Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000247 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000247
Unique NameTCONS_00000247
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1946

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000247 ID=TCONS_00000247|Name=TCONS_00000247|organism=Clytia hemisphaerica|type=transcript|length=1946bp
AGATATCAATGACATTGGCAAGAAACATATAAAATGGGATAACAAAACAA
TAATTCAAAATGGCGATGATTGCAGGTGATTTCAAGAGCTTCCTAACTAT
CAAAATCAAGCAGCGAGATGACAATTTATTTGATCAATATTCCCGAATCT
TTATGGTGAAAGTCCTGTTGATCACATCAATGGTTTGTGGAATCTCTTGG
TATAGTGACAAATTCAATTGCATCATACCTGAAAAAATGATGGTTTCGGA
AGACTTTCCAGCATTCGTCGGTGCAACATGCTGGATCCAAGGTGTTTATA
TCTACAAAGAACTTTACGGTCGGAATGACGACGTTGCATATTTTGGTATC
ACAAAAGATATTGATACAGATGGAATGTATAATGGTGAATTATGTAAAAC
GGAGAAAAAGTTGAATAAAGATTCGAACGAATACTGTGAACCAATGGAAA
AGACATTCTATCAACAGTACCAATACATGCCGTTCCTTCTTGGTGCATTG
GCTCTCATCTATTACATACCATACATGTTCCACAAAGTGGTCAACCATGA
CATTGTCAAATTGAAGAACCAAGTGGATAAGGAGAATCCAGATGCTTCTG
CTATTTACCGCATCTTTTTCAAACAGCACAGAGGAAAAGTATTAAGTCAA
ACGCCAGTCATGCACCGTCAAATTCTCATCATCCTGGTGAAGCTAACATA
CTTGGTGGTCAACATTGGAACATTCTTGTCTTTCGACAGTTGTTTGAATG
GATTGTTCGTCAGCTTTGGAAGTAATTGGTATAGTTGGGCATCTTTAGAG
AATACAGATCGATTTGATTATATGGGTGGTTCCGAATTCCCTAAACCagc
tAATGAGCTTTTACCACCTTTCGGTTACTGTGAAATCTGGTCATCAGCAA
AAGACATTCGTGATACCCACGCCAACAGACATAAAGTGATTTGCGAAATC
TCACAACACGTTCTTTACCAATatacttttattttgttatggTTATTGAT
CGTCATTGGTATTTTGGTGTCCGCTATTGGTTTGATTGTCAGCTTCTTTA
AAGTGTTCTCAGCTTGTATGGGAATGAGGCAAATTGGATTGACTCCAGAA
TCGAAGAAGATCTTTCGCAATTTGACAGCTCGTCAATGGGATTACTTAGT
TTTCTTGAAACAACAAAACATTGGAGTTTATGGTGAAGTTCGAGATATGT
TTACTGCCGATATCAGCATCGGGGAAGAAGAGCCGAGTGGTTCAAGCACT
CCCCCACAGATGAAAGGATGGGATCAAAGCCCTGCACGAAATAAAAAAGA
TATGGAGCTTTCTCAAAGGCCTGGATATGCTCTGTGAAGAGTTCAAAAAT
TGatgcattttgtatttttaactgGGATAAGATCAACGTAGAATTTATTA
TTAAAATACTTTATCGCTATGAAGATGTGAGATTTGCTGGATATGGCTTC
TTGAGCTCTTCCAAATGAGCCCTATTGTTCACTCCTTTCAAAGAAGAATA
TTAAATGACACGCTTGACATGACATattgttttatacggaagcacccaaa
gtAGCATAGGCATTTatcaaatatttatttatttgcaAACACCCGGTCTA
TTTTGGGTGCTGCCGTATAAAATATCACGCCATCAATGAGacatgaatat
cacgaatttTTCTATGGACAATTGTTTTGACTATGTGTGCAGTCAACAGC
ATCTGTAATTCCTTGGTGCCAGATCCTTGTTGACAACTCtggtaaaaatt
ttattttattcgttCAGTTTATAAATTGAGGCTTACTGTTCTGTTAttgt
attttgtaaaaatatctttttctACGCATCATTatacataaatatttttt
tgagaattttttaactgatatATAAAAATACCTTGCTAGTTTCTTATCAt
ataatcaaataatttttGCTAATAACTTGATGGAattttttttagc
Run BLAST on NCBI

protein sequence of TCONS_00000247-protein

>TCONS_00000247-protein ID=TCONS_00000247-protein|Name=TCONS_00000247-protein|organism=Clytia hemisphaerica|type=polypeptide|length=425bp
MAMIAGDFKSFLTIKIKQRDDNLFDQYSRIFMVKVLLITSMVCGISWYSD
KFNCIIPEKMMVSEDFPAFVGATCWIQGVYIYKELYGRNDDVAYFGITKD
IDTDGMYNGELCKTEKKLNKDSNEYCEPMEKTFYQQYQYMPFLLGALALI
YYIPYMFHKVVNHDIVKLKNQVDKENPDASAIYRIFFKQHRGKVLSQTPV
MHRQILIILVKLTYLVVNIGTFLSFDSCLNGLFVSFGSNWYSWASLENTD
RFDYMGGSEFPKPANELLPPFGYCEIWSSAKDIRDTHANRHKVICEISQH
VLYQYTFILLWLLIVIGILVSAIGLIVSFFKVFSACMGMRQIGLTPESKK
IFRNLTARQWDYLVFLKQQNIGVYGEVRDMFTADISIGEEEPSGSSTPPQ
MKGWDQSPARNKKDMELSQRPGYAL
Run BLAST on NCBI

transcript from alignment at sc0000001:2260599..2274285-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000247 ID=TCONS_00000247|Name=TCONS_00000247|organism=Clytia hemisphaerica|type=transcript|length=13687bp|location=Sequence derived from alignment at sc0000001:2260599..2274285- (Clytia hemisphaerica)
AGATATCAATGACATTGGCAAGAAACATATAAAATGTAAGTTTCAGTTTT CCCAGTAACAATTCCTTTACGTCTTTACCAGCTAATCAAAAAATATTTTG TCTTATGATTTTTTTTCTTTGACAAATGTGAATTGGATTGATTTAGGAGT GTGTTTTTAAGTATTGATTGTTTTCGTCGAAAGTATTTGGTATGATTTGG AAATTTGTTTTAAATCCTGAAAACACCCCCTTCGCACAGACCCGGTAGAA TTTTATCACCTAGCAGGGGTAAAAATTGCAGACCAAAAATCGATGGAGAT TGATATGTTTTTTATGGCTGGGGATTTGAATTCCGCTGTTTTTCTAGCCA GAAAGTTCAGTGAGGATGGAAAAAATAGCCCAATAAATATTTTGCTTATC TGATTATTTTCAGCGGGGACAAAAATTTGAGTATAATTGTCCACTGGGGA CGATATTTTGACCAATTTTTCCAGTGGGAAGGGCTCCCAGTGGTCTGTGA GAAGGGGTGTCAGAAAACCTGTTTTTAAAACTATTGATGAATGACCTCCG GTGGTTTGGGACAAGCTGGAGTTTTTATAAGCTCTTATTTGATTTGGTTG GTCGTTAAGATGTAATAAAAGAATCTTTTTACTTTTTCTAAAGAACGCGT CATCTCTATCACTTTAAGTGACCAATTAGTGAAGTATCTTGTAAAAACTC CAGCTCATCCCAGTGGTTTACATGATAATGTGATCTACGAGTTCAAAATG ATACTTGATTTACGAAATGTTTTTTTTGGTTTTGATGGTGTGATGAGAGA ATATTTTCGACCAATAGTGTGATTAAAATTTCTTTTTAGTGTGATAGCGT GATCGAGGAGGGCTGCACTGGGGGAGGGGTAAGCTCGATAGAAGCAATAG CATATTTCTGAGTGGTTTCAGCATATATAAAGATACTTGGTTATACGGTA TTTATAGGCTACTTCACCCCCTTCTCACAGCCCTATTGGGACCCCTTGTC ACTGGAAAATCTGCCCAAAATATCACCTCCGGTGGAAAATTATCCTCAAT TTTTTGTCCCCATTGAAACTAATCAAATACACCAATCCTTACTGCAAAAT ATTATCCTATTTTCCTCATCCCCACTAAATTTTCTGACTTCAAAACAAAA GAATTGAAACCCCAGCTATAAAAATTATTGGAATATCAATCCTCATCGAG TTTCAGTCCGATGTTTTTATCCCCACTGGCTGAAAAAATCCTACCGGGTC TGTTAGAAAAGGGTGTGTTGCTTTTTCCTGTGTATATGGACATTAATTTG GCTTCTAACTATCTGGAACGAGTTTATCTAAATTATTTTGGATTAAAAGT GGTTTTAAATGATTTACAAATTACTGTGCATTCTCATTATAAAACAGTTC GAATCTAAATGAGAAGTTTCCAGGGGTACCTAAGACGATAAATTCGGGTG GAGTAAGTAGTGGCGGAGGTGTTTACAGTGTTCCAAACTCTACCGCCACT TTTTCCGTAAACCACCCTGACGCCCTTATATGACGCCGATCATTGAGTTT AGAGCATTGAGTTTCAAGCCCGAAGGGCTAGAGGTCAATCTCTANNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGCTTAAGGCCGCGCAACTTT GGTAGGATTTGTTGGCTTCAAATCCTACCAAAGAGATTGACCTCTAGTCC TTCGGGCTTGAAACTCAATGGTTTAGAGCCCGAAGGGCTAGGGTAGAATC TCTAACCTTTCTCAGGCAAGAAAAAGTGAAGCCTTAAAAAATGTGACGTA TTTTTGACGACAGATTGAATCTAGCAGTTCCTTTGGTTACGATTGTTATT TTTTCAAAATTTAGTGGTAAATTTTAGTTTCAATCTGTCATTTGTGTAAA AACCAGGCGAGCTGCTCAAGGCTACGCAACTTTGGTAGGATTTGTTGGCT TCAAATCCTACCAAGGAGATTTGATTCTAGCCCTTCGGGCTTATACTTCA TTGATGCCGACTATACGCCCGACTATGCACTTATATATTTTCCTGCGGTT ACTGACCCTCTAAAACGGACGATAGCATCGTCTAGGGATACCGTAAAACG ACCATAATTTATTAATTATCACGTCTGGTTATGTCTCTTATGTTTTGGGT TTTAGACCCGATACATCTCTAACTCTTAAAATCTTTGAACCAAACTGACG AAATTCTTACATCAGTTATCAAAAAGGATCCATCAATGAAAGTATCACAG GTAGAGAGTCTCTCAGCCATAAAAGGTAAAATATCACAGAGAGTTTATGT TCTCCATTGCAGAGATTATCTCTATCTACTTTCAATGTAGGAACAACTGT GTCAGGGGGCTGGTTTATTGACAAAATATAAAATCTTCAAATGATATTTG AATTAGATTTTCAATGTTTAAAATATTTGACAAACAAAAATAAAGTACAA AAAAATTAAAATCAAAAAATAATAAAGTTCCTTGAAAAACAAAGCTATTA AACAAAACAATCAAAATATAATCACAACTGATTTTGTTTAAAAAGTTTTA CGATAATTTTTATGATAATTTCTAATCAATGAATTAAAAATCCGTTAAAT TATTCTAAACTCTAGACAACGGCGTAATGAGTTGTGATTGTCAATAACAT TGTCAAGGGAATTTCTATGCTTTGTTATGACTCTCAAATGGCTTGTCTTG TTGAAGCTCATGGGATTTGTTAGTGATTGTGATAATGGTAGGTGATTAGG GTTGGATATCGTATTAAAAATTGGATTAAAAAGTTAAAATGTTTTACGTT TGTTGAAAGTGGTGACTTCTGATAGTTGATGTGGTGTGGCGTAAAGTTGT GGTTTCGCTGATGGTTTGACGAAATGAGCGTTTGAAAAATTGCATTTTTA TGAAAATAGCAAATTTTTATGAAATTTTTACCATGAAAAGTTTTGGTTTT CAAAATTATGTTTCTAACCTAATGAAACGGTCTTTCAAACATGAATAGTT TTGGAAGTTTCAGTCTTTTTACATGAGCTTTATTTCACTGTATGTATCCT CGAGTTCAGCCGAAAATCTCCTGAATTCGTAAATCTACTTGTAATGCTTA TATCGAAACAATTACTTTCGTTAAATGTTTTAAAAAATCGAGTTTTTTAA GTTTTAAAGTTAAGTATGGCTTTTAGTAGAGAACGTTTCTGATTTTTTGA AACTTTCATTTGTGTCCAAAGTTGTTTTTAAAAGGCTGATTTCTGTATCC ACAAAGCTATATTTTCGAAGGATTAAATCTCAGAGAGATGGATTAATTTT GAAGCTTTAGGTTTTTTTGGTTTCAGTCACCCATTAAGTGAACTAGATTT CAAAAGTTTTTTTACGTCAATCGATCAACGAATTTAGAAAATTTCAAGTT TTCTGTAGCTTTTGATTATTGTGAGAGATGGTGACGTCATTCATTTGTAA AAGATAAGTTTTCGGTAGGAACGGTACATGATACTTACGCTCTACTGTAC TTGTGACTTTCTTTCCAAAAGTTCGTTTAGCAGTGAAACCACAGATTTAT AAAGTCCGAAGGGCTAGATGTCGTGTTTTAAGCCATAGCAGGGAAAAAAA ATTGAATATCGCAAAAGATATTGTTGCTCTTGTTCTCGAAAGCCCGTGAA GCTTCTAATTGGTCAAGCGCTGAAATTTTATTGTAATGTCATGTAACCAC GACACACTTTTGAGCCAAAGCACAACATCTAGCCCTTCGGGCTTTATAAA TCTATGAGTGAAACACGCCAAAATGACAGAGATTCGGATAGCGTTGCGTT ATACATATTTGAATAGCACTTTGTCCAGTATTCTGATAGTACAGCAGTGC AGAATTAATTGACACGGCCATAAAACATGGCAACTTGAAGAGATAAGCGG GTTTAGTTAGAATACCTCATCCATTACGAACTGTTATTTTGCCAAGAAAG TCTTTCATTTAATTCAGTATTTGAAATCAATCATCATGATAGAACTTTTG AACTAAATGCACCATTGTATTATCCTGAAAGTTAAATACACTTTCATCGA GTTGGCACAAAAAGTGTTTCAATGTTTCTAATGTTGTTATACGCGTTAGA TCAATGCTGAAAGAATATTTTGAACCAGTCCAGACTGATGCATGAATGTT CCGATAAATCTGTTTTCAGGGGATAACAAAACAATAATTCAAAATGGCGA TGATTGCAGGTGATTTCAAGAGCTTCCTAACTATCAAAATCAAGCAGCGA GATGACAATTTATTTGATCAATATTCCCGAATCTTTATGGTGAAAGTCCT GTTGATCACATCAATGGTTTGTGGAATCTCTTGGTATAGTGACAAATTCA ATTGCATCATACCTGGTAAGAGCAAAACTTAATATTTATACGCAGACACC CCTTGCTCACAGCCCTAGTGGAAGGTTTTCTTACAGTGAAATAAGTATTT CTTTCGAAATTCAATAGCTCAAAAATTGTAGGAGTGGTTTTGGAGTGCAT TGAATTTCAATGAAAATAGAGAGCTAATTTATCAGTGAAATGGTAGGGTA TTTTTCTAACCGGACACAAAGTTTTGACCAACTTTTAGACAGGGGTTCAA CCAGGATTTTATTTGATTGTTATGCATGTGGACTTTCGGATAGTTAGTGG TAAGTACGTAAGCTCAAAATTAGGGGAAAACATCCGGGCTATTTTGGGTA CTTCCGTATAGAAATATATTGCGTAATATCACGAGTTATAAACTTTTAAA TTTTCACAGTGAAGTATCTATCCAAATATCATGGGTAATGCTTTAACTTT TAACTACAGTTCTCGCTCTCTAATTCGATCTTTAATTGGAATTGGATTCT CATCGAATAAGGGAGCGACATTTTTGAGACTTTCTTATTGACGATGGCTT TCATTTATCAAATAGTGAAGCCTATCGAATAGTAGAACGTCGAATTAGAG AGCTTCAACTGTATTCTTACTTTCTAGAAAAAATGATGGTTTCGGAAGAC TTTCCAGCATTCGTCGGTGCAACATGCTGGATCCAAGGTGTTTATATCTA CAAAGAACTTTACGGTCGGAATGACGACGTTGCATATTTTGGTATCACAA AAGATATTGATACAGATGGAATGTATAATGGTGAATTATGTAAAACGGAG AAAAAGTTGAATAAAGATTCGAACGAATACTGTGAACCAATGGAAAAGAC ATTCTATCAACAGGTAAGAATATGAGTGACTCACGCAAAAAGAGTTAAAG CTTTTGAAAAGCTTCACTTTGTTCGTATTTTAGTGGAGTGAAAAAGACTT ATTACTTCGTACTTTATATTTGGTTCAGTGGCTTAAATACCGAGCTTTCA AAGTTGAATTTCCTTTTGAAAATGTCCGAAGAAAAACCTGAATTCTGAGG AACTACTTATCTCAAATCTCAGGCTCTTAGATTCCAGTATTTCAGTACGG TACATACATACCCTTCCTTCTTGGTGCAATCATAGTATAAGAAAGCCGCG GCTGGAATATGTACCGCATTGTCTTTTCAGTTAATTGCTGTTCCATCTCT GTCTCCGAGCTTTATAAGAACATCAAGATGCTCAGTTTATCATTGGTAGA TAGTTTTTGAAATTTTTCTCTTATTTTCCTTCACAAAAAGTTTTTTTGTT GCTAGATATCTTTGAATCTGTACCCAATAGAACACTTGAACTAATTTTGG ACATATTTTAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNATTTCGAGGCACCTCATTAATTTT TGAGTTCTTTCAGCCCAGCCATTTTGTGCTTGTTTAAATTTCTTAGTGTT GATTTTTCCTTTACAATGATTTTATAATGCAAGAGCATATCATTAATTTC TAAAACGCACTGAGAAGTAAGTATTAACGACAAACCAATAAAATATACCA TTAAAGATGCTACATTACTGATTTCTTGATCAACAAATAGTCATCAAATA CGACAGAGATAGAACAAGAGAAGTTCAGATGTTATCATTCCAGCCGCGGC TTTCTTATACTATGGTGCAATGTCTCTCATGCTATATACCGTACAAATAA AGAATCAAATGCTGCCTCCAACTTAAAATAAAAAGTTGAGTTTGTTGTCG TTATTGTATGCCCAAAATTACAATTTCATAATAATTCTACAACTTCAGTA CCAATACATGCCGTTCCTTCTTGGTGCAATGGCTCTCATCTATGTATAGC GCCAAATATGAATGACACGCAAATTTTTGATTCTCAATTTTATTACTCTT ATAATATTTTACAACTTAGTACCAATACATGCCGTTCCTTCTTGGTGCAT TGGCTCTCATCTATTACATACCATACATGTTCCACAAAGTGGTCAACCAT GACATTGTCAAATTGAAGAACCAAGTGGATAAGGAGAATCCAGATGCTTC TGCTATTTACCGCATCTTTTTCAAACAGCACAGAGGTACGTCATTTTCAA TTCCCTCGCATGACCAACTACCATAGAAATTTTGACACCCCCTTCTCACA GACCCGGTAAAATTTCTTCGGCCAGTGTTGGTAAAAATAGCGGACTAAAA CTCAATCTGGATTGATATTACCATTTTTCTCATGACTGGGGATTTGAATT CCTTTGTTTTGAGCAAGAAAATGTGGTCAGTGGGGATGTTAAGAATAGCA CAATAATTTGCAGCGAGGATCGGATTATCTATGATTATTTTCTGTGGGGA CAAAAATAAGAGTGAAATTTTCCACCGGGGACGATATCTTGGCCAGTTTT TCCTGTGGGAAGGGTTCCCAGTGGGTCTGTGAGAAAATGGTGTACTCTGT CTTTCCCGGGGAAGCATTCCTGGCATGTTTCCAGGTATACCGGCAGAAAT AAGTTTTTTGCTGCGTACAAATGACTACACGCAACGACCTTGAGATCGAC CACCTAACAATAACTCCAATAACTCCAATAATAACTCCTAACAAAACCCC AATAACTCTTGGGACTTATTTTGAACCTGCACAAAGTGTTGGTCTTTTTC TGTTATAGTGGTCAATAGGAAAATTTTGCCAGGAAAGAGAAGGTTTAGTC ACTCTACAGTACTTAATGTTGTTCCAAAAACCATTTTATCTAACCTCCAT TAGCTAGTCATAGCTTAAAAGAGCTTAATCTAGCGAAAAACTCTTGTCAC TTTTAGTAAGCTGAGGCTAATAGTGCTCTAATGGTACTAAAGTTTTTGTC TGAAAGCCATTTTCAGCATCAAAGTTTTCATTAGTTCAAACTCTTTGATT GATACATGAAATGCAAATGATTTATTTGGTTATTTGGTGTGTTAAATTTA CATTGTGTTACGCCGCCGTAACTTTGCGAGTGAATTCACTGTAATTTAGC TGATAACCAACTCAGCGCCAAGACCTGGTGAGTGGGCGGCCGCTTTCCAC CCTTTTTGTCTAAATGTCATTGCTTCGGGTCTATATTATCATCTTGTCTA AACTCTTCTTCATATATTATTGCAAATTAGAAGTTAAACTTTACTTTTTT AATTTCACTACACAGGAAAAGTATTAAGTCAAACGCCAGTCATGCACCGT CAAATTCTCATCATCCTGGTGAAGCTAACATACTTGGTGGTCAACATTGG AACATTCTTGTCTTTCGACAGTTGTTTGAATGGATTGTTCGTCAGCTTTG GAAGTAATTGGTATAGTTGGGCATCTTTAGAGAATACAGATCGATTTGAT TATATGGGTGGTTCCGAATTCCCTAAACCAGGTAATTCATGATATTCATG ACGTAATGTCTTCCACGAAAAAAACCCGGTTTTTACCAGTAGTGGCAAAT TTAAACTAGACAAAAGTTGCCTCTACTGGCGAAACCGGGGTCTTTCCGTA GAAAACATTAAGTCAAGAATATCATGAAAAGAAGCACATGTTTATGGTAT TTATAATTTCATTAGGCCCCTTTATCATGACTCAAAAGCTATTTTCCCTA TTTCTCGGTGCTGTGTCCGTGGAAAACACCAATCAGTGTAGCAAGAGATT ACTTAATTATTAAGATTTGGTGTTTTAACTTCGATTTTTTTTTAATTTTA TCTAATGGACCTTTTACAACCTTCCTTTTGGCTATTTTCCCTTTTCCTAG GTTTCGCATGGCAGGATATGCAGTCTCATACTAATTTTTGGTAATAGATT TTAAGAAGTCTGGTGTCTAATTCGTGTTTTTTTTGTTTTAGCTAATGAGC TTTTACCACCTTTCGGTTACTGTGAAATCTGGTCATCAGCAAAAGACATT CGTGATACCCACGCCAACAGACATAAAGTGATTTGCGAAATCTCACAACA CGTTCTTTACCAATATACTTTTATTTTGTTATGGTTATTGATCGTCATTG GTATTTTGGTGTCCGCTATTGGTTTGATTGTCAGCTTCTTTAAAGTGTTC TCAGCTTGTATGGGAATGAGGTATGTAGGTTGAATCATTGCATTTAAGGG CTAGACCCCGAAGGGATAGAGTAGAATCTCTAACCTTTCTCAGACAAGAG AAAGTGGAGCCACTTATTTCCCATTCAGTAAGGCACCTAGAACGCGCCGC AGCGGATTTTTTTCCGTCAACGAACGAAGACCTACGCTAGCGGCCGAATA CCTTTAAAACTTTAATGCGTGGTTTTCCAGCGGTCGAAGACCTACAAATT TAATGTGCGATCAGTTTTCAGCGCCAGAAGACCTACACAAACGGCCGAAG ACCTGCAAAACTTAGAAATTTGAGAATCTAAATCTGAGCCAGCGGACGAA TACCTTTCTTTGCTGCATGAAAGTTTTTCGCACCAAACTGCCATTCAAGC AATAAATTTTTAATATTTCGTGAAATAAATTCTTTTCGTGATAAGTCACA TGACAACATAATGGTACTCGGTAGCACATTTCCTACGAAATTCACCTAGA AACTCAGCATATGCTTGCTTGTGATGGAGTCATACCAGATTTGAATAGCT TTTTGATATAATTTTGCGTTTCCTCTGAAATCAATTTAAAGCTTAAAGCA TGAAGAGAATTCACGGGGTGATTGTGTTTATGCTCTATATCTATGGTACN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAGCGTAGGTCTTCGGCCGCT GGAAAACCGCACATTAAAGTTTTAAAGGTATTCGGCCGCTAGCGTAGGTC TTCGTTCGTTGACGGAAAAAAAATCCGCCGCGCCGCAGTCATGACAACGG ATTGTATCTAGCGGTTCCATTGTTTTTGAGGACTGCATTTTTTTAAATCT AGCAATAGATTTTAGTTTCAATCCAGTGTTTGTGTAAAAACCACACACGG GCGTTCTGGATGGGAAATAAGTGGTTTCATTTCCCAGCAAGGACTCTCGA GTCTAGCCCTTCGGGCTTGGAAGTCAATGGGTGGAATGCACCAAATTAAA TATTTTTACGCGTTGGTTAGTTAAGCTGTCTATGACCTAGACTAGAGACT ACTCCTGGCTTAGACGATGTTATTGTCCATTACAGTGATAATAAAGGCGG GGAGATATACGCACGGAGTTTAAAATCGGTGGTAAAGTTTTGAAGAAACG ACTGGTAAACTTCATCGGCTGTAAACTCTTTTTGACAAAAAAAACCCGTT TGCGAATTTTCTTCGGCTTTGGGCTTATTTTCTTAGATAATGATTTGTCT TAGACTATAGCATAGTCTTCTCCACGCTGAACACGCCCCTTATTTTCATA TGATATTCTTATAAAATCTGACCCTTTCAAAAACATTTCTTAATCCTATT CTTACCATCCAAAAGCAACCTAGATTCCAAAGCAAAAGCTCCAAATTAAG AACTACCATTTTCTACCGGACCATTTAATCACCATTCAGTCTATCAAAAT CCCTTAAGAGAACCCTGGAATATCTAAGGCTTTGAGACAGCCTTCTAAAA TCTGTGTCAAGAAGGACTCTTCTTCACTTTCTTGAACAAATTTTGGAAAA GAAATTGATGCGAAATATAAGCCCGTTCAAATATCTTTCCAACGGTACCA AACTTTTCATTTATACGACAATTATTTGGAAATTTATGGCCAAAAATGTT CTTGCTCTGATAAAGAAATGCATTTCTTATTCAAGCCCTCGTATTTGTAG AAGATCTTTTGGTTAAAATCTGTTGTTGTATTGAGCACTAGGTCAGGCAT GAATTTCATCAAAAACTTTTCTAATTTACAGGCAAATTGGATTGACTCCA GAATCGAAGAAGATCNTGTTGTTGTATTGAGCACTAGGTCAGGCATGAAT TTCATCAAAATCTTCTCTAATTTACAGGCAAATTGGATTGACTCCAGAAT CGAAGAAGATCTTTCGCAATTTGACAGCTCGTCAATGGGATTACTTAGTT TTCTTGAAACAACAAAACATTGGAGTTTATGGTGAAGTTCGAGATATGTT TACTGCCGATATCAGTAAGTGTAGCTGCCTCTTTTTGATTCGATCTTCAA GGTACAAAATCTTTTGTTCAAATTATAGAGATATAAATTTATGCCACTTT CTAGCTGAGGAGGGTGATTTAGAGAGAGTCGACTATATGGACCAATTCTG CATTTCACCATTGATAAGCCGTTTTTATGAGGAATAGCATATGATAGATA TTTAAAGGGTGATTTATAGTCGCACACCTTGCTTTGCTTAAGGTTTTAAG TATTCCCCGTTTAGACCTGCGCATAGTCTACTATTTTTATTTTGTGGGTG AAATTTATGTCCGTTAGGCAGCTTGCTTGAGTTCTGGTTGAAGGCTTTTC CCTACTGGATTTTGCATCGATCCGTCTATTCATCCATCCATATTCGTGTC TTTCTAATTACAATCAAGATCAATGATACACCCCTGTCTCAGCAGCTCGT AGAATTGCACCAGGGATAGAAATATTTCTTTGGAAATCCGGTGGGGATTT TCCAAGGAACGACAGAAGCAATGAAGGGCTAGAATTGAATCTTTAACCTT TCTCAGGCAAGAAAAAGTGAAGCCTTAAAATATGCGCCGTATTTTTGACG ATGGATTGAATCTAACGATGCCTTTGTTTTCGATTGATATCTTTTTTGAA GTTTAGGTGTAAATTTTTAGTTTAAATCTGTCATTTATGTAAAAACCAGG CGGACCGCGCTAGACCACGCAACTTTGGTAGGATTTGGTAAGCTTCAAAT CCTACCAAGGAGATTCAATTCTAGCCCTTCGGGCTTATACTTTATTTAAC AGGGGGCTCTATCGGGGTTGTGATATGGGGGTTTCATAATAATTGAAGCG ACTTAACAGACCATTTTCGAGTTTGATAGATTCTAATAAATGTCATAAAT TTTCAGGCATCGGGGAAGAAGAGCCGAGTGGTTCAAGCACTCCCCCACAG ATGAAAGGATGGGATCAAAGCCCTGCACGAAATAAAAAAGATATGGAGCT TTCTCAAAGGCCTGGATATGCTCTGTGAAGAGTTCAAAAATTGATGCATT TTGTATTTTTAACTGGGATAAGATCAACGTAGAATTTATTATTAAAATAC TTTATCGCTATGAAGATGTGAGATTTGCTGGATATGGCTTCTTGAGCTCT TCCAAATGAGCCCTATTGTTCACTCCTTTCAAAGAAGAATATTAAATGAC ACGCTTGACATGACATATTGTTTTATACGGAAGCACCCAAAGTAGCATAG GCATTTATCAAATATTTATTTATTTGCAAACACCCGGTCTATTTTGGGTG CTGCCGTATAAAATATCACGCCATCAATGAGACATGAATATCACGAATTT TTCTATGGACAATTGTTTTGACTATGTGTGCAGTCAACAGCATCTGTAAT TCCTTGGTGCCAGATCCTTGTTGACAACTCTGGTAAAAATTTTATTTTAT TCGTTCAGTTTATAAATTGAGGCTTACTGTTCTGTTATTGTATTTTGTAA AAATATCTTTTTCTACGCATCATTATACATAAATATTTTTTTGAGAATTT TTTAACTGATATATAAAAATACCTTGCTAGTTTCTTATCATATAATCAAA TAATTTTTGCTAATAACTTGATGGAATTTTTTTTAGC

Coding sequence (CDS) from alignment at sc0000001:2260599..2274285-

>TCONS_00000247 ID=TCONS_00000247|Name=TCONS_00000247|organism=Clytia hemisphaerica|type=CDS|length=8946bp|location=Sequence derived from alignment at sc0000001:2260599..2274285- (Clytia hemisphaerica)
GCATCGGGGAAGAAGAGCCGAGTGGTTCAAGCACTCCCCCACAGATGAAA
GGATGGGATCAAAGCCCTGCACGAAATAAAAAAGATATGGAGCTTTCTCA
AAGGCCTGGATATGCTCTGTGAGCAAATTGGATTGACTCCAGAATCGAAG
AAGATCTTTCGCAATTTGACAGCTCGTCAATGGGATTACTTAGTTTTCTT
GAAACAACAAAACATTGGAGTTTATGGTGAAGTTCGAGATATGTTTACTG
CCGATATCACTAATGAGCTTTTACCACCTTTCGGTTACTGTGAAATCTGG
TCATCAGCAAAAGACATTCGTGATACCCACGCCAACAGACATAAAGTGAT
TTGCGAAATCTCACAACACGTTCTTTACCAATATACTTTTATTTTGTTAT
GGTTATTGATCGTCATTGGTATTTTGGTGTCCGCTATTGGTTTGATTGTC
AGCTTCTTTAAAGTGTTCTCAGCTTGTATGGGAATGAGGAAAAGTATTAA
GTCAAACGCCAGTCATGCACCGTCAAATTCTCATCATCCTGGTGAAGCTA
ACATACTTGGTGGTCAACATTGGAACATTCTTGTCTTTCGACAGTTGTTT
GAATGGATTGTTCGTCAGCTTTGGAAGTAATTGGTATAGTTGGGCATCTT
TAGAGAATACAGATCGATTTGATTATATGGGTGGTTCCGAATTCCCTAAA
CCAGTACCAATACATGCCGTTCCTTCTTGGTGCATTGGCTCTCATCTATT
ACATACCATACATGTTCCACAAAGTGGTCAACCATGACATTGTCAAATTG
AAGAACCAAGTGGATAAGGAGAATCCAGATGCTTCTGCTATTTACCGCAT
CTTTTTCAAACAGCACAGAGAAAAAATGATGGTTTCGGAAGACTTTCCAG
CATTCGTCGGTGCAACATGCTGGATCCAAGGTGTTTATATCTACAAAGAA
CTTTACGGTCGGAATGACGACGTTGCATATTTTGGTATCACAAAAGATAT
TGATACAGATGGAATGTATAATGGTGAATTATGTAAAACGGAGAAAAAGT
TGAATAAAGATTCGAACGAATACTGTGAACCAATGGAAAAGACATTCTAT
CAACAGATGGCGATGATTGCAGGTGATTTCAAGAGCTTCCTAACTATCAA
AATCAAGCAGCGAGATGACAATTTATTTGATCAATATTCCCGAATCTTTA
TGGTGAAAGTCCTGTTGATCACATCAATGGTTTGTGGAATCTCTTGGTAT
AGTGACAAATTCAATTGCATCATACCTGGCATCGGGGAAGAAGAGCCGAG
TGGTTCAAGCACTCCCCCACAGATGAAAGGATGGGATCAAAGCCCTGCAC
GAAATAAAAAAGATATGGAGCTTTCTCAAAGGCCTGGATATGCTCTGTGA
GCAAATTGGATTGACTCCAGAATCGAAGAAGATCTTTCGCAATTTGACAG
CTCGTCAATGGGATTACTTAGTTTTCTTGAAACAACAAAACATTGGAGTT
TATGGTGAAGTTCGAGATATGTTTACTGCCGATATCACTAATGAGCTTTT
ACCACCTTTCGGTTACTGTGAAATCTGGTCATCAGCAAAAGACATTCGTG
ATACCCACGCCAACAGACATAAAGTGATTTGCGAAATCTCACAACACGTT
CTTTACCAATATACTTTTATTTTGTTATGGTTATTGATCGTCATTGGTAT
TTTGGTGTCCGCTATTGGTTTGATTGTCAGCTTCTTTAAAGTGTTCTCAG
CTTGTATGGGAATGAGGAAAAGTATTAAGTCAAACGCCAGTCATGCACCG
TCAAATTCTCATCATCCTGGTGAAGCTAACATACTTGGTGGTCAACATTG
GAACATTCTTGTCTTTCGACAGTTGTTTGAATGGATTGTTCGTCAGCTTT
GGAAGTAATTGGTATAGTTGGGCATCTTTAGAGAATACAGATCGATTTGA
TTATATGGGTGGTTCCGAATTCCCTAAACCAGTACCAATACATGCCGTTC
CTTCTTGGTGCATTGGCTCTCATCTATTACATACCATACATGTTCCACAA
AGTGGTCAACCATGACATTGTCAAATTGAAGAACCAAGTGGATAAGGAGA
ATCCAGATGCTTCTGCTATTTACCGCATCTTTTTCAAACAGCACAGAGAA
AAAATGATGGTTTCGGAAGACTTTCCAGCATTCGTCGGTGCAACATGCTG
GATCCAAGGTGTTTATATCTACAAAGAACTTTACGGTCGGAATGACGACG
TTGCATATTTTGGTATCACAAAAGATATTGATACAGATGGAATGTATAAT
GGTGAATTATGTAAAACGGAGAAAAAGTTGAATAAAGATTCGAACGAATA
CTGTGAACCAATGGAAAAGACATTCTATCAACAGATGGCGATGATTGCAG
GTGATTTCAAGAGCTTCCTAACTATCAAAATCAAGCAGCGAGATGACAAT
TTATTTGATCAATATTCCCGAATCTTTATGGTGAAAGTCCTGTTGATCAC
ATCAATGGTTTGTGGAATCTCTTGGTATAGTGACAAATTCAATTGCATCA
TACCTGGCATCGGGGAAGAAGAGCCGAGTGGTTCAAGCACTCCCCCACAG
ATGAAAGGATGGGATCAAAGCCCTGCACGAAATAAAAAAGATATGGAGCT
TTCTCAAAGGCCTGGATATGCTCTGTGAGCAAATTGGATTGACTCCAGAA
TCGAAGAAGATCTTTCGCAATTTGACAGCTCGTCAATGGGATTACTTAGT
TTTCTTGAAACAACAAAACATTGGAGTTTATGGTGAAGTTCGAGATATGT
TTACTGCCGATATCACTAATGAGCTTTTACCACCTTTCGGTTACTGTGAA
ATCTGGTCATCAGCAAAAGACATTCGTGATACCCACGCCAACAGACATAA
AGTGATTTGCGAAATCTCACAACACGTTCTTTACCAATATACTTTTATTT
TGTTATGGTTATTGATCGTCATTGGTATTTTGGTGTCCGCTATTGGTTTG
ATTGTCAGCTTCTTTAAAGTGTTCTCAGCTTGTATGGGAATGAGGAAAAG
TATTAAGTCAAACGCCAGTCATGCACCGTCAAATTCTCATCATCCTGGTG
AAGCTAACATACTTGGTGGTCAACATTGGAACATTCTTGTCTTTCGACAG
TTGTTTGAATGGATTGTTCGTCAGCTTTGGAAGTAATTGGTATAGTTGGG
CATCTTTAGAGAATACAGATCGATTTGATTATATGGGTGGTTCCGAATTC
CCTAAACCAGTACCAATACATGCCGTTCCTTCTTGGTGCATTGGCTCTCA
TCTATTACATACCATACATGTTCCACAAAGTGGTCAACCATGACATTGTC
AAATTGAAGAACCAAGTGGATAAGGAGAATCCAGATGCTTCTGCTATTTA
CCGCATCTTTTTCAAACAGCACAGAGAAAAAATGATGGTTTCGGAAGACT
TTCCAGCATTCGTCGGTGCAACATGCTGGATCCAAGGTGTTTATATCTAC
AAAGAACTTTACGGTCGGAATGACGACGTTGCATATTTTGGTATCACAAA
AGATATTGATACAGATGGAATGTATAATGGTGAATTATGTAAAACGGAGA
AAAAGTTGAATAAAGATTCGAACGAATACTGTGAACCAATGGAAAAGACA
TTCTATCAACAGATGGCGATGATTGCAGGTGATTTCAAGAGCTTCCTAAC
TATCAAAATCAAGCAGCGAGATGACAATTTATTTGATCAATATTCCCGAA
TCTTTATGGTGAAAGTCCTGTTGATCACATCAATGGTTTGTGGAATCTCT
TGGTATAGTGACAAATTCAATTGCATCATACCTGGCATCGGGGAAGAAGA
GCCGAGTGGTTCAAGCACTCCCCCACAGATGAAAGGATGGGATCAAAGCC
CTGCACGAAATAAAAAAGATATGGAGCTTTCTCAAAGGCCTGGATATGCT
CTGTGAGCAAATTGGATTGACTCCAGAATCGAAGAAGATCTTTCGCAATT
TGACAGCTCGTCAATGGGATTACTTAGTTTTCTTGAAACAACAAAACATT
GGAGTTTATGGTGAAGTTCGAGATATGTTTACTGCCGATATCACTAATGA
GCTTTTACCACCTTTCGGTTACTGTGAAATCTGGTCATCAGCAAAAGACA
TTCGTGATACCCACGCCAACAGACATAAAGTGATTTGCGAAATCTCACAA
CACGTTCTTTACCAATATACTTTTATTTTGTTATGGTTATTGATCGTCAT
TGGTATTTTGGTGTCCGCTATTGGTTTGATTGTCAGCTTCTTTAAAGTGT
TCTCAGCTTGTATGGGAATGAGGAAAAGTATTAAGTCAAACGCCAGTCAT
GCACCGTCAAATTCTCATCATCCTGGTGAAGCTAACATACTTGGTGGTCA
ACATTGGAACATTCTTGTCTTTCGACAGTTGTTTGAATGGATTGTTCGTC
AGCTTTGGAAGTAATTGGTATAGTTGGGCATCTTTAGAGAATACAGATCG
ATTTGATTATATGGGTGGTTCCGAATTCCCTAAACCAGTACCAATACATG
CCGTTCCTTCTTGGTGCATTGGCTCTCATCTATTACATACCATACATGTT
CCACAAAGTGGTCAACCATGACATTGTCAAATTGAAGAACCAAGTGGATA
AGGAGAATCCAGATGCTTCTGCTATTTACCGCATCTTTTTCAAACAGCAC
AGAGAAAAAATGATGGTTTCGGAAGACTTTCCAGCATTCGTCGGTGCAAC
ATGCTGGATCCAAGGTGTTTATATCTACAAAGAACTTTACGGTCGGAATG
ACGACGTTGCATATTTTGGTATCACAAAAGATATTGATACAGATGGAATG
TATAATGGTGAATTATGTAAAACGGAGAAAAAGTTGAATAAAGATTCGAA
CGAATACTGTGAACCAATGGAAAAGACATTCTATCAACAGATGGCGATGA
TTGCAGGTGATTTCAAGAGCTTCCTAACTATCAAAATCAAGCAGCGAGAT
GACAATTTATTTGATCAATATTCCCGAATCTTTATGGTGAAAGTCCTGTT
GATCACATCAATGGTTTGTGGAATCTCTTGGTATAGTGACAAATTCAATT
GCATCATACCTGGCATCGGGGAAGAAGAGCCGAGTGGTTCAAGCACTCCC
CCACAGATGAAAGGATGGGATCAAAGCCCTGCACGAAATAAAAAAGATAT
GGAGCTTTCTCAAAGGCCTGGATATGCTCTGTGAGCAAATTGGATTGACT
CCAGAATCGAAGAAGATCTTTCGCAATTTGACAGCTCGTCAATGGGATTA
CTTAGTTTTCTTGAAACAACAAAACATTGGAGTTTATGGTGAAGTTCGAG
ATATGTTTACTGCCGATATCACTAATGAGCTTTTACCACCTTTCGGTTAC
TGTGAAATCTGGTCATCAGCAAAAGACATTCGTGATACCCACGCCAACAG
ACATAAAGTGATTTGCGAAATCTCACAACACGTTCTTTACCAATATACTT
TTATTTTGTTATGGTTATTGATCGTCATTGGTATTTTGGTGTCCGCTATT
GGTTTGATTGTCAGCTTCTTTAAAGTGTTCTCAGCTTGTATGGGAATGAG
GAAAAGTATTAAGTCAAACGCCAGTCATGCACCGTCAAATTCTCATCATC
CTGGTGAAGCTAACATACTTGGTGGTCAACATTGGAACATTCTTGTCTTT
CGACAGTTGTTTGAATGGATTGTTCGTCAGCTTTGGAAGTAATTGGTATA
GTTGGGCATCTTTAGAGAATACAGATCGATTTGATTATATGGGTGGTTCC
GAATTCCCTAAACCAGTACCAATACATGCCGTTCCTTCTTGGTGCATTGG
CTCTCATCTATTACATACCATACATGTTCCACAAAGTGGTCAACCATGAC
ATTGTCAAATTGAAGAACCAAGTGGATAAGGAGAATCCAGATGCTTCTGC
TATTTACCGCATCTTTTTCAAACAGCACAGAGAAAAAATGATGGTTTCGG
AAGACTTTCCAGCATTCGTCGGTGCAACATGCTGGATCCAAGGTGTTTAT
ATCTACAAAGAACTTTACGGTCGGAATGACGACGTTGCATATTTTGGTAT
CACAAAAGATATTGATACAGATGGAATGTATAATGGTGAATTATGTAAAA
CGGAGAAAAAGTTGAATAAAGATTCGAACGAATACTGTGAACCAATGGAA
AAGACATTCTATCAACAGATGGCGATGATTGCAGGTGATTTCAAGAGCTT
CCTAACTATCAAAATCAAGCAGCGAGATGACAATTTATTTGATCAATATT
CCCGAATCTTTATGGTGAAAGTCCTGTTGATCACATCAATGGTTTGTGGA
ATCTCTTGGTATAGTGACAAATTCAATTGCATCATACCTGGCATCGGGGA
AGAAGAGCCGAGTGGTTCAAGCACTCCCCCACAGATGAAAGGATGGGATC
AAAGCCCTGCACGAAATAAAAAAGATATGGAGCTTTCTCAAAGGCCTGGA
TATGCTCTGTGAGCAAATTGGATTGACTCCAGAATCGAAGAAGATCTTTC
GCAATTTGACAGCTCGTCAATGGGATTACTTAGTTTTCTTGAAACAACAA
AACATTGGAGTTTATGGTGAAGTTCGAGATATGTTTACTGCCGATATCAC
TAATGAGCTTTTACCACCTTTCGGTTACTGTGAAATCTGGTCATCAGCAA
AAGACATTCGTGATACCCACGCCAACAGACATAAAGTGATTTGCGAAATC
TCACAACACGTTCTTTACCAATATACTTTTATTTTGTTATGGTTATTGAT
CGTCATTGGTATTTTGGTGTCCGCTATTGGTTTGATTGTCAGCTTCTTTA
AAGTGTTCTCAGCTTGTATGGGAATGAGGAAAAGTATTAAGTCAAACGCC
AGTCATGCACCGTCAAATTCTCATCATCCTGGTGAAGCTAACATACTTGG
TGGTCAACATTGGAACATTCTTGTCTTTCGACAGTTGTTTGAATGGATTG
TTCGTCAGCTTTGGAAGTAATTGGTATAGTTGGGCATCTTTAGAGAATAC
AGATCGATTTGATTATATGGGTGGTTCCGAATTCCCTAAACCAGTACCAA
TACATGCCGTTCCTTCTTGGTGCATTGGCTCTCATCTATTACATACCATA
CATGTTCCACAAAGTGGTCAACCATGACATTGTCAAATTGAAGAACCAAG
TGGATAAGGAGAATCCAGATGCTTCTGCTATTTACCGCATCTTTTTCAAA
CAGCACAGAGAAAAAATGATGGTTTCGGAAGACTTTCCAGCATTCGTCGG
TGCAACATGCTGGATCCAAGGTGTTTATATCTACAAAGAACTTTACGGTC
GGAATGACGACGTTGCATATTTTGGTATCACAAAAGATATTGATACAGAT
GGAATGTATAATGGTGAATTATGTAAAACGGAGAAAAAGTTGAATAAAGA
TTCGAACGAATACTGTGAACCAATGGAAAAGACATTCTATCAACAGATGG
CGATGATTGCAGGTGATTTCAAGAGCTTCCTAACTATCAAAATCAAGCAG
CGAGATGACAATTTATTTGATCAATATTCCCGAATCTTTATGGTGAAAGT
CCTGTTGATCACATCAATGGTTTGTGGAATCTCTTGGTATAGTGACAAAT
TCAATTGCATCATACCTGGCATCGGGGAAGAAGAGCCGAGTGGTTCAAGC
ACTCCCCCACAGATGAAAGGATGGGATCAAAGCCCTGCACGAAATAAAAA
AGATATGGAGCTTTCTCAAAGGCCTGGATATGCTCTGTGAGCAAATTGGA
TTGACTCCAGAATCGAAGAAGATCTTTCGCAATTTGACAGCTCGTCAATG
GGATTACTTAGTTTTCTTGAAACAACAAAACATTGGAGTTTATGGTGAAG
TTCGAGATATGTTTACTGCCGATATCACTAATGAGCTTTTACCACCTTTC
GGTTACTGTGAAATCTGGTCATCAGCAAAAGACATTCGTGATACCCACGC
CAACAGACATAAAGTGATTTGCGAAATCTCACAACACGTTCTTTACCAAT
ATACTTTTATTTTGTTATGGTTATTGATCGTCATTGGTATTTTGGTGTCC
GCTATTGGTTTGATTGTCAGCTTCTTTAAAGTGTTCTCAGCTTGTATGGG
AATGAGGAAAAGTATTAAGTCAAACGCCAGTCATGCACCGTCAAATTCTC
ATCATCCTGGTGAAGCTAACATACTTGGTGGTCAACATTGGAACATTCTT
GTCTTTCGACAGTTGTTTGAATGGATTGTTCGTCAGCTTTGGAAGTAATT
GGTATAGTTGGGCATCTTTAGAGAATACAGATCGATTTGATTATATGGGT
GGTTCCGAATTCCCTAAACCAGTACCAATACATGCCGTTCCTTCTTGGTG
CATTGGCTCTCATCTATTACATACCATACATGTTCCACAAAGTGGTCAAC
CATGACATTGTCAAATTGAAGAACCAAGTGGATAAGGAGAATCCAGATGC
TTCTGCTATTTACCGCATCTTTTTCAAACAGCACAGAGAAAAAATGATGG
TTTCGGAAGACTTTCCAGCATTCGTCGGTGCAACATGCTGGATCCAAGGT
GTTTATATCTACAAAGAACTTTACGGTCGGAATGACGACGTTGCATATTT
TGGTATCACAAAAGATATTGATACAGATGGAATGTATAATGGTGAATTAT
GTAAAACGGAGAAAAAGTTGAATAAAGATTCGAACGAATACTGTGAACCA
ATGGAAAAGACATTCTATCAACAGATGGCGATGATTGCAGGTGATTTCAA
GAGCTTCCTAACTATCAAAATCAAGCAGCGAGATGACAATTTATTTGATC
AATATTCCCGAATCTTTATGGTGAAAGTCCTGTTGATCACATCAATGGTT
TGTGGAATCTCTTGGTATAGTGACAAATTCAATTGCATCATACCTG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000135XLOC_000135Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000247-proteinTCONS_00000247-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000247-exon-sc0000001-1575043694:2274251..2274285TCONS_00000247-exon-sc0000001-1575043694:2274251..2274285Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1575043694:2269321..2269516TCONS_00000247-exon-sc0000001-1575043694:2269321..2269516Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1575043694:2268473..2268708TCONS_00000247-exon-sc0000001-1575043694:2268473..2268708Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1575043694:2266951..2267116TCONS_00000247-exon-sc0000001-1575043694:2266951..2267116Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1575043694:2265655..2265870TCONS_00000247-exon-sc0000001-1575043694:2265655..2265870Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1575043694:2264966..2265194TCONS_00000247-exon-sc0000001-1575043694:2264966..2265194Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1575043694:2262222..2262358TCONS_00000247-exon-sc0000001-1575043694:2262222..2262358Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1575043694:2260599..2261329TCONS_00000247-exon-sc0000001-1575043694:2260599..2261329Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1510915933:2274251..2274285TCONS_00000247-exon-sc0000001-1510915933:2274251..2274285Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1510915933:2269321..2269516TCONS_00000247-exon-sc0000001-1510915933:2269321..2269516Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1510915933:2268473..2268708TCONS_00000247-exon-sc0000001-1510915933:2268473..2268708Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1510915933:2266951..2267116TCONS_00000247-exon-sc0000001-1510915933:2266951..2267116Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1510915933:2265655..2265870TCONS_00000247-exon-sc0000001-1510915933:2265655..2265870Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1510915933:2264966..2265194TCONS_00000247-exon-sc0000001-1510915933:2264966..2265194Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1510915933:2262222..2262358TCONS_00000247-exon-sc0000001-1510915933:2262222..2262358Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1510915933:2260599..2261329TCONS_00000247-exon-sc0000001-1510915933:2260599..2261329Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1491911889:2274251..2274285TCONS_00000247-exon-sc0000001-1491911889:2274251..2274285Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1491911889:2269321..2269516TCONS_00000247-exon-sc0000001-1491911889:2269321..2269516Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1491911889:2268473..2268708TCONS_00000247-exon-sc0000001-1491911889:2268473..2268708Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1491911889:2266951..2267116TCONS_00000247-exon-sc0000001-1491911889:2266951..2267116Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1491911889:2265655..2265870TCONS_00000247-exon-sc0000001-1491911889:2265655..2265870Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1491911889:2264966..2265194TCONS_00000247-exon-sc0000001-1491911889:2264966..2265194Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1491911889:2262222..2262358TCONS_00000247-exon-sc0000001-1491911889:2262222..2262358Clytia hemisphaericaexon
TCONS_00000247-exon-sc0000001-1491911889:2260599..2261329TCONS_00000247-exon-sc0000001-1491911889:2260599..2261329Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2260599..2274285 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
82.1843 79.584 79.1785 82.1888 0 0.0437072 0.924572 1.33288 3.56874 7.93485 5.98279 1.76833 18.7722 19.0086 20.0057 21.6441 3.07393 4.22882 21.8434 28.9711 3.17243 2.66926 41.9478 38.7352 19.3402 25.9385 64.844 59.2999 46.3807 38.357
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: Cellular Component
TermDefinition
GO:0005921gap junction
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0005921 gap junction
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000247 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top