Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000245 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000245
Unique NameTCONS_00000245
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1656

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000245 ID=TCONS_00000245|Name=TCONS_00000245|organism=Clytia hemisphaerica|type=transcript|length=1656bp
ttcatttagtCCCACATAATACAAATTTTGAGTCAgcaatttgattcttt
tttccaCTACTGATTTTTATACTTATTTTCCTCTTTTAGAAACTAACAAC
AAAACTGAACAAAATTaactaaaaataacaaaaaataacgaTTTAAACTA
ACACACACTCGATAACAACCGAACTTTGATGGTCATCATATACCATGATG
ATTTGAAAAATGACTAATCCAAGACCATCAATAACATTATAACGAGTCTT
AAAAAACTGGTTAAAGAAGATTAGTCTAGTCTTTGCAATGAGTGGcaaga
aatatcaaaactttGGGGATGATGCGAATATTGAAGAGCAAGAGGAACAA
CATTCACATGAACAACCTTCTATTTCTGATGGACCAACACTGAATAGTAT
ACCGCATGCGAAAGTCGTACCCGGCTTGTTATGCGGTATTTTCAAAAAGC
CAAGATGGTGCCAGGATGGATTTAAGGTTTTAATAGTGATTGCAGTTGTA
TTTTCCACCATTATTGGTCTTACATTAATCATTGATATCAGTCTACGGAA
AACCCATAAACCTTTGCAAGTTGTGACCGATCACCCAGAATGCACTTCTT
TGGTGAGGGAGCTCATGGACACGACCGATTCGAATGCAGTTGATGGTGCG
GTTGCTGGAATGTTTTGTTTGGCAATCACACGACCTGATCTAACAAGCTT
AGCAAGCGGTGGGTTTATGATTTATCATTCGGAAGATAAATCGAGTGGCC
TCGATTTTCAAATGGAAGCCCCAGGAGATAAAACGATTATTTCGCCAGTA
GCGCTACCTGGTCTTGTTGAAGGCCTTCTTAAAACTCACCAACTGCACGG
AAGTACGAAGCTTGCACGTCTACTCGAAAGTTGTATAACATTGGCGAAAA
ACGGGTTTAAAGTTTACAAGAAAACAGTGGAAGGTGAATTTGGCTTCTTT
GAAAAGAACATGCAAATAATGTTATCTAAACACGGAAACGGGATAGTTCC
TTTACAGgaaGGTGATATTTTGAGACTTCCAGAAGTATCGAAACTACTTT
ACCAAATTTCGCGAGGGAATTTAAAACCCTACCAAGACGATATTATAGAA
AAAGTGAAAGACTTGGGTTGGACTTCTGAAATGTTCAAGTCGTATCAATC
TAAAGAGCTTGCTTTACTGAAGACTTCATTAAAAAATGGTGTTACTCTAC
TTACGTTACCCCCACCTTCAAGTGGGATTGTCAGTCTCTTGGCAACCAAG
TACCTTGACTACCTTTTACCCGAGACTAGCACACCACTGGATAAGTATTT
CACCATAGCTGAGACATTGAAATCAACATTTGAAAACCAAAGCCGATTAT
TAGACGAACCTTCCAACCTCCACGAGAAGATTGCAGAACTGTTACAAAAA
GATGACATAGATGGAGTAGTGAAGAGCATCAAATCCACTGTTGACAATAA
AATACCACGTCAAACTGCAACAGGGAAAACGCCGGCCCATCCCAAATTGG
ATGTGAAAAGCGCAAATGTGTTGGTGATTGATCATAATAATCAAGTGGCT
GCCATTTCTAGTTCACTTGGTCATTCATTTGGTAATAAACAAATGACAAA
ATCAGGGGTGGTTTTGAACAATGGAATGAAGTTATTTCCTTCATCTTGGA
AGGTTT
Run BLAST on NCBI

protein sequence of TCONS_00000245-protein

>TCONS_00000245-protein ID=TCONS_00000245-protein|Name=TCONS_00000245-protein|organism=Clytia hemisphaerica|type=polypeptide|length=456bp
MSGKKYQNFGDDANIEEQEEQHSHEQPSISDGPTLNSIPHAKVVPGLLCG
IFKKPRWCQDGFKVLIVIAVVFSTIIGLTLIIDISLRKTHKPLQVVTDHP
ECTSLVRELMDTTDSNAVDGAVAGMFCLAITRPDLTSLASGGFMIYHSED
KSSGLDFQMEAPGDKTIISPVALPGLVEGLLKTHQLHGSTKLARLLESCI
TLAKNGFKVYKKTVEGEFGFFEKNMQIMLSKHGNGIVPLQEGDILRLPEV
SKLLYQISRGNLKPYQDDIIEKVKDLGWTSEMFKSYQSKELALLKTSLKN
GVTLLTLPPPSSGIVSLLATKYLDYLLPETSTPLDKYFTIAETLKSTFEN
QSRLLDEPSNLHEKIAELLQKDDIDGVVKSIKSTVDNKIPRQTATGKTPA
HPKLDVKSANVLVIDHNNQVAAISSSLGHSFGNKQMTKSGVVLNNGMKLF
PSSWKV
Run BLAST on NCBI

transcript from alignment at sc0000001:2167115..2179540-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000245 ID=TCONS_00000245|Name=TCONS_00000245|organism=Clytia hemisphaerica|type=transcript|length=12426bp|location=Sequence derived from alignment at sc0000001:2167115..2179540- (Clytia hemisphaerica)
TTCATTTAGTCCCACATAATACAAATTTTGAGTCAGCAATTTGATTCTTT TTTCCACTACTGATTTTTATACTTATTTTCCTCTTTTAGAAACTAACAAC AAAACTGAACAAAATTAACTAAAAATAACAAAAAATAACGATTTAAACTA ACACACACTCGATAACAACCGAACTTTGATGGTCATCATATACCATGATG ATTTGAAAAATGACTAATCCAAGACCATCAATAACATTATAACGAGTCTT AAAAAACTGGTTAAAGAAGATTAGTCTAGTCTTTGCAATGAGTGGCAAGA AATATCAAAACTTTGGGGATGATGCGAATATTGAAGAGCAAGAGGAACAA CATTCACATGAACAACCTTCTATTGTGAGTTTTGAATTTATTTGGAGGGT TCTCAACTTTATGATATACTGTAGTCCGTCTAGGTAAAGTCATGTANGAG GAACAACCTTCTATTGTGAGTTTTGAATTTATTTGGAGGGTTCTTCGTCT AGGTAAAGTCATGTATTCGCTTCCATTATATTTAGTTTTTCATATTCATT TACTCTCCAAGAACATTTTGTTTGAGATGGTCTTGGACTAATTTAAAATT CTAAAATCTAGGAGTAAGCTAATTGTTTGCCTGAAGATCTGTACCCAGAT TGACACTGCAGATGTTGAGTCATTTGATCGCCTTCAACACCACAATACAC GGGTTGCAAAATTATATCAGTTTAGTCAAAACATGTGATTACTCGAAAAA GTTGACGTGATTTTATTCCCATGTTACTTATGCTTTATGNAAAACATGTG ATTACTCGAAAAAGTTCACGTGATTTTATTTCCATATTACTTGCTTTACA ACTTACAGCTGATAACTTTATTAGTGTCAATAAATTCGAACCAATCAGAA ATAAATGTCATATAGCAAGCACATAACAATTTCGAGTAAAATCGTGATTT GTCTTTAAACTTATCATTATTTGCAACCTGTGTATTGAAATGAAATTCTT CTTCATTTTAGTCTGATGGACCAACACTGAATAGTATACCGCATGCGAAA GTCGTACCCGGCTTGTTATGCGGTATTTTCAAAAAGCCAAGATGGTGCCA GGATGGATTTAAGGTATAACTTTAAATACTGTATTAGAATAAACCTGCTA TAATTTCTGAAAAAAGGAGAAAGAACTACCTCAGAAATACAACTAAGAAC TAAGAACTACCTCAGAAATATTGAATTAGTCGGAATTTCAAGAATTTTTA TACTCAAATCCTAGAATTCAAAATTCAAAAATATACTTTGATGTCATTGC GGTCATTTTGACTAATATTTCTATACCTTAACGGTGCTTTTTACGCCAGG TCTCGTTAGTGTGTTTTTTTCGTCACTGGCGTAATAAGGGCTATCATAAG GGATCAGAATTGAACTAGGGCCGCAAGCCCTGAATTGAGCTTTGAAGGGG CCGTCGCCAAATTAGGACCGGCGTAAAAATGGTCGATAATGTACCAATAT CTAATTTCACTTTACGCTCTTCAAACGAAAAACTTCGAAACCTTCCGCAT TCAATGTAATGATTCAACCAGCGACCTGTTGATGCCACGGGGAAAAATGA TTAAATCACCAGTGTGTAAAAGTGCATTTCCCCTCATGGAATGTAAATAA TTTTTCAGACCCATGTGAATATATACGTTCCAAGGTATGAAATATACTTT TAACATCCACCTGATCTACCCTCTTTTCCCTGCTTGCTTCCTATCCTATC ACGTCAATTCGGTCAAATCGTCTCATTTTATCAAGCTATACCTGATCTGC TTCTCTGGTGATCTGATGACCCAAAGCGTCTGAGAAAACATACCTTCTTA GATATTTCTAAAACGAAGAACATGGCTTGAGTTGGGGGAATTGGAGACCG CGATGGCCGACCGTGATCTGGCGGATTGGCAGCCGCCCACGCGCTATTTT AAAGGAGCGGATCAATTTCCCATCGGAGATGATTGATAGTCAGCCTTTGA TATGCCGTATCCCCAGTCGGATTCAACTATCCTTAAGGGTAAACCTAAAA TTATTTCGGTTTGACCTGCAAATCCCCGAAAACGAGGACTGTGTTACCAG GCCTTCCAATGCAAAATCCTTGACACGGTCTTGTAAATTTCCGTAATCTT GAACTAATCATATTGTTGAAAATGTTCCCGACCTTCAGAGCTTTAGAGTG TCAGATGAAAATCTATGCATCTGGGTGCCAGATAATGTCATTCTGTGATG ATGTTCAAGTTCTCAATCTTCTTCCTAATAGGTTTTAATAGTGATTGCAG TTGTATTTTCCACCATTATTGGTCTTACATTAATCATTGATATCAGTCTA CGGAAAACCCATAAACCTTTGCAAGTTGTGACCGATCACCCAGAATGCAC TTCTTTGGTGAGGGAGCTCATGGACACGACCGATTCGAATGCAGTTGATG GTGCGGTTGCTGGAATGTTTTGTTTGGCAATCACACGACCTGATCTAACA AGCTTAGCAAGGTACCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNCCCCCCGCCCCCCCCCCCCACTTTGTTAATA ATTCCCCAAAATTAAAACGTTGATCATTTTTCATTTCTTTAAATTCTGGT AACAAACGAAGGTTTAAAAACACGTACGATACGTGTACTCTTCTTAATTC GACTTTTCTAACATTCCCATCTAGAGTTCGACATGACGTGCGTTAATTAG CCCAAGAAGCTGAGTGAAATTTTTATATCAAAGGAAAAAAAATAGAGATG ACGAGTGTTCAAGATAGAGTGGGTTTTATTTTTGCCTGTGTTTGCTACCA GCCAACGTTCTTTATTCGCTTTGTCGAAATTTGGCGAGAATTGGCAAGTT GAAATACGTGTAGTGAAGTCTCATACTCGCAAACTCTAAAGAAATACCTA ACCGTCAAGTCAAAAATAATGAAAACTGAATGTTAGAATTCCTTTAGGCG TACAAACTTTAACGAGGTCGAAAAATCGCGAAATTTACGACCTTTTACGA CATTTACTTTCGCGAATTTGAGGAAAAAATGTTTTTCGCGAGCATAAACT TTCGCGAATCGTTAGATAAAAATGTCAATTTTCGAATGAAAATCGACTTA AATATGAAAAATATTCCTTAAATCCGATAAAGACGGTCGCTCTTCGACTT AAAAAAAGAAAAAAATATGCCGAAAATTTGATATTTATTACAATTTCGAG GTTTTTATAGATTTCCAATTTTTTTGAGAATTTTTCGTGAGCATAAACTT TCGCGAATTGCCCTGTTAAGAGTTTTCAAAGACATTTACTTTCGCGAAAA AGGCCAAAAATTCGCAATAAGTTTCTGCTTGCGGAAGTTTGTACGCCTAA AGTATTCTCCACAAACTGTGTTACAATCTTTACATTTCAGAAATGACTAT TTATTTTAATACTGTTCTATTTTAGCGGTGGGTTTATGATTTATCATTCG GAAGATAAATCGAGTGGCCTCGATTTTCAAATGGAAGCCCCAGGAGATAA AACGGTTAGTCTTTTGTAGAACTTAGACACACCTCCTTTCGGTAGAAGGG TGAAAAGGGTGTAACTTTTGCCAATTTTTGGACCTACCGGGAGGTCCTTT AATTTGACCGTTGTCCGTTCGTCTGTTACAAGCTTTTCTCGGGATTGGGT CATTAGTTTCTTTTAATTTTTTGCACAATGATACAAAATGGCAATGCCTG AAAAGTGACGGAGCCGGATTTTTGAAAAAGATTTTGGGGGGGGCAAATTT GGGCCAAAAACTACCTAAAAATAAGGTTTTTTGGACTTTGTGCAAAATTG CTTCATTAGTTTTTCCTGATTTTTGGCAGAACGATAGAGTGCAAGGTACC CTAAAATGTGGCTGAAGTAATTTTTCTCGGAAAATTTTTTTTCGTCGTCA AATACGGATTTTCGCAAATTTGGGCCAAAAACTNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCTCGGAAAA TTTTTTTTCGTCGTAAAATACGGATTTTCGTTTTTTTGGGGAAATTCCCT TTTACCATTTTCCTGTTAGCAGCTTTTCTCGGGATTGGGTCATTAGTTTT TTTTAATTTTTTGCACAATGATACAAAATAGCAATGCCTAAAAAGTGACA GAGCCCGATTTAAAAAAAAAATTTGGGGGGGCAAATTTGGGCCAAAAACT ACCTAAAAAAAAGGTTTTTTGGACTTCATTAGTTTTTCCTGATTTTTGGC AGAAAGATGGAGTGCAAGGTACCTTAAAATGTGGCTAAAGTAATTTTTCT TGGAAAATTTTTTTCGTCATAAAATTTTCAAAAAAAGACGACCAAGTTAC ACAATGATAAAAGAAAATAAATTAGACGTTTTTGCATTGTTCTAAAACTT ATTGTGTTTGCTCAATACCAATAGTAAAATGTAGAACACCTACTTTTATC TGATTTTGATCAACAGGTAGGTCCATTCAGCATGTTGCTTGTTTAATTAT TTTTCCTTGTTTGAAATATAGTTTCTACTCTTCGCGCCGGAATGTCAAAA TTTAACTTTTTTCTAATACGGCTGCTCTTTTTCAACATTTCATTATGCTC TATTTCTACGCAACCCTCCGACGGTAAAGTTCTTACGAAGTCGAGACGGC TTCTTCGTCAGACCGTTTGCGTTCACCCATCCCTTTAGTTTGTTTTTGTA AAACGTTAATAGATATGATGACGCATTGGAAATTATATCAGGGTCAAACT TTACTGAATAAACGAACCGAAGTAATCACAAAATGCCTTCCGATGAGTAA CTCTTAGAAAAATTCGAATGATTTTTCCGTCAGATAACTTGTAGACAAAA ATCTTTGAAAATATTTTTAAAGAAACGTCTGTTTCACTGAGAATTGTCGT CCCAGACGGCATGAAACTAGCCTGTACCACCTCGCCGCCACAGGCTTTAT TTTATATTTTGAAAAAAAACTTGCCGTTATCTTTTTAGTCACCGAAGAAG AGTCTGGTACAGGCTAGCATGAAACTAATATCTTGTTTTCTTCTGAGAAT CCGTATCCATGGTAATATTATATTATTTTTATTCAGATTATTTCGCCAGT AGCGCTACCTGGTCTTGTTGAAGGCCTTCTTAAAACTCACCAACTGCACG GAAGGTACCTATCTATACCACAGATCTGTAAAGCCCGAAGAGCTAGATTT GCGGCCTTTATCGAAAAGTGAAGCAAGTTTTGATNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTCCC CCCCCCCCCCAGGACATCAAGTTCTTTAAGTCCTAGGCAATGGCGGGTTC CCTGCTGACAAGATATCCACCATAATGGGGTATGGACATTTTTTGGGAAT GGCTGATTGTAATGTTTTTGGTTGTCATAAAAGACCCATAATTAAGTCTG CGACTGCAGTCGACGGCGGCAAGAACGCTCATCTTTCGATAGCTGTTTAC CTGAAGCTAGGGGGAGGCGCCACTTTTTCTCTCTAGATTGCTCCACTCAC CATTGATCCTTTCCTTAACGGCTTTTTTGTTTTTGTGTACTTGATTCTAT TTTCTTTCGGAATCAAAGTTAATAATGGTACTCTGGTTGGGTGATAAATC ATCCTTAACTGAATTTCTTTGCTAGAATGATATTTTTCCTTACAGTACGA AGCTTGCACGTCTACTCGAAAGTTGTATAACATTGGCGAAAAACGGGTTT AAAGTTTACAAGAAAACAGGTATATCTATCAATTTATTCATCTTTTTGAT TGGTCAAATAGGGCAAACCCTTAAGATCCGTAGCTTCATTCTTAGGACGC ACACCACGTATTGTTATAATTATAATATATAATATAATTTGGTATGAATT GAACCCACAACCTTGCGCGCCGTAGACGAATGCTTTACCTTTGCACTACG GTTATCTGGTACCAGATGTGGAAATATGCTACGACACGCTTTGCTCTGTG AAGGTCGGGCCTATTTTAACATCTGGAAGGTTTGCATTACGGAATTTGTT TTGACCGCGTTTAAAAGTTTTGCAAGGAGCTTGCATCATGAAAGTTCCCT CCTTGCATCAGAAATTTGCTGTGGTATTGAAGCGCCGAGACTATAAAATA CTAAACCTCTCCGATGGATGGTATATTGGTCCGCTCCTTTAGAGCTTAAG CGTGGGCGGCCACCAATACGCCATCGGAATATCAGATAAGGACTACGGTC GCATATACTCTCGGTCGTACTTCTCTTTAGTGTGTGACATCTTGAATCTT GAAAAATTATGAGCGCTATAGTTACACTTATTTGACAAAAATCTTATCAC GAGAAAATTATCAAATTTCTTTTCTTTTCTTTCTAAGTGGAAGGTGAATT TGGCTTCTTTGAAAAGAACATGCAAATAATGTTATCTAAACACGGAAACG GGATAGTTCCTTTACAGGTTAGTGATTTCTTTGAGACTTTGGTACTGTTT TTGGACCTACCTAGAGCTGGATGTCCTATAAATTAACCCCTGTTCGTTTG TCCGTCCGTCCGGATCGTTCGTTCATTCGTTAGTAGCTTTTTTCAGGATT GGCCTGGCACAAAGATTCAAAATGGTAATGCCTAAAATGTGACCAAGCCC GATTTTCGAAAAAAATTTCTTTTGCCGGTCGCCAGATCCGGAAGCGAAAA ATTCTTTTTTCAGTTTTTCGGAATTTTCTCTAGAGAAAACCTTTGAAGCT TTGAAGTAATATGGTGTTGAGATGCCCTCATTTTTCGTCGAGGGAGTTGC CTTCTCTTCAATTTCACCTTTACGTCTTTTTTCTTTCAGGAAGGTGATAT TTTGAGACTTCCAGAAGTATCGAAACTACTTTACCAAATTTCGCGAGGGA ATTTAAAACCCTACCAAGACGATATTATAGAAAAAGTAAGATATCTCACA TTATTTTTCATTGATCTAACTAAAGACGTTTCGAGATAAATTTAGACACT GGTTGAGACTTTTCTCTATATCTTTCCAATTCGCAGCTAAGGCGCCATTT TTGTTGTAAAGCATTTTCCTAGTGTCGTAAGGAGGTTCATTTATCTCAGC TCGGGAAATTAAATAGGATAGCAGCGATGCAAAATCCCGCAATTCAGCGT TATCAAATTCTGTAACTTACGCAGCTTATCCGTTGTAATATTTGACAACA GGATTTTAAGCTCCTACCTAGGGATTTTTCGTAATCAATCTTGGCTGATA GTGATAGGCTACTTTGTTAAAAAAACACGAGATTTTGCTTTATTTTATTG CTTGAGGTTTAGCCGGCGTTCTTAATTTCAAATCGCAAACTTCAATTGGA AGCGTTGCATTGCGGAATATTGCTGCGTTGCAGAACCATGCAGTTTTCCG AGCTGCTCTGTAATCGTGAACTGTCGTTTCCTCAAAGGTGAAAGACTTGG GTTGGACTTCTGAAATGTTCAAGTCGTATCAATCTAAAGAGCTTGCTTTA CTGAAGACTTCATTAAAAAATGGTAAGTTTTTCTGAGATGTGTGGATCTC TTTTCGATGCCACGATGGAATCTATCTAACAAATCCTGCATTATTAAAAA TAGACAAAAAGAACGACAAATTTCATACTTTGCCTTCCACAACCCCGACC GAAAGTGACTGTACCACTCCATACGAATTCATTCCTCTTTGTTTATCACG GGAATTTACTGCGTGTGGTTTAAAAGAACGACTAATTACGCATGCGTGTT ATTAATGCAGGAACTGCAAGACAAACCTACTGCCACTGACAAACTTTGCT CGGTTTTTCATAATAATCATTTTGTTACAGATCCTTCAACTTTGGAAATA ATCTAGAAACAATATAGCAAGCTTCAAATCTCTTTTGTAAGACGAATGTC CTAGAAACAAAATAGAAAACTATCACCCTCAAGGCAGTCCTTGAAACTAG TCTGAGATCTGTCTGAGAACTCACAGAATTACATCGAAAATTCATGATAT GCGTCATTGCAATGTCTTCTGACATTAAATCACGGACCCATTAGCTGATT GGTTGTAAGCGACGTAAAATCATTCAATACGTTACTTTCAACCAATCAAC TGTTGGGTCCGTGGAAGACATTGCAATGGTGCATATCATTAATAATGAAC GTTTTTTTCCCATGGTTAGGTGTTACTCTACTTACGTTACCCCCACCTTC AAGTGGGATTGTCAGTCTCTTGGCAACCAAGTACCTTGACTACCTTTTAC CCGAGACTAGCACACCACTGGATAAGTATTTCACCATAGCTGAGGTAAGG TCCTTGCTTGTTGAGTTTAAGTTAAATCTTTAACCTTTCCCAAGTAAGAA AAGGTAATGCCTTAAGACTTGCGCAACTTTTAGAATGGCGTGTTGAATCT ATATTCCTTTCTTTGTTTTTAAGCGCCAATTTTTTTTTCCGAAATCTGGC GCTACATTTTACTTGAAATTGCGCGTTTGTGTGAAAACTATTTGGGCCAC GCGTTTTGAGTGGGAATGTGGCAACATTTTCAATTCGAATTGCTTCAGGT TGCTTGTAAAAAAAATTGCTTTTTAAGCCTGATTAATAGTTAGGCCGGGA AAAACCGAAATCTGTTATATCTAAACTCCATTTTTTTGCTAACTGTTGCC ATTATCATCTCTTCGTTCCGGAGTGATGACTGTGCAAAGCAGGGACCCAG AGGAAACAGCTTTATCAGTTCGCTGTGATTGAAGGTGTTGAAATACAGTT GGCGCTCTCTAATACGACGTTCTACTTTTCGATACGTTACATTATTCGAT AGTCATAAAAGCCACCGTCAACAAGAAACTCATAAACGACGCTCTACTAT TCGATACTCTCCCTTATTCGATAAGAATCCAATTCCCTTTGGAAATCGAA TAAGAGAGTGTCAACTGTAATTTATTTGAGATACTTACTATTCTTTCTCT AGACATTGAAATCAACATTTGAAAACCAAAGCCGATTATTAGACGAACCT TCCAACCTCCACGAGAAGATTGCAGAACTGTTACAGTACGGTCATGATTT TTTAACTGGAAAACTTCAGAAAGAGTACATTAGAAACATGCTAAAGTCCA GGGGAGAATTCTGACGAAAATCCATAGGGGAGTTTGACCTTCTAAAACTG ACCTTAGTATGGTAAGGGGAAGGGCAGTTTTCTTCCTAGGATAAAGCCAA TTCAAATTTTGATTGCATCTTGATCAAAAACCGTCAAAAACTGATAACGT GCGAGTATTTTCTAGAAAAACACAACATTGCTTGGCTTAAAAACAATACT TACCGCTAACAATTCAGTCCACTCGACAATCACTTTCAATGGAACTGATT GGTTGATATGGTTCAATTACATCATAATTATGAGATTTGAACCAATCGGA TTGATTTGATTGTTGAGTGTTTTGTTTTGTCAGTGTTCAGAGTATTTCTG TCTCACAGAAGTTTAAGAAAGCGAATTTCGTCTCAAGTTATATAACAACC AGCCGAGTTTGAAGAGTCTGGCCAAGGTTGGAGTGTTATCAAACCCCATT TCCGCCTGACAGGAGAATCTCTGCTTTGACCACTGTTTTATAGAAAAGAT GACATAGATGGAGTAGTGAAGAGCATCAAATCCACTGTTGACAATAAAAT ACCACGTCAAACTGCAACAGGGAAAACGCCGGCCCATCCCAAATTGGATG TGAAAAGCGCAAATGTGTTGGTGATTGATCATAATAATCAAGTGGCTGCC ATTTCTAGGTAAAGAAATTTTACTGATATCTTTTTTTTTGGCAAATTCTT GAAGTTACCCGTTGAATTGACATGTATGTGGAGCAAGATTGGTCAGAAAA AAAACATTTTTGCTTATTAGCATAATATAACAATAGATAGACACTGTCCT GATATGAAACGTAAATGTAAAAATAAAACCTTTAATACGACACTTAACTT TTACATTGTGACTGTTTTTTCTGTATCTGCTTTCCAAGCAGCACTTTTCT GATTTTCTCCTTTTCCATACAATTTTTTTAGTTCACTTGGTCATTCATTT GGTAATAAACAAATGACAAAATCAGGGGTGGTTTTGAACAATGGAATGAA GTTATTTCCTTCATCTTGGAAGGTTT

Coding sequence (CDS) from alignment at sc0000001:2167115..2179540-

>TCONS_00000245 ID=TCONS_00000245|Name=TCONS_00000245|organism=Clytia hemisphaerica|type=CDS|length=17784bp|location=Sequence derived from alignment at sc0000001:2167115..2179540- (Clytia hemisphaerica)
TTCACTTGGTCATTCATTTGGTAATAAACAAATGACAAAATCAGGGGTGG
TTTTGAACAATGGAATGAAGTTATTTCCTTCATCTTGGAAGGTTAAAAGA
TGACATAGATGGAGTAGTGAAGAGCATCAAATCCACTGTTGACAATAAAA
TACCACGTCAAACTGCAACAGGGAAAACGCCGGCCCATCCCAAATTGGAT
GTGAAAAGCGCAAATGTGTTGGTGATTGATCATAATAATCAAGTGGCTGC
CATTTCTAGACATTGAAATCAACATTTGAAAACCAAAGCCGATTATTAGA
CGAACCTTCCAACCTCCACGAGAAGATTGCAGAACTGTTACAGTGTTACT
CTACTTACGTTACCCCCACCTTCAAGTGGGATTGTCAGTCTCTTGGCAAC
CAAGTACCTTGACTACCTTTTACCCGAGACTAGCACACCACTGGATAAGT
ATTTCACCATAGCTGAGGTGAAAGACTTGGGTTGGACTTCTGAAATGTTC
AAGTCGTATCAATCTAAAGAGCTTGCTTTACTGAAGACTTCATTAAAAAA
TGGAAGGTGATATTTTGAGACTTCCAGAAGTATCGAAACTACTTTACCAA
ATTTCGCGAGGGAATTTAAAACCCTACCAAGACGATATTATAGAAAAATG
GAAGGTGAATTTGGCTTCTTTGAAAAGAACATGCAAATAATGTTATCTAA
ACACGGAAACGGGATAGTTCCTTTACAGTACGAAGCTTGCACGTCTACTC
GAAAGTTGTATAACATTGGCGAAAAACGGGTTTAAAGTTTACAAGAAAAC
AGATTATTTCGCCAGTAGCGCTACCTGGTCTTGTTGAAGGCCTTCTTAAA
ACTCACCAACTGCACGGAAGCGGTGGGTTTATGATTTATCATTCGGAAGA
TAAATCGAGTGGCCTCGATTTTCAAATGGAAGCCCCAGGAGATAAAACGG
TTTTAATAGTGATTGCAGTTGTATTTTCCACCATTATTGGTCTTACATTA
ATCATTGATATCAGTCTACGGAAAACCCATAAACCTTTGCAAGTTGTGAC
CGATCACCCAGAATGCACTTCTTTGGTGAGGGAGCTCATGGACACGACCG
ATTCGAATGCAGTTGATGGTGCGGTTGCTGGAATGTTTTGTTTGGCAATC
ACACGACCTGATCTAACAAGCTTAGCAAGTCTGATGGACCAACACTGAAT
AGTATACCGCATGCGAAAGTCGTACCCGGCTTGTTATGCGGTATTTTCAA
AAAGCCAAGATGGTGCCAGGATGGATTTAAGATGAGTGGCAAGAAATATC
AAAACTTTGGGGATGATGCGAATATTGAAGAGCAAGAGGAACAACATTCA
CATGAACAACCTTCTATTTTCACTTGGTCATTCATTTGGTAATAAACAAA
TGACAAAATCAGGGGTGGTTTTGAACAATGGAATGAAGTTATTTCCTTCA
TCTTGGAAGGTTAAAAGATGACATAGATGGAGTAGTGAAGAGCATCAAAT
CCACTGTTGACAATAAAATACCACGTCAAACTGCAACAGGGAAAACGCCG
GCCCATCCCAAATTGGATGTGAAAAGCGCAAATGTGTTGGTGATTGATCA
TAATAATCAAGTGGCTGCCATTTCTAGACATTGAAATCAACATTTGAAAA
CCAAAGCCGATTATTAGACGAACCTTCCAACCTCCACGAGAAGATTGCAG
AACTGTTACAGTGTTACTCTACTTACGTTACCCCCACCTTCAAGTGGGAT
TGTCAGTCTCTTGGCAACCAAGTACCTTGACTACCTTTTACCCGAGACTA
GCACACCACTGGATAAGTATTTCACCATAGCTGAGGTGAAAGACTTGGGT
TGGACTTCTGAAATGTTCAAGTCGTATCAATCTAAAGAGCTTGCTTTACT
GAAGACTTCATTAAAAAATGGAAGGTGATATTTTGAGACTTCCAGAAGTA
TCGAAACTACTTTACCAAATTTCGCGAGGGAATTTAAAACCCTACCAAGA
CGATATTATAGAAAAATGGAAGGTGAATTTGGCTTCTTTGAAAAGAACAT
GCAAATAATGTTATCTAAACACGGAAACGGGATAGTTCCTTTACAGTACG
AAGCTTGCACGTCTACTCGAAAGTTGTATAACATTGGCGAAAAACGGGTT
TAAAGTTTACAAGAAAACAGATTATTTCGCCAGTAGCGCTACCTGGTCTT
GTTGAAGGCCTTCTTAAAACTCACCAACTGCACGGAAGCGGTGGGTTTAT
GATTTATCATTCGGAAGATAAATCGAGTGGCCTCGATTTTCAAATGGAAG
CCCCAGGAGATAAAACGGTTTTAATAGTGATTGCAGTTGTATTTTCCACC
ATTATTGGTCTTACATTAATCATTGATATCAGTCTACGGAAAACCCATAA
ACCTTTGCAAGTTGTGACCGATCACCCAGAATGCACTTCTTTGGTGAGGG
AGCTCATGGACACGACCGATTCGAATGCAGTTGATGGTGCGGTTGCTGGA
ATGTTTTGTTTGGCAATCACACGACCTGATCTAACAAGCTTAGCAAGTCT
GATGGACCAACACTGAATAGTATACCGCATGCGAAAGTCGTACCCGGCTT
GTTATGCGGTATTTTCAAAAAGCCAAGATGGTGCCAGGATGGATTTAAGA
TGAGTGGCAAGAAATATCAAAACTTTGGGGATGATGCGAATATTGAAGAG
CAAGAGGAACAACATTCACATGAACAACCTTCTATTTTCACTTGGTCATT
CATTTGGTAATAAACAAATGACAAAATCAGGGGTGGTTTTGAACAATGGA
ATGAAGTTATTTCCTTCATCTTGGAAGGTTAAAAGATGACATAGATGGAG
TAGTGAAGAGCATCAAATCCACTGTTGACAATAAAATACCACGTCAAACT
GCAACAGGGAAAACGCCGGCCCATCCCAAATTGGATGTGAAAAGCGCAAA
TGTGTTGGTGATTGATCATAATAATCAAGTGGCTGCCATTTCTAGACATT
GAAATCAACATTTGAAAACCAAAGCCGATTATTAGACGAACCTTCCAACC
TCCACGAGAAGATTGCAGAACTGTTACAGTGTTACTCTACTTACGTTACC
CCCACCTTCAAGTGGGATTGTCAGTCTCTTGGCAACCAAGTACCTTGACT
ACCTTTTACCCGAGACTAGCACACCACTGGATAAGTATTTCACCATAGCT
GAGGTGAAAGACTTGGGTTGGACTTCTGAAATGTTCAAGTCGTATCAATC
TAAAGAGCTTGCTTTACTGAAGACTTCATTAAAAAATGGAAGGTGATATT
TTGAGACTTCCAGAAGTATCGAAACTACTTTACCAAATTTCGCGAGGGAA
TTTAAAACCCTACCAAGACGATATTATAGAAAAATGGAAGGTGAATTTGG
CTTCTTTGAAAAGAACATGCAAATAATGTTATCTAAACACGGAAACGGGA
TAGTTCCTTTACAGTACGAAGCTTGCACGTCTACTCGAAAGTTGTATAAC
ATTGGCGAAAAACGGGTTTAAAGTTTACAAGAAAACAGATTATTTCGCCA
GTAGCGCTACCTGGTCTTGTTGAAGGCCTTCTTAAAACTCACCAACTGCA
CGGAAGCGGTGGGTTTATGATTTATCATTCGGAAGATAAATCGAGTGGCC
TCGATTTTCAAATGGAAGCCCCAGGAGATAAAACGGTTTTAATAGTGATT
GCAGTTGTATTTTCCACCATTATTGGTCTTACATTAATCATTGATATCAG
TCTACGGAAAACCCATAAACCTTTGCAAGTTGTGACCGATCACCCAGAAT
GCACTTCTTTGGTGAGGGAGCTCATGGACACGACCGATTCGAATGCAGTT
GATGGTGCGGTTGCTGGAATGTTTTGTTTGGCAATCACACGACCTGATCT
AACAAGCTTAGCAAGTCTGATGGACCAACACTGAATAGTATACCGCATGC
GAAAGTCGTACCCGGCTTGTTATGCGGTATTTTCAAAAAGCCAAGATGGT
GCCAGGATGGATTTAAGATGAGTGGCAAGAAATATCAAAACTTTGGGGAT
GATGCGAATATTGAAGAGCAAGAGGAACAACATTCACATGAACAACCTTC
TATTTTCACTTGGTCATTCATTTGGTAATAAACAAATGACAAAATCAGGG
GTGGTTTTGAACAATGGAATGAAGTTATTTCCTTCATCTTGGAAGGTTAA
AAGATGACATAGATGGAGTAGTGAAGAGCATCAAATCCACTGTTGACAAT
AAAATACCACGTCAAACTGCAACAGGGAAAACGCCGGCCCATCCCAAATT
GGATGTGAAAAGCGCAAATGTGTTGGTGATTGATCATAATAATCAAGTGG
CTGCCATTTCTAGACATTGAAATCAACATTTGAAAACCAAAGCCGATTAT
TAGACGAACCTTCCAACCTCCACGAGAAGATTGCAGAACTGTTACAGTGT
TACTCTACTTACGTTACCCCCACCTTCAAGTGGGATTGTCAGTCTCTTGG
CAACCAAGTACCTTGACTACCTTTTACCCGAGACTAGCACACCACTGGAT
AAGTATTTCACCATAGCTGAGGTGAAAGACTTGGGTTGGACTTCTGAAAT
GTTCAAGTCGTATCAATCTAAAGAGCTTGCTTTACTGAAGACTTCATTAA
AAAATGGAAGGTGATATTTTGAGACTTCCAGAAGTATCGAAACTACTTTA
CCAAATTTCGCGAGGGAATTTAAAACCCTACCAAGACGATATTATAGAAA
AATGGAAGGTGAATTTGGCTTCTTTGAAAAGAACATGCAAATAATGTTAT
CTAAACACGGAAACGGGATAGTTCCTTTACAGTACGAAGCTTGCACGTCT
ACTCGAAAGTTGTATAACATTGGCGAAAAACGGGTTTAAAGTTTACAAGA
AAACAGATTATTTCGCCAGTAGCGCTACCTGGTCTTGTTGAAGGCCTTCT
TAAAACTCACCAACTGCACGGAAGCGGTGGGTTTATGATTTATCATTCGG
AAGATAAATCGAGTGGCCTCGATTTTCAAATGGAAGCCCCAGGAGATAAA
ACGGTTTTAATAGTGATTGCAGTTGTATTTTCCACCATTATTGGTCTTAC
ATTAATCATTGATATCAGTCTACGGAAAACCCATAAACCTTTGCAAGTTG
TGACCGATCACCCAGAATGCACTTCTTTGGTGAGGGAGCTCATGGACACG
ACCGATTCGAATGCAGTTGATGGTGCGGTTGCTGGAATGTTTTGTTTGGC
AATCACACGACCTGATCTAACAAGCTTAGCAAGTCTGATGGACCAACACT
GAATAGTATACCGCATGCGAAAGTCGTACCCGGCTTGTTATGCGGTATTT
TCAAAAAGCCAAGATGGTGCCAGGATGGATTTAAGATGAGTGGCAAGAAA
TATCAAAACTTTGGGGATGATGCGAATATTGAAGAGCAAGAGGAACAACA
TTCACATGAACAACCTTCTATTTTCACTTGGTCATTCATTTGGTAATAAA
CAAATGACAAAATCAGGGGTGGTTTTGAACAATGGAATGAAGTTATTTCC
TTCATCTTGGAAGGTTAAAAGATGACATAGATGGAGTAGTGAAGAGCATC
AAATCCACTGTTGACAATAAAATACCACGTCAAACTGCAACAGGGAAAAC
GCCGGCCCATCCCAAATTGGATGTGAAAAGCGCAAATGTGTTGGTGATTG
ATCATAATAATCAAGTGGCTGCCATTTCTAGACATTGAAATCAACATTTG
AAAACCAAAGCCGATTATTAGACGAACCTTCCAACCTCCACGAGAAGATT
GCAGAACTGTTACAGTGTTACTCTACTTACGTTACCCCCACCTTCAAGTG
GGATTGTCAGTCTCTTGGCAACCAAGTACCTTGACTACCTTTTACCCGAG
ACTAGCACACCACTGGATAAGTATTTCACCATAGCTGAGGTGAAAGACTT
GGGTTGGACTTCTGAAATGTTCAAGTCGTATCAATCTAAAGAGCTTGCTT
TACTGAAGACTTCATTAAAAAATGGAAGGTGATATTTTGAGACTTCCAGA
AGTATCGAAACTACTTTACCAAATTTCGCGAGGGAATTTAAAACCCTACC
AAGACGATATTATAGAAAAATGGAAGGTGAATTTGGCTTCTTTGAAAAGA
ACATGCAAATAATGTTATCTAAACACGGAAACGGGATAGTTCCTTTACAG
TACGAAGCTTGCACGTCTACTCGAAAGTTGTATAACATTGGCGAAAAACG
GGTTTAAAGTTTACAAGAAAACAGATTATTTCGCCAGTAGCGCTACCTGG
TCTTGTTGAAGGCCTTCTTAAAACTCACCAACTGCACGGAAGCGGTGGGT
TTATGATTTATCATTCGGAAGATAAATCGAGTGGCCTCGATTTTCAAATG
GAAGCCCCAGGAGATAAAACGGTTTTAATAGTGATTGCAGTTGTATTTTC
CACCATTATTGGTCTTACATTAATCATTGATATCAGTCTACGGAAAACCC
ATAAACCTTTGCAAGTTGTGACCGATCACCCAGAATGCACTTCTTTGGTG
AGGGAGCTCATGGACACGACCGATTCGAATGCAGTTGATGGTGCGGTTGC
TGGAATGTTTTGTTTGGCAATCACACGACCTGATCTAACAAGCTTAGCAA
GTCTGATGGACCAACACTGAATAGTATACCGCATGCGAAAGTCGTACCCG
GCTTGTTATGCGGTATTTTCAAAAAGCCAAGATGGTGCCAGGATGGATTT
AAGATGAGTGGCAAGAAATATCAAAACTTTGGGGATGATGCGAATATTGA
AGAGCAAGAGGAACAACATTCACATGAACAACCTTCTATTTTCACTTGGT
CATTCATTTGGTAATAAACAAATGACAAAATCAGGGGTGGTTTTGAACAA
TGGAATGAAGTTATTTCCTTCATCTTGGAAGGTTAAAAGATGACATAGAT
GGAGTAGTGAAGAGCATCAAATCCACTGTTGACAATAAAATACCACGTCA
AACTGCAACAGGGAAAACGCCGGCCCATCCCAAATTGGATGTGAAAAGCG
CAAATGTGTTGGTGATTGATCATAATAATCAAGTGGCTGCCATTTCTAGA
CATTGAAATCAACATTTGAAAACCAAAGCCGATTATTAGACGAACCTTCC
AACCTCCACGAGAAGATTGCAGAACTGTTACAGTGTTACTCTACTTACGT
TACCCCCACCTTCAAGTGGGATTGTCAGTCTCTTGGCAACCAAGTACCTT
GACTACCTTTTACCCGAGACTAGCACACCACTGGATAAGTATTTCACCAT
AGCTGAGGTGAAAGACTTGGGTTGGACTTCTGAAATGTTCAAGTCGTATC
AATCTAAAGAGCTTGCTTTACTGAAGACTTCATTAAAAAATGGAAGGTGA
TATTTTGAGACTTCCAGAAGTATCGAAACTACTTTACCAAATTTCGCGAG
GGAATTTAAAACCCTACCAAGACGATATTATAGAAAAATGGAAGGTGAAT
TTGGCTTCTTTGAAAAGAACATGCAAATAATGTTATCTAAACACGGAAAC
GGGATAGTTCCTTTACAGTACGAAGCTTGCACGTCTACTCGAAAGTTGTA
TAACATTGGCGAAAAACGGGTTTAAAGTTTACAAGAAAACAGATTATTTC
GCCAGTAGCGCTACCTGGTCTTGTTGAAGGCCTTCTTAAAACTCACCAAC
TGCACGGAAGCGGTGGGTTTATGATTTATCATTCGGAAGATAAATCGAGT
GGCCTCGATTTTCAAATGGAAGCCCCAGGAGATAAAACGGTTTTAATAGT
GATTGCAGTTGTATTTTCCACCATTATTGGTCTTACATTAATCATTGATA
TCAGTCTACGGAAAACCCATAAACCTTTGCAAGTTGTGACCGATCACCCA
GAATGCACTTCTTTGGTGAGGGAGCTCATGGACACGACCGATTCGAATGC
AGTTGATGGTGCGGTTGCTGGAATGTTTTGTTTGGCAATCACACGACCTG
ATCTAACAAGCTTAGCAAGTCTGATGGACCAACACTGAATAGTATACCGC
ATGCGAAAGTCGTACCCGGCTTGTTATGCGGTATTTTCAAAAAGCCAAGA
TGGTGCCAGGATGGATTTAAGATGAGTGGCAAGAAATATCAAAACTTTGG
GGATGATGCGAATATTGAAGAGCAAGAGGAACAACATTCACATGAACAAC
CTTCTATTTTCACTTGGTCATTCATTTGGTAATAAACAAATGACAAAATC
AGGGGTGGTTTTGAACAATGGAATGAAGTTATTTCCTTCATCTTGGAAGG
TTAAAAGATGACATAGATGGAGTAGTGAAGAGCATCAAATCCACTGTTGA
CAATAAAATACCACGTCAAