCTAAGCAAATTGAAGAAAAACAACGCGTTATATAAAG GTAGCGAGCCTTTCCGTCAGGTCCATGGTTGTTACTTTCGATTCGATTTT ACTTTTCAAAACCGCTACCTCATTTGGTATAGGATTCTATATTTGGTCTG TTGAGAAAGGCTGTCTAAATTTTCTAGGACTTTCTTAGCTATATTTTCAA GTATGCTGGGCTTTTATCGACTAATGTTGTTTTGATATGATCTTGAATTT AGCCCCTAAAGGCAAAGAAAATCTATTATGTCTAGACAGGAAATCTCCCC CTGATCAAAGGGAGGAATATCAAGGGTAGATCTTTAGATAATTTAAATAG GCTTACAGGATTCTTCTTGGGGAAATAGTGTTGTGTTATGAGTGGGTCGA GCTTTTTTGGAAATTAGCCTTAAATATGGTTTCTCATTCGTCATAATAGA AAATTTAGAGGTTTGATCATTTGGGGGATTATTTTAAAGAAAAGGCGGGG CGCTGTTGACAAATTTTGAAGGGAAGAATCTTATCTCTTGATTGAATTTG TACCCAATTTGTAGTAGGGTGAACTTTCTTCTTTAGGGGATTTACATGTT GCCGGTTGAATTTGGGTTCAAGGGTGTCCTGAAGTTCTGTCATGCGTTGT TGCTATATAGAGTTGAGTCTCCATCACAACTCGAACACGTACGGGGAACA CAAATTTGTCCGAGTTAAGTAAATTTTGAGTTATAGAGTAAGGCTTTCAA GGTATTGTTAACTGAAGGCATGAGAAAACCTATTCGAGTTAAGGAGACAT TCGAACTATAAAGTTTCGAGTTAAAGAAAGGTTACTGTAGAAATTAACTT GTTTGCGTTGTATTGAGAACTGTTATGGACAGAACGGTGTTGTGAAAAGA ATGTCATCCTTATGTTAAAGAGCACTATACTTATAGACCACATAAACTCA GATTCTCTGGTGACACAGAGCATTAAAAATATACGGGTGATCCTAGTCGC AGCATAGAAGGGATGTTTCGTTCCCACATAGTGGTTTATTGACAAAGTCG ATGACAAAGTTACAATTAGCTTTTATAAAAGCCTGAATGTTGTTATTCAG TCCCACATCGCCAAAATATGCGACGAAAACTACTTGTTGTAGTAACATTG AATGTCTGGTTTTGTCTGTTCGTTTGTTTCAAGCGTTCTTGGAAGTGACT TATGTAGTTTTTTTACATTTACAACAAGATGCAAGGTGTAAGATAACCCA GCTGGCACACAACGTTGTTTTAACGTTCAAATAACGTTATTTGAACGTTA TGAATGTCAAATGGACGTTGTTTTAACGTTGTGTGCCGGCTGGGTAAGGA TGGCAAAATAGATATTTACAAATCGAGCAATGCTAACTAATTTGTTCATT AAAATTTACTATAGTCAAGCTCCAAATTAAAAAAAAACACGTAAAAAAAA CTAGCCAGGCCTTAGCCTTAGAGATATAGTATTCGCATTAAAAGATTAAA GGCACTGGGGCTGAAACAATAGTCGGAAAGCTTATCACAGCTTTATGAGG ATTTGTGCTAAAAGATTTCTTTCGGACATTACTGAACCCCCGTCTTTATG AAGGGATTCTCATATTTCCCTTAATCACAGCGGATTTTCGAGAATTTCAT AATAAAGCTCATTTCCTCCCCTAGGGAACAAAATCAATAAAAGAAACCGA TTTTTTTTTGTAAGAATTATAATCATGTGGTACTGTATCGTGATAACTAT TTAGAAGAAAAAACATTGGAAAGATAGTCAAAAGTTTATGGAAGCTTTCA ACGTTTTGTCCAGTTTAGAGTCGGAGATTCGTTACATTGTTAATTTTGTC AGGTATCCTTGTTACATTTCTGCTAAGGAGCGGCCTACGACCGGATTCAA GCTACTTCTTTTTAGACTGTGTACACTTTGACCGTTAGCCTGTGTCATGC ATGCTACTAAGGTTTTTTCTAGATAATTTACTGTAAAAGAGGGAGAATTT TCGAACCTTCATAGAATCTCGAGAGAACTTACAACGTTTAAGTATTCCTG CCCAAATTTTCATATTTTGGCATTACCTTTAGCTTTTTTCCTATATAAAA AACATCTCGCCCTCTTTTTGAATAAATTTATTCAAAGTGTGGTTAGCCCC CTATCGCGTCCTTCTCTTAAAAATTCTCGAACGTATTCAAGAAAAATATG GTCTCCTAGGCAACGCTACGTAGGGATAGTTTGCATAATTATGTTATTGT AAGGAAGTGGTGTTCAATGTCCCCTACATATAACCGGGGGTCATGTATGT AACATTTTGAGGTTCTAAAACTTTATTTTACACCTATTTTGAAATTTAGA ATCTTAACTTGAGAGGTTATATTCACGAGGGAAGTTGAAGCCAAGTCTTA GTGATAGAATTGTTACTTGTATAAGACTCTGGTGTTTTTTAATTACATTT AATTCCGCCCTTTTTCTTATTCTTTCGGTTAAAAATGACCCCCTGGATGC GTGGAATTTTATTTTTATTTTATGTTGTGTGTTCATGAGATTCTCGGTTG TAAAGCTTATTATAATAGAAAGAGGATATAAACTCAGTGTGGTTTTCTTT TGACGGTTCGTAGCCCCGGGGTCAAATTGATGTCGCGCAAAGTAGAAAGA GAGATAGAGAGAGAGGGAAAGAGAAATATTGCAGTATGTAGTGCAGTAGT GGTGTGTTGATATGATATAAAAATTCTTGAGTTTTTATTGTTTCTTTTTT TCTTTTTTGTTGAAGGGAAGGGAGGAAAGATGGGAGAGGGGTTCTAAATT TTCATTTTGTTGTTTGTTGTGTTTTTTGGAAGGGAGTTGCAAGAAAATGC AAGTAAGGCTAAATTTTATCTTATTTTGAATTTTATTTATATTTTGTCTT TTTTTTGTTTTTTTTTTGTCCTCAGATGCCTCGTACTAGGATACAGTATA CTAAGTAAGTACACGTTCGTTTTATAAGAAGAAAATTTTTGAAGCCTTGG GATGTTCTTAACTTTTTGAGTTTTAAGCCTAAAAATGTTCTTAATATGTT CTTATTATTTTCTCCATTTTTTGACCATTTTCCTAAGAAATCGGGTGTTT TAGAGTCCACGAAGCCTTAAAATGTTTTAAACCTGTTCTTAGCATTTTGG CCATCGAAGCCTTAGTTTGTTCCTATAAAAAAACGTGTTCTGTATACTGT ATCTTAGAAAGAGCAAGTACGATAATTTTTATACCTAGCCCCTTTCCAAA GGGGCTTCCTAAGTTACATTTATTTGACTGTTATTTGTAACCTTGAAAGT TTATTCCATGTAAGAAATTGTATGAAAAACGGTCAACCTTTTTGTGTCAA CGAACTGAATCCTCAATGGTACAGGGGTGTCTCTCGATTTTGTTCTTCTG GCTTTAATCTATCATACAAAAAAAACACAAAATGTGGTAAGAAGCAATTA TATTTTGCGAGTAAACTTTTCATAATTTTTGAGTTTATTTTCATACCGTG TTTACCTATAACAATCCAAAAGTATCTAGTCTGAATCGTAGACCTCTTTA GATATACTTCCTACATGGAAACTTTTTTCGCTAGAGGATGAGCAGAAGCC TAAAAGTTCCGCCCTTGACAATCAAAATCGCCAAAATCGCAATAAAGTGC GTTTACCGCAGCACTATCGTAGTTTTTTTGATTTCGGCGTTTTTGATTGT CGAGGGAACTTTTTAATTGTTATAGATAAGTACGGTATCTGGCAAAAAAA TGATTGCTAAAGATTTTGCCCGCGATACTTTCTGCCTTTGGTGAATTATA TGACATAAATAAATTTTGACGTATGCTGTTTCACCTTACATGTTTTTTTA CAAGCATAACGCTTAAGCATATGAAGGCTCAGATTTACAGAATTCCTAAG CATAGCATAAGCATATTATGTCAGCCTGAAATATTTGTCAAGTTGAAAAC TTTGAAAACTTAAGCATACACGAGCCTGACCAAAGGGGCAGACACTTGTT TTTGAAAAAAACATGTACCAAAATGATAAGGCTTTTAGAAGGAAGGTTGC TATCACAGAACGATCTCTATCTGTCATGGAGATTATCACCTTTTTCTTTC CCTCTTACGAAATTGAGGAGTGACTTTCCCGCCCTTTGAAATTCCATTTG CCCGCCCTCACCTTCCTTCATTTAGATCACGTCTATTAGCTCAGAACTTG TTTAAGGAGTTTTGGGGAGGGGAACTGTAAGAATTGTATTTTTGACTTGT GTGGAAAAAATGTTCCTGTTTATAGTTGAGTCTTGACCTTACTTACAACT TGGAAAAATACAATTAGTTTCTAATCTTCTGTCATTTTAGTCCATTTAGC TACAATTTTATACAACATCAAAATTTCCTTGAAACAGGAGTGAATTTGAG TTTATCAGGTTCGAATATGTAAATTCATTGCATTAAGGAAGGGAGCTGTA AGAGTTGTATTACACCCCCGGGTTTGAAATGGTCAAAATGGACCAATTGC AAGAGGCTTAAACCTTTGAGTACCTTATGAAAAATCTTAATACATATTTA AAATCAGTAGCCCCACTTTTTTGCTAATCAGAATAAAGTCGGCAAATAGG GAACTTTTGATTATGTTTGCATACTTGACGATGCTTTTGATACACGAAAG AGATTTTCCAATTTGTCACATTAAAAAATTGATGAAAAGAAATCAGGAGA GGACAAACAATAAAATAGGTTACTAGAGGTTCAAAACTTGAAATGCCTTT TTGATATTTTGATATGAGTTGACAAAAATATTTGGAAGATTACAGTCCTG TCAACTGCCTTTGTCCAGATTGGTGGGGCATATAATATAATATTTAAGGA GGTTGGGGTACACGTTTTTTTTTTTATAAGGAACCTTAACTTTGCTCTGA GCCTGGAGTTCCTTATCTTTACAGAGAATTTCAGCCTCAAAGTTCCTTAT CGAGTTCCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNTCAGCCTGAGCAGTTCCTTAACAATTCCTTATTTTTTGAACCATTTT CAGCCTCGAGTTCCTTATAAACGTGTTCCTTATAAAAAAAAAACGTGTAT GGGTTAATCTTTTTGCCTTCTTTTCTTTTTCTCTTCACTCGTGATAAAAG GATCGGTGTCTCAAAGTAGGTATGGAGCTAAAAAGATAAGGTTTTACACA ACGAATTTACACACCTGTTGGCAATAGTTTTTCTTCTCTCTTTACACCCC TGTCTCAGTGACCTGGTGAGAATCTTTCAAGCTGATTTTGATAGAATTGA GGAGTTTAATGCCAAAAGGGGGATATAAAATAGCCTGTTTTTAATGCATG ATATATCACCCCTGATATTATACCATATTTGGGCTAAGGGCTTTCGTTTG CCATGGTTAGATTATCTAAAATAGATTTTACTTAACGTAATTGGCTAATT TGAGCCCTCAAGCCTTAGCAGCCTGTTTGCTTATAAAAAATCATGTAGTT TGTGGCGTAATATATGATTATTAGGATAATATTCTCAGGAAAATGTCAAG GGTTGGGTTTATCCTCCTCTCTCTCTCGTAAGAGCTTCCCTTACTCTGAA AAATCAACCTTGTCCATCTTTTCACAATCCTTCAAAAAGGATGTTAAAAA AGTTTTTGTTTTTTATTTTGCAAGATCGTTTATTGTAAAAAGGGGGCAGT CTAAAGGGGGTGGAGATGGGAGGGGACTTTTTAGATTGTTTTAATGTCTT TTCTTTTTTCACGATGAATTGCCCCCTTGTTATGGCCCGACCCCCTTTTC TTTTTTCTTTCAATCCGTCTTTTGTATATCTGCCCTTAATTATATATCCA TCACTCACCTATCAATACTATTTTTCTTTCTTCAAATTACGTATTCTATG CTGGCCAGTCGTGTTGGGGTAAAGAGGGTGAGAATGTTTTTATAGCTATG TATTTTGCCCTTTTTCTCGTCTTCGTTTTTGAGTAGGTCTTTTTATAATT TTATACTAGTTTCTCACGGCGAAAAAAGTATAGTTCTTTTACTTTTTTCC AATGATGGGTCATTGGGGAAAAGTATTCCTTCATAAAGGAATTCCTTAAT TTCAGACTGAAAGTTCAAAATATTTGGTTCATGTCAATGATCTTTATTAA GTTACATCAATCTGCTTTAGTCGGAGTTTTTCGAAAAGTGGTTCCTGCCG GTGGATGTGGATTTCCTTTATAGAGGGGGGTTTATCTAAAGAATCCTGCA TTTACTAAAAATTGACAAAAAGAACGACAAATTTCATAAAAGACGACAAA TTCCAGCGTCCAAAACCCCGATCGAAAGTGACTGTACCATCCCTACGTAT AAATTTCTCTTGCTTTATCACGGGAATTAACTACATATGGTTTAAAGAAC GACAAATTACGCATGCGTGCTGCAATTCAGGATTCTTTAGAGGAACAGAC TGATAGCCTGGCAACACCCACGTCGAGTAGTGGTTCTATTATTAGGGTTA AAAAGGTAACGTCGGAGGCTAAAGTCGAATCTCTATCATGGAACTTAAAT AAAAGTTTTATTAAAGTTCCTTGTTTCTATATACGTGGTTGCGTGGCCTG CTTGGCTCTCGTACAAATACTAACTTGGAAGTCACATTTCCCGCCAAAAT TTGAAAACAAGAAAATGCTAAATTCAATCCGTCATTCGAAAAGCGGTGCA AATCTAACAGAATCACTTTTGCTTGCCTGGGAAAAGTTTCTGATTCCTTC CTTATTTGTAATGATGTACTGGAGCCTTATCTGAGTGCTGGCCTAGCAGA CGAATAAGACGCAGTGGGTGAGTGAGTCTAGACTACGAAAGGGACGGGTT AAAGGGACCTAGGGGAGTAGAACCTAATCCTATTGTAGACAAGAACGGTA GACTATGCAGTTACAATAAAACTAATATTTAATAATGACAACGCTCTACA ATCGGGCTACAAATACGAAAAGGATACTTACAAACCTATGTCCTGAGCAG GTCCGCCGCCGATCGCTGCCGAAACAACACTAAAGTTTAGGAGGGCTGGA CACCAATTGCTAAGTTGCTGCCCAGTGGAGCGTGGAAGGCGCAGTTGGGC GTTAGAAGGGCGCTAGATACGATGGGTAAAGGTATAGCCTAAGGAACTTT AGTACAATGATTAGGGTAACAGATTGCAATTAAAAAAACTTTGATTGGAT AGAAGATTTTGGGTTACTGGGAATTCAGTTTGTATAGCTTAGTAAATCTA ATTGAATCTTTCTTTATTATTTCAGTGATTGATAAAATAATACAAACCAG CGAAGAAAGATGCCATCGTTACCAAAATCGATTTATCAATGGTCAATCGC TGATGTCCTTCATTGGTTGACTGAAAATGGTTTCGAACAAGAAACAGAAA GCTTCAAAAGTATGCCAATTGTTTTTATAATCGCTTTAAAAGGTTCTAAA CATCCCCTTCTCACAGACTCACTGGGACCCCTTCACACTGGAAAAATTCT ACAAATATCGTCCCTGGTGGAAAATTATCCTCCAATTTTTGTCCCCACTG AAAATAATCAAATAGAAATAAACCAATTAGTGTGGTCGCCTGACATTATT TGTAGGAAAAAAATATGATCCGGCTGAAATTTTGCACAGACCTTCCTTAT AGTATCCTTAAACCACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTGGTGGAACACCCTTTT TTAGGCCATTTTAGTGATGACGTCATAACAGGAAATTCAAAATATCGTCA TTTTCAGACTTTTAACAATATCTTCGCTGAAAATGGTTCAAATGTGATCA AATTTGGCCAAAAGTTGTGTTTTATGATGGCAATTAAGATGAAAGTATAA AAAATGACAAAATTTTATTTTTCAGGGGGTTTGGTTGAGTCAAAATAGCT CAAATGAGCAATTTTTGCCTATTTTTGCCTATTTTTTGCACTTTATCATC GCCTTACTTTAAAAGAGTCATTCAAACTCTTGATAAAGTATTCTAGCTTC CCGAGTAAAATGTTTGAACTTTTTAATGGATTCCCCAAGGGATCAGCATG CACTCCATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNGAAAAAAGAGGGAGAGCTTAAAAT ACAATTTTGTGAACACGCACATAAAACTTTCTACTCATAGTTGTGTTTCG ACTCGATACTTTAATTAGGGACACCCTGTACTTTGGATAATGTCCTTTTT ACAAACACTCATCTCCATTGTTTTCAATGGTTGAAAGAAGAGAATTCTAC TTGAGAGTCGTTAACGATTATCCAAAGTAGAGTGAACGTACTATAATATT TGAGACTTGCATTCTTATCTAAAATACGGGTCGGTGTGAGTTTCTATGTC ACTTGTATTTTTTTTTTAATTTAAAATGTTTATGAATTTTTTTGCTTATC TTCTAGTGGTAAACAATAATAAGAATTAGTAATATTGATTGATAACTTTA CTGGTATGAACCAAGAAACTTGTACGAACGCAGGAGTACTCAGATTATAT ACTAAAGGTTAGTTTTATAATCGTTCGTTTTGCACATTTGCTTAAAAATC CATGACAAGACCACCAGTACATAAATCTAGCTGTCAAAATTACACAATCA TCCGGTGAAGACCTTAGAAATTAAACCTATTTTTTACCCTGTTTTATAGT TACTTTGATAAGCTGTTCTTGGGTTTGTACCTTGTCTTACTGTCTTAGAA ATTACCCCTGCCTCATCGTCTCAAGAATTCATCTACTGATCTCAGTTGTA TGCATACCCGTGTCTCATTGCTTTATAACCCTGTCCCACCTAACTATCTC AAAAGTTTTGACCTGCTGNGCGGCAAGAAAGGAGAGAGTGGGCTGTTACA AGAGATCAAAAATCTGTCAGCTAAAGAGTCCAAAATTTTCGTGCATGAAA AGTGTCGTAAACGCCTAACTGACAAAAGAACGATTCCAATCGAAACCCTT CCTCCAAAACGACTACGATCTTCGTTGGATAGAATTTTCAATTGGAAGAA AGATTGCTTTTAATGTGCCAAACCATGTGATAGTAAAAAAGATGATTACA AGGAAGTCGAGACAATCGAGAGGCGCAAAATTGTTTTGGAGGCTGCATTA AACCGGAAGGACGACTGGGGAGAAGAAGTTAATGGAAGATTGCAAACATG CATAGATTTGCCAGCAGAAGAGGCAAGATACCACTGCTATTGTATGATGG ATTTCTGCTTACACGAAGCCCCGAAGCCTAAAAAAGGCAGACCTGAAAAT ATAGAAATGTCTGAAGCGTTCGAGATGTTTTGTCATCACTTCGAAAACAT GATGGATTGTGAAAGCTACACAATACAGAACATACAATACAAGAACTTCA CGAAAAGCTCCTTGAATTCAACGAGAACGGNCTAAAAAAGGCAGACCTGA AAATATAGAAATGTCTGAAGCGTTCGAGATGTTTTGTCATCACTTCGAAA ACATGATGGATTGTGAAAGCTACACAATACAAGAACTTCACGAAAAGCTC CTTGAATTCAACGAGAACGGATACACTCTTCGTAGATTTCGTGATAAACT AAGTGCCAAATACGAAGGGCACATCTACTTTGTTAAAGGAAAAGGTCGCC AAAGTGACTTAGTAATGTTCAGAAACCTTGCTGATTTTCACCTCCGAAGA CTTAAATCATTAATGACAAAGGGAGGCGTCTTAAGAGCAGCTGCACAAAT CATAAAAGCTGATATTCGAGATCTAGATGTCTCGAAATGGCTTGTTAATC ATTTGTCAAAACTTGGATTAGCAATAACACCCGATGAAGTTACAAGATTC AAACAATCAGTCATCGCAAATCTAAATGCCGATCAGTTGTCTCAAATCAA CTTAGAAACGCTGACTCAACTGTTCGCTCAGTGGATTGCAGATAATGCTG ACCATAACACTGTCACCCTATCAGGAAAAGGTACATTTCACGGTATGGGC ATCATTTGTACAAACCACCTCAAGAATATTTCGGACGTGTTCCACGATTG AAAAAACGCCTCAAAGTCGAAAGGCNTCAAATAATGTGCTGGTCTCTCAT TAAAGATGATGAAAAGGACTTCTTTGTCTTCGACGTATGTAAATGGGGAT GGAAAACACACAAGGCGGATGTACTTATTCCAGTTAAGACCGATCAACCT TTTGCTCCGGATTCTCTCCTGAAGGTAATCAGATGCAAGTGCAAAACAAC TACCAAAAACCCATGTGGACCGAAGATTTGCACGTGTAAGAAGTATAACC TACCTTGTGTTTCATCGTGTGGCGATTGCCATGGAGTTGATTGTAACACA ACAGAAATGTAATTTGGCTTTAAACTATCATTAACTATGCCAAATTTTAA TGCATCAATTTGACCCGAGTGAGAAACTCATTTTCCTTAAATTAGGTCAT AACTTCTGACCACTTGAGTTTTGAGGAAAACGTTCGCCTGTTTTGTAACT AAGGAGCAAGATTTTATAAAGACAAAGTGTTTAATATGGCAACTACTGTA GCTCCCCTTACTAGAAATCCACTCACCAAGCTGTCTGACGACTTCCCCTC ATTGCTTATTTCTCTAGGACGAGGAAAACGTTTTCGAAGAAGAAGAGTTA GACGAAGCGATTAGTGAACAACTCGAATGGACAAGACACTGAAAATATTT TTGAAAAACTCAATGATTGTTAAATAGATTTTTTTCCTTTTCAAAAAACT CTCAGATTAATTTTAAATTCAAGAATCCANNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNAAAAATCGTCAAAATTAGGCAAAAATTGCTAATTTGAGCTAT TTTGACCCAACCAAACCCCCTGAAAAATAAAATTTTGTCATTTTTTACAT TTTCATCTTAATTACCATCATAAAGCACAATTTTTGGCCAAATTTGATCA TATTTGAACCATCTTCAGCAAAGATATTGCTAAAAGTCTGAAAATGACGA TATTTTGAATTTCCTGTTATGACGTCATCACTAANNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTGGTTTAAGGATACTAT AAGGAAGGTCTGTGCAAAATTTCAGCCGGATCATATTTTTTTCCTACAAA GAGTGCTTTTTAAGCTGGCACGACCATACTAAATACTCACTGCGAAATGT TATGTTATTTTTTCCTTCCCTACTGAATTTTCCGAATTGAAAACAAAAGA ATTGAAATCCCCTGCCAAAAAAATATGGGGATATCGCCATTGTATTTTGG TCCGTTTTTTTATCTCAACTGGCTGAAAAAATCCTACCGGGTCTGTGAGA AGGGGGTGTTTCTAAGAATGTTTCCTGGCACGAAAGAATGTTGATCTGTT CAATAATTGTTCTTCTTTTATTGAAGTTTAGAAAATTACAAAAAAGTTAC AAATGATTTCTATCCCCACCCTCGTTCCAGTGACCCGGTCGGAATTCATT CAATAATGAAGGAGCTAAATTTACAATTTCTTGACTTTCATAAGTCGAAT AGATTTCAATTTTATCTACCGCCCGTCCAGCTCTATCGAAAATTTGAAAA AATTTCTTGCTGGGCCAGATAAATCTAATAATAAAAGTGAAAACTAAAAA TTTAATTTTGTTCATTTCTTGACGTTTCGTTGTCTTCTTTGCACCATTAC TATACTTGTAGTAAAAAAAATTCAAAACGAATTTCAATTTACAAAATTAA AAAAATATCACAAAATTAAAAAATTACTACCAGGTAATTACAAGTTGTTA AATTTCACAAAGGAACGAATACATATTAAAAAGGCTCAAGGGGGGATGAA GAAACGTGCTCATTCAAATTCGGTTTGAGCTCCCTTATTCCTATAGAAAA GGCTCAAAGCTCCTCCAGCTACAATAACGTTGGAATAATAGGGTATTTTT TTGGAAACGATTTTTTTGGACACTTAATTTCGTGAAGGGTCTAAGAAAAC CTGGTCTGTGACAAATGTTGTGATTAAATAAACGTTATAATAATGAAACA AATATCTGATATAAAAAACTACATGGAGCTAGTCTGTACATGGTGCAGCA AAACAATGCGCCATTTTTATAATCAGGCAAATTTGATCAATCAAGACCGT TTTGTCGCCTCCTCGTTTCCTGTTGAGTCATTTGTTTATCTTGGTTGAAA AAATTGCCGGTACCGAACTGTGATCTTCTCCCGATCTGGTCTACTCAGCA AAGATGGCGTATTAATTTGCTTCAACTCCCATGCGCTATGGCGTGAAATA GACAGAGTAACTCGATCTACTCTCTATGAATAAAAACTTCTTATTTTTCT TCTAGCTCATCAAATCGATGGTCGTGCGCTTGCTCTGCTTTATCGATGCG ATCTGAAAGAAGTCATCAGGAGGGTTGGACCGAGAGTGAAATTTCGCGCC AAATTATCACAATTGTTGACGTCACGTGGTATGAAGAACAACATGGAACC TAAAGAAACAAGAAATAACAACAACAGTAAGATTTTGAAGACAGTTCTGT TAAACTACAATCAAGGTCATGATATTTGAGAAAAAAGAGAAATTCCCCAG CAAATTTTGAAATCACAATCGATTTGTAAGTACTGTAAAGTAGGTTCAAA GGGTAGAGTTTTAACTCTGTTTTAACGCTAGACTTAGAATCTGAGGATCC AAAAGTTCAAAAATAGTCCAATAAGGCCTTGAAGTTAGAATAACCGGAAT TCTCAATATATTTCGACCATGATTGTAGATCATTTTTATGAACCCGACGA TGGTATAAACACCGAAAAGCTTCGAGACAAACAGTTTCTTGGATTTTTAA ATTTTGTTCAAATTCAATATTACCAGAGGAATGCAAAGAGATGGAAAAAC AGCTTTTCTGATTACTCAAAGTTCAACGATCACNGGAATGTAAAGAGATG GAAAAACAGCTTTTCTGATTACTCAAAGTTCAACGATCACTTCTATTGAA AATTCTATTGTAAAAACGTTGATTAGGTCATTAAATGTAAGTCCAGAAAA GACGGCTCGCCATACAAATCGGAAGGTTTCTACATGATTTGACGATAGAA ATGAAAATTTGTTTTTCCTTTTTTGCCGATTACTAGTTCAATTTTTAAGA ATAAGGAGCAATATTTTTACCAATGTATAGCAAAAGAAATTCTTAACGCA ATGATATTAAATTGGTTCTTGTAAAACTGTCAGAAGTCGAGTAAAATCAA GATGAAGTTATAATATTCTCGAGCTCTAGCTTTCCATATTATGGTGCGGT CATGATGCGGTTATATCAGTAGAATCGCTAGGAAATTCTGAGCAAGAAGA TATAGGTACCTTTTCGTATAGGAGAGGTGTACCCAAAATATAAGCCCTAA AAGTTTGCGCATAATCAGGCTTGAAACAAAAGAATTATTTCACAACACGC TACTACTAGTAATTATGCAGATTTTTTATAGCGACAACAAAAGAAACCTA TTTACTCGACATAAACTCCCTTAAGGGCAAGAGACCTGGTATATGACGAG CAGTTTTTCCATTGTTTTCAAGAAGCTGTTTTTCCATCTCTTTACATTCC TCTGATATTACATGACGAACTTTGGCACAAATAATTTCTTATTCGTTAAA TATTTTCAATATATCGAATTCCAAAGATGTTACGATTGTTCGAGTCTCTT ACGAGAGCTTTACGAAGAAGCTTTTACTGTTTAAGCTGTAACATTTTGAA GCATTGAAAGTTTTTTGTAGCTCTTGTTGCGCGGTTTTAAGACAAAATCT TCTGTTTTTTTTTATAAATTATCTTACTTAAATTTAACTTAGAAATTCTT TATAGGTCGTACTGTATACCATTCATTGCTTTTCAACATTTTATTCAGAT AATACAACTTCGTTCTACGACCCTAATTTCGGACAGCACGTTGTCATGCC AATGTATGGTCAATACGGACAACGACCACCCTACCCTCAACAAAACAATG GAATGAAAAAGAACCAATCGAATGGCTTCTATCCACAACAAAACCAAATG CAACAAAGGAATTATTACCAACAAAAACAACAACAACAACAACAACAACA ACAACAGCAACAGCAGCAACAGCAACAGCCAATGAGAATGAACTATTCTA ATAATCAGCCAATGAGCGGCTGTCAACAAAACATGCCATCCAATGGGAAT ACAGGAATGAATCATAACGGACCAATCAGAAATCCGCATTCGAACAATAC CGCAAACAAAACATGCGATTGCATGACGGTCAAAGCAAATGATTACCGTA GTGTAAAGCGCCCGCAACAAACACAAAATCAACCGGAAACTAACCAAATC AACGGAAGCTCAAGTGCGGAAAACAAAACAGAGAAAATTCCCTACACAAA AGATGAAGTAGACATCACAAAGTTTTTAGAGGGGTCTGGGTTTAAAAAAG AACCAATCGATTCGCTGGAAAGCCCGAATCAACCAATCAGTGAGCACAAA GCAAATGGTTCCCACGGCTCTCCCCCACTTTCGTTTTGCAGAAGCTCACC TAACAACAACGATGAAAACCTTGATCCGACCCACTATACGAATACCCACG ATGGAGGGAGCTTGAATGGAAGTTATGATGGTGGAAATTCTCCATTGAAT CCTGAAGAATCCGCGATGGAGGACGATGAACACTTCCCCGTGTTGGATAT TACAGAACGTACCGAAGAGCTAGAGAATAAAATGCAGAACGACGGAATGA ATGTTTTTCACAATGGTTTCCATGGTAGTAACAACGGGATGAACAGTAAG CTGGGAATTGAAGCTGTGACCAATAGACTTGCGTTACGTGAACGTTCGAA GATTTTTCGACGTAGTGAAAAGAAATGGCACGTCGCTGTTAACGAAACGG CATACCAACTCGTTTTAAAAGATCCCAGTTTGCTGATGAGGAAAAAAGAT TTACGAACAATGGCAGAAACTGAAGTTCGAAAGACCTATCGCTTTGCTAA AGGTATGTATTTGATTATTATGTATTAGAGTTAACGATTCGTGGTATTCA TGACCTAATGTTTTATACGGAAACCCCATAAAGACGGGGTTTTAAGGTTC GCCACTGATTTTGAATCTAAACATTAAAATTAGCGGTAAGCGCCCGGGCT ATTTCCGATGCTTCCGTATGAAGCATTGCGTCATGAACTTCATGAATAGA CCTTTTCATAAATTACGTCACGAACATCATTTGCCTCGTATTCAAACAAT TACCATGGTGATTATATCCCTTGAGACATTAAATGATATGAATAGAAATT AGTATTAATAAAATCCACTGGGAGTTAATCACTTTGGCAATAATTTTAAA ACGAGGCAAATGATGTTCGTGACGTAATTTATGAAGAGGTCTATCCTTTA AAATTTACTTCAAAATCAACTTTTCGAAATATAAGGAAGATGGATGTAGA ATCTTGTTTACGACATTCGTTCGATGGAAACCATGTGAGGCACATGTGAG TAAGCTGTCACGATATTAATATACTTGCTCAATAACCCAAAGACAAAATC AGGTACTCCATTTTTGAAAATCTTCGTTTCTTTAGGTAAATCACGTTCGA TAGCCATTCCAGAGAATCGAGCGGCAGCGGAAGAGAAGAAGAAACAGAAA TTGACCAGAGAGAAAATCGAAGAAATGAAAAGACAACTGAAAGCTGAAGG TAAAGAATCTAAAGATGGCCCACTTATTTTGCCCAATTCACAATTGTGAA TTTAAGTGGGCTGTCTAAAGTCAATGCATTGCCCTCTTTTGACGTCAATG CAAGGTCTTCTTTGAACTCTTTTCCAAGCAAAGATTTTAGCTGCCAACTT TTTGCTCAACTTCTGCCTACTCTAACAATAAGAATAGTCAGGACAGAAAG TCGGCCGTCTAAACTAGAGCTAATCAACCCAATGCTTTTCCCGAACAACA AAGCACAATGGATTAACTTACTAAGAAGATTTTTGTGTGTTTAATAAACA AAACTTTAAGAGTGAGTTAACCCACGGTGCTTGTTCCCCCATCCAAATCA AGAAATCTTATTGGGTAAAAAGTAGCACATGACTTCCTTATGGCAAAAGT ATGACTGAAAGAATCTAAATATCCTCGATAGATTCGAGATGTTCATTATA TAATGTTTTTACGGGAGCACAAAAAATAGACCGGATGTTGAATTTAAACA ATAAAACTAGTGACAAACGCCCGTGCTATTTTTATGCTTCCGTATAAAAC ATTACGTCATGGATATAATGCATTCACTTGCTTACTTATGTCGTTCAATG TCCCATGCATTCAATATTCCTAAACGTACTCACTTATACGCTCACATTTA CACGTCCACATTCTTATTACAGGCGAGGAGTTGAGTCGTCAAATGCGACA GTGTCAAGTGAACATACAACTGGCCAATCAACAATCAGATATGACGCGAT CCGCAGAACTAAGAGACGAAATGCAAAAACTCAACCAACAGCAGGCTAAA ATCCATTTTTCAATGCACGAGCTGATCACTAAAGAACGTAAACTGGATGC CAGTGTAAATAAAATGATGCAAAACGGACATGCACCCACAATGAGTATGG TCAACACTCAAGGACATCAAATGATGGATTTATCTGATGAAGGGAACTCT TATTATAACAACAATGAAAATATAAACGATGACCCAACTTTAACCTCTCC TACCCAACTTGTCTCATTCGTTGCCTCGCAACCAACTACATTATCTCCTT TAAATGCAGTATTACCTCCGCAAAGTGCCGTATTATCTCCCGAAGGATCG GCAACACAGGTCCACGTGGACAATGATGGACGTGTAATGCAATTCGGCAG CCAATCAGAAACACCGAATGGCGTAATGATTATAAATAATGATGAAATGA CGTCATCGCCTCAAAATATGACGTCATCACAACATATGCCGCCGCCGATG GAGAATGGTGGGAATAATGCTTACATCAGCATGTAGAATGTATTCAAGAA GGTGTTGAGTGTTAGCTTGTTTTCGTTGTAGATTTTTTTTTATAAACTGT GTATTTATACTCTGAAATATCATTTTGGAATAAAAATT

Coding sequence (CDS) from alignment at sc0000001:2419716..2443503-

>TCONS_00000254 ID=TCONS_00000254|Name=TCONS_00000254|organism=Clytia hemisphaerica|type=CDS|length=10515bp|location=Sequence derived from alignment at sc0000001:2419716..2443503- (Clytia hemisphaerica)
GCGAGGAGTTGAGTCGTCAAATGCGACAGTGTCAAGTGAACATACAACTG
GCCAATCAACAATCAGATATGACGCGATCCGCAGAACTAAGAGACGAAAT
GCAAAAACTCAACCAACAGCAGGCTAAAATCCATTTTTCAATGCACGAGC
TGATCACTAAAGAACGTAAACTGGATGCCAGTGTAAATAAAATGATGCAA
AACGGACATGCACCCACAATGAGTATGGTCAACACTCAAGGACATCAAAT
GATGGATTTATCTGATGAAGGGAACTCTTATTATAACAACAATGAAAATA
TAAACGATGACCCAACTTTAACCTCTCCTACCCAACTTGTCTCATTCGTT
GCCTCGCAACCAACTACATTATCTCCTTTAAATGCAGTATTACCTCCGCA
AAGTGCCGTATTATCTCCCGAAGGATCGGCAACACAGGTCCACGTGGACA
ATGATGGACGTGTAATGCAATTCGGCAGCCAATCAGAAACACCGAATGGC
GTAATGATTATAAATAATGATGAAATGACGTCATCGCCTCAAAATATGAC
GTCATCACAACATATGCCGCCGCCGATGGAGAATGGTGGGAATAATGCTT
ACATCAGCATGTAGGTAAATCACGTTCGATAGCCATTCCAGAGAATCGAG
CGGCAGCGGAAGAGAAGAAGAAACAGAAATTGACCAGAGAGAAAATCGAA
GAAATGAAAAGACAACTGAAAGCTGAAGATAATACAACTTCGTTCTACGA
CCCTAATTTCGGACAGCACGTTGTCATGCCAATGTATGGTCAATACGGAC
AACGACCACCCTACCCTCAACAAAACAATGGAATGAAAAAGAACCAATCG
AATGGCTTCTATCCACAACAAAACCAAATGCAACAAAGGAATTATTACCA
ACAAAAACAACAACAACAACAACAACAACAACAACAGCAACAGCAGCAAC
AGCAACAGCCAATGAGAATGAACTATTCTAATAATCAGCCAATGAGCGGC
TGTCAACAAAACATGCCATCCAATGGGAATACAGGAATGAATCATAACGG
ACCAATCAGAAATCCGCATTCGAACAATACCGCAAACAAAACATGCGATT
GCATGACGGTCAAAGCAAATGATTACCGTAGTGTAAAGCGCCCGCAACAA
ACACAAAATCAACCGGAAACTAACCAAATCAACGGAAGCTCAAGTGCGGA
AAACAAAACAGAGAAAATTCCCTACACAAAAGATGAAGTAGACATCACAA
AGTTTTTAGAGGGGTCTGGGTTTAAAAAAGAACCAATCGATTCGCTGGAA
AGCCCGAATCAACCAATCAGTGAGCACAAAGCAAATGGTTCCCACGGCTC
TCCCCCACTTTCGTTTTGCAGAAGCTCACCTAACAACAACGATGAAAACC
TTGATCCGACCCACTATACGAATACCCACGATGGAGGGAGCTTGAATGGA
AGTTATGATGGTGGAAATTCTCCATTGAATCCTGAAGAATCCGCGATGGA
GGACGATGAACACTTCCCCGTGTTGGATATTACAGAACGTACCGAAGAGC
TAGAGAATAAAATGCAGAACGACGGAATGAATGTTTTTCACAATGGTTTC
CATGGTAGTAACAACGGGATGAACAGTAAGCTGGGAATTGAAGCTGTGAC
CAATAGACTTGCGTTACGTGAACGTTCGAAGATTTTTCGACGTAGTGAAA
AGAAATGGCACGTCGCTGTTAACGAAACGGCATACCAACTCGTTTTAAAA
GATCCCAGTTTGCTGATGAGGAAAAAAGATTTACGAACAATGGCAGAAAC
TGAAGTTCGAAAGACCTATCGCTTTGCTAAAGCTCATCAAATCGATGGTC
GTGCGCTTGCTCTGCTTTATCGATGCGATCTGAAAGAAGTCATCAGGAGG
GTTGGACCGAGAGTGAAATTTCGCGCCAAATTATCACAATTGTTGACGTC
ACGTGGTATGAAGAACAACATGGAACCTAAAGAAACAAGAAATAACAACA
ACAATGCCATCGTTACCAAAATCGATTTATCAATGGTCAATCGCTGATGT
CCTTCATTGGTTGACTGAAAATGGTTTCGAACAAGAAACAGAAAGCTTCA
AAAGCGAGGAGTTGAGTCGTCAAATGCGACAGTGTCAAGTGAACATACAA
CTGGCCAATCAACAATCAGATATGACGCGATCCGCAGAACTAAGAGACGA
AATGCAAAAACTCAACCAACAGCAGGCTAAAATCCATTTTTCAATGCACG
AGCTGATCACTAAAGAACGTAAACTGGATGCCAGTGTAAATAAAATGATG
CAAAACGGACATGCACCCACAATGAGTATGGTCAACACTCAAGGACATCA
AATGATGGATTTATCTGATGAAGGGAACTCTTATTATAACAACAATGAAA
ATATAAACGATGACCCAACTTTAACCTCTCCTACCCAACTTGTCTCATTC
GTTGCCTCGCAACCAACTACATTATCTCCTTTAAATGCAGTATTACCTCC
GCAAAGTGCCGTATTATCTCCCGAAGGATCGGCAACACAGGTCCACGTGG
ACAATGATGGACGTGTAATGCAATTCGGCAGCCAATCAGAAACACCGAAT
GGCGTAATGATTATAAATAATGATGAAATGACGTCATCGCCTCAAAATAT
GACGTCATCACAACATATGCCGCCGCCGATGGAGAATGGTGGGAATAATG
CTTACATCAGCATGTAGGTAAATCACGTTCGATAGCCATTCCAGAGAATC
GAGCGGCAGCGGAAGAGAAGAAGAAACAGAAATTGACCAGAGAGAAAATC
GAAGAAATGAAAAGACAACTGAAAGCTGAAGATAATACAACTTCGTTCTA
CGACCCTAATTTCGGACAGCACGTTGTCATGCCAATGTATGGTCAATACG
GACAACGACCACCCTACCCTCAACAAAACAATGGAATGAAAAAGAACCAA
TCGAATGGCTTCTATCCACAACAAAACCAAATGCAACAAAGGAATTATTA
CCAACAAAAACAACAACAACAACAACAACAACAACAACAGCAACAGCAGC
AACAGCAACAGCCAATGAGAATGAACTATTCTAATAATCAGCCAATGAGC
GGCTGTCAACAAAACATGCCATCCAATGGGAATACAGGAATGAATCATAA
CGGACCAATCAGAAATCCGCATTCGAACAATACCGCAAACAAAACATGCG
ATTGCATGACGGTCAAAGCAAATGATTACCGTAGTGTAAAGCGCCCGCAA
CAAACACAAAATCAACCGGAAACTAACCAAATCAACGGAAGCTCAAGTGC
GGAAAACAAAACAGAGAAAATTCCCTACACAAAAGATGAAGTAGACATCA
CAAAGTTTTTAGAGGGGTCTGGGTTTAAAAAAGAACCAATCGATTCGCTG
GAAAGCCCGAATCAACCAATCAGTGAGCACAAAGCAAATGGTTCCCACGG
CTCTCCCCCACTTTCGTTTTGCAGAAGCTCACCTAACAACAACGATGAAA
ACCTTGATCCGACCCACTATACGAATACCCACGATGGAGGGAGCTTGAAT
GGAAGTTATGATGGTGGAAATTCTCCATTGAATCCTGAAGAATCCGCGAT
GGAGGACGATGAACACTTCCCCGTGTTGGATATTACAGAACGTACCGAAG
AGCTAGAGAATAAAATGCAGAACGACGGAATGAATGTTTTTCACAATGGT
TTCCATGGTAGTAACAACGGGATGAACAGTAAGCTGGGAATTGAAGCTGT
GACCAATAGACTTGCGTTACGTGAACGTTCGAAGATTTTTCGACGTAGTG
AAAAGAAATGGCACGTCGCTGTTAACGAAACGGCATACCAACTCGTTTTA
AAAGATCCCAGTTTGCTGATGAGGAAAAAAGATTTACGAACAATGGCAGA
AACTGAAGTTCGAAAGACCTATCGCTTTGCTAAAGCTCATCAAATCGATG
GTCGTGCGCTTGCTCTGCTTTATCGATGCGATCTGAAAGAAGTCATCAGG
AGGGTTGGACCGAGAGTGAAATTTCGCGCCAAATTATCACAATTGTTGAC
GTCACGTGGTATGAAGAACAACATGGAACCTAAAGAAACAAGAAATAACA
ACAACAATGCCATCGTTACCAAAATCGATTTATCAATGGTCAATCGCTGA
TGTCCTTCATTGGTTGACTGAAAATGGTTTCGAACAAGAAACAGAAAGCT
TCAAAAGCGAGGAGTTGAGTCGTCAAATGCGACAGTGTCAAGTGAACATA
CAACTGGCCAATCAACAATCAGATATGACGCGATCCGCAGAACTAAGAGA
CGAAATGCAAAAACTCAACCAACAGCAGGCTAAAATCCATTTTTCAATGC
ACGAGCTGATCACTAAAGAACGTAAACTGGATGCCAGTGTAAATAAAATG
ATGCAAAACGGACATGCACCCACAATGAGTATGGTCAACACTCAAGGACA
TCAAATGATGGATTTATCTGATGAAGGGAACTCTTATTATAACAACAATG
AAAATATAAACGATGACCCAACTTTAACCTCTCCTACCCAACTTGTCTCA
TTCGTTGCCTCGCAACCAACTACATTATCTCCTTTAAATGCAGTATTACC
TCCGCAAAGTGCCGTATTATCTCCCGAAGGATCGGCAACACAGGTCCACG
TGGACAATGATGGACGTGTAATGCAATTCGGCAGCCAATCAGAAACACCG
AATGGCGTAATGATTATAAATAATGATGAAATGACGTCATCGCCTCAAAA
TATGACGTCATCACAACATATGCCGCCGCCGATGGAGAATGGTGGGAATA
ATGCTTACATCAGCATGTAGGTAAATCACGTTCGATAGCCATTCCAGAGA
ATCGAGCGGCAGCGGAAGAGAAGAAGAAACAGAAATTGACCAGAGAGAAA
ATCGAAGAAATGAAAAGACAACTGAAAGCTGAAGATAATACAACTTCGTT
CTACGACCCTAATTTCGGACAGCACGTTGTCATGCCAATGTATGGTCAAT
ACGGACAACGACCACCCTACCCTCAACAAAACAATGGAATGAAAAAGAAC
CAATCGAATGGCTTCTATCCACAACAAAACCAAATGCAACAAAGGAATTA
TTACCAACAAAAACAACAACAACAACAACAACAACAACAACAGCAACAGC
AGCAACAGCAACAGCCAATGAGAATGAACTATTCTAATAATCAGCCAATG
AGCGGCTGTCAACAAAACATGCCATCCAATGGGAATACAGGAATGAATCA
TAACGGACCAATCAGAAATCCGCATTCGAACAATACCGCAAACAAAACAT
GCGATTGCATGACGGTCAAAGCAAATGATTACCGTAGTGTAAAGCGCCCG
CAACAAACACAAAATCAACCGGAAACTAACCAAATCAACGGAAGCTCAAG
TGCGGAAAACAAAACAGAGAAAATTCCCTACACAAAAGATGAAGTAGACA
TCACAAAGTTTTTAGAGGGGTCTGGGTTTAAAAAAGAACCAATCGATTCG
CTGGAAAGCCCGAATCAACCAATCAGTGAGCACAAAGCAAATGGTTCCCA
CGGCTCTCCCCCACTTTCGTTTTGCAGAAGCTCACCTAACAACAACGATG
AAAACCTTGATCCGACCCACTATACGAATACCCACGATGGAGGGAGCTTG
AATGGAAGTTATGATGGTGGAAATTCTCCATTGAATCCTGAAGAATCCGC
GATGGAGGACGATGAACACTTCCCCGTGTTGGATATTACAGAACGTACCG
AAGAGCTAGAGAATAAAATGCAGAACGACGGAATGAATGTTTTTCACAAT
GGTTTCCATGGTAGTAACAACGGGATGAACAGTAAGCTGGGAATTGAAGC
TGTGACCAATAGACTTGCGTTACGTGAACGTTCGAAGATTTTTCGACGTA
GTGAAAAGAAATGGCACGTCGCTGTTAACGAAACGGCATACCAACTCGTT
TTAAAAGATCCCAGTTTGCTGATGAGGAAAAAAGATTTACGAACAATGGC
AGAAACTGAAGTTCGAAAGACCTATCGCTTTGCTAAAGCTCATCAAATCG
ATGGTCGTGCGCTTGCTCTGCTTTATCGATGCGATCTGAAAGAAGTCATC
AGGAGGGTTGGACCGAGAGTGAAATTTCGCGCCAAATTATCACAATTGTT
GACGTCACGTGGTATGAAGAACAACATGGAACCTAAAGAAACAAGAAATA
ACAACAACAATGCCATCGTTACCAAAATCGATTTATCAATGGTCAATCGC
TGATGTCCTTCATTGGTTGACTGAAAATGGTTTCGAACAAGAAACAGAAA
GCTTCAAAAGCGAGGAGTTGAGTCGTCAAATGCGACAGTGTCAAGTGAAC
ATACAACTGGCCAATCAACAATCAGATATGACGCGATCCGCAGAACTAAG
AGACGAAATGCAAAAACTCAACCAACAGCAGGCTAAAATCCATTTTTCAA
TGCACGAGCTGATCACTAAAGAACGTAAACTGGATGCCAGTGTAAATAAA
ATGATGCAAAACGGACATGCACCCACAATGAGTATGGTCAACACTCAAGG
ACATCAAATGATGGATTTATCTGATGAAGGGAACTCTTATTATAACAACA
ATGAAAATATAAACGATGACCCAACTTTAACCTCTCCTACCCAACTTGTC
TCATTCGTTGCCTCGCAACCAACTACATTATCTCCTTTAAATGCAGTATT
ACCTCCGCAAAGTGCCGTATTATCTCCCGAAGGATCGGCAACACAGGTCC
ACGTGGACAATGATGGACGTGTAATGCAATTCGGCAGCCAATCAGAAACA
CCGAATGGCGTAATGATTATAAATAATGATGAAATGACGTCATCGCCTCA
AAATATGACGTCATCACAACATATGCCGCCGCCGATGGAGAATGGTGGGA
ATAATGCTTACATCAGCATGTAGGTAAATCACGTTCGATAGCCATTCCAG
AGAATCGAGCGGCAGCGGAAGAGAAGAAGAAACAGAAATTGACCAGAGAG
AAAATCGAAGAAATGAAAAGACAACTGAAAGCTGAAGATAATACAACTTC
GTTCTACGACCCTAATTTCGGACAGCACGTTGTCATGCCAATGTATGGTC
AATACGGACAACGACCACCCTACCCTCAACAAAACAATGGAATGAAAAAG
AACCAATCGAATGGCTTCTATCCACAACAAAACCAAATGCAACAAAGGAA
TTATTACCAACAAAAACAACAACAACAACAACAACAACAACAACAGCAAC
AGCAGCAACAGCAACAGCCAATGAGAATGAACTATTCTAATAATCAGCCA
ATGAGCGGCTGTCAACAAAACATGCCATCCAATGGGAATACAGGAATGAA
TCATAACGGACCAATCAGAAATCCGCATTCGAACAATACCGCAAACAAAA
CATGCGATTGCATGACGGTCAAAGCAAATGATTACCGTAGTGTAAAGCGC
CCGCAACAAACACAAAATCAACCGGAAACTAACCAAATCAACGGAAGCTC
AAGTGCGGAAAACAAAACAGAGAAAATTCCCTACACAAAAGATGAAGTAG
ACATCACAAAGTTTTTAGAGGGGTCTGGGTTTAAAAAAGAACCAATCGAT
TCGCTGGAAAGCCCGAATCAACCAATCAGTGAGCACAAAGCAAATGGTTC
CCACGGCTCTCCCCCACTTTCGTTTTGCAGAAGCTCACCTAACAACAACG
ATGAAAACCTTGATCCGACCCACTATACGAATACCCACGATGGAGGGAGC
TTGAATGGAAGTTATGATGGTGGAAATTCTCCATTGAATCCTGAAGAATC
CGCGATGGAGGACGATGAACACTTCCCCGTGTTGGATATTACAGAACGTA
CCGAAGAGCTAGAGAATAAAATGCAGAACGACGGAATGAATGTTTTTCAC
AATGGTTTCCATGGTAGTAACAACGGGATGAACAGTAAGCTGGGAATTGA
AGCTGTGACCAATAGACTTGCGTTACGTGAACGTTCGAAGATTTTTCGAC
GTAGTGAAAAGAAATGGCACGTCGCTGTTAACGAAACGGCATACCAACTC
GTTTTAAAAGATCCCAGTTTGCTGATGAGGAAAAAAGATTTACGAACAAT
GGCAGAAACTGAAGTTCGAAAGACCTATCGCTTTGCTAAAGCTCATCAAA
TCGATGGTCGTGCGCTTGCTCTGCTTTATCGATGCGATCTGAAAGAAGTC
ATCAGGAGGGTTGGACCGAGAGTGAAATTTCGCGCCAAATTATCACAATT
GTTGACGTCACGTGGTATGAAGAACAACATGGAACCTAAAGAAACAAGAA
ATAACAACAACAATGCCATCGTTACCAAAATCGATTTATCAATGGTCAAT
CGCTGATGTCCTTCATTGGTTGACTGAAAATGGTTTCGAACAAGAAACAG
AAAGCTTCAAAAGCGAGGAGTTGAGTCGTCAAATGCGACAGTGTCAAGTG
AACATACAACTGGCCAATCAACAATCAGATATGACGCGATCCGCAGAACT
AAGAGACGAAATGCAAAAACTCAACCAACAGCAGGCTAAAATCCATTTTT
CAATGCACGAGCTGATCACTAAAGAACGTAAACTGGATGCCAGTGTAAAT
AAAATGATGCAAAACGGACATGCACCCACAATGAGTATGGTCAACACTCA
AGGACATCAAATGATGGATTTATCTGATGAAGGGAACTCTTATTATAACA
ACAATGAAAATATAAACGATGACCCAACTTTAACCTCTCCTACCCAACTT
GTCTCATTCGTTGCCTCGCAACCAACTACATTATCTCCTTTAAATGCAGT
ATTACCTCCGCAAAGTGCCGTATTATCTCCCGAAGGATCGGCAACACAGG
TCCACGTGGACAATGATGGACGTGTAATGCAATTCGGCAGCCAATCAGAA
ACACCGAATGGCGTAATGATTATAAATAATGATGAAATGACGTCATCGCC
TCAAAATATGACGTCATCACAACATATGCCGCCGCCGATGGAGAATGGTG
GGAATAATGCTTACATCAGCATGTAGGTAAATCACGTTCGATAGCCATTC
CAGAGAATCGAGCGGCAGCGGAAGAGAAGAAGAAACAGAAATTGACCAGA
GAGAAAATCGAAGAAATGAAAAGACAACTGAAAGCTGAAGATAATACAAC
TTCGTTCTACGACCCTAATTTCGGACAGCACGTTGTCATGCCAATGTATG
GTCAATACGGACAACGACCACCCTACCCTCAACAAAACAATGGAATGAAA
AAGAACCAATCGAATGGCTTCTATCCACAACAAAACCAAATGCAACAAAG
GAATTATTACCAACAAAAACAACAACAACAACAACAACAACAACAACAGC
AACAGCAGCAACAGCAACAGCCAATGAGAATGAACTATTCTAATAATCAG
CCAATGAGCGGCTGTCAACAAAACATGCCATCCAATGGGAATACAGGAAT
GAATCATAACGGACCAATCAGAAATCCGCATTCGAACAATACCGCAAACA
AAACATGCGATTGCATGACGGTCAAAGCAAATGATTACCGTAGTGTAAAG
CGCCCGCAACAAACACAAAATCAACCGGAAACTAACCAAATCAACGGAAG
CTCAAGTGCGGAAAACAAAACAGAGAAAATTCCCTACACAAAAGATGAAG
TAGACATCACAAAGTTTTTAGAGGGGTCTGGGTTTAAAAAAGAACCAATC
GATTCGCTGGAAAGCCCGAATCAACCAATCAGTGAGCACAAAGCAAATGG
TTCCCACGGCTCTCCCCCACTTTCGTTTTGCAGAAGCTCACCTAACAACA
ACGATGAAAACCTTGATCCGACCCACTATACGAATACCCACGATGGAGGG
AGCTTGAATGGAAGTTATGATGGTGGAAATTCTCCATTGAATCCTGAAGA
ATCCGCGATGGAGGACGATGAACACTTCCCCGTGTTGGATATTACAGAAC
GTACCGAAGAGCTAGAGAATAAAATGCAGAACGACGGAATGAATGTTTTT
CACAATGGTTTCCATGGTAGTAACAACGGGATGAACAGTAAGCTGGGAAT
TGAAGCTGTGACCAATAGACTTGCGTTACGTGAACGTTCGAAGATTTTTC
GACGTAGTGAAAAGAAATGGCACGTCGCTGTTAACGAAACGGCATACCAA
CTCGTTTTAAAAGATCCCAGTTTGCTGATGAGGAAAAAAGATTTACGAAC
AATGGCAGAAACTGAAGTTCGAAAGACCTATCGCTTTGCTAAAGCTCATC
AAATCGATGGTCGTGCGCTTGCTCTGCTTTATCGATGCGATCTGAAAGAA
GTCATCAGGAGGGTTGGACCGAGAGTGAAATTTCGCGCCAAATTATCACA
ATTGTTGACGTCACGTGGTATGAAGAACAACATGGAACCTAAAGAAACAA
GAAATAACAACAACAATGCCATCGTTACCAAAATCGATTTATCAATGGTC
AATCGCTGATGTCCTTCATTGGTTGACTGAAAATGGTTTCGAACAAGAAA
CAGAAAGCTTCAAAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000138XLOC_000138Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000254-exon-sc0000001-1575043694:2443481..2443503TCONS_00000254-exon-sc0000001-1575043694:2443481..2443503Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1575043694:2430495..2430628TCONS_00000254-exon-sc0000001-1575043694:2430495..2430628Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1575043694:2424278..2424448TCONS_00000254-exon-sc0000001-1575043694:2424278..2424448Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1575043694:2421802..2422905TCONS_00000254-exon-sc0000001-1575043694:2421802..2422905Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1575043694:2421105..2421218TCONS_00000254-exon-sc0000001-1575043694:2421105..2421218Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1575043694:2419716..2420431TCONS_00000254-exon-sc0000001-1575043694:2419716..2420431Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1510915933:2443481..2443503TCONS_00000254-exon-sc0000001-1510915933:2443481..2443503Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1510915933:2430495..2430628TCONS_00000254-exon-sc0000001-1510915933:2430495..2430628Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1510915933:2424278..2424448TCONS_00000254-exon-sc0000001-1510915933:2424278..2424448Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1510915933:2421802..2422905TCONS_00000254-exon-sc0000001-1510915933:2421802..2422905Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1510915933:2421105..2421218TCONS_00000254-exon-sc0000001-1510915933:2421105..2421218Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1510915933:2419716..2420431TCONS_00000254-exon-sc0000001-1510915933:2419716..2420431Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1491911889:2443481..2443503TCONS_00000254-exon-sc0000001-1491911889:2443481..2443503Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1491911889:2430495..2430628TCONS_00000254-exon-sc0000001-1491911889:2430495..2430628Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1491911889:2424278..2424448TCONS_00000254-exon-sc0000001-1491911889:2424278..2424448Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1491911889:2421802..2422905TCONS_00000254-exon-sc0000001-1491911889:2421802..2422905Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1491911889:2421105..2421218TCONS_00000254-exon-sc0000001-1491911889:2421105..2421218Clytia hemisphaericaexon
TCONS_00000254-exon-sc0000001-1491911889:2419716..2420431TCONS_00000254-exon-sc0000001-1491911889:2419716..2420431Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
WegA-2 putative cnidarian restricted proteinTCONS_00000254-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2419716..2443503 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.37884 1.23418 0.275 0 14.5372 8.77997 18.7379 16.2894 7.18787 5.52373 6.75637 9.6915 15.848 14.5823 11.0225 7.02579 13.9988 13.8979 12.2826 13.969 17.2857 21.0002 3.92627 4.89814 16.9709 21.0193 2.94816 4.35472 0 1.96765
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001660SAM
IPR013761SAM/pointed
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000254 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top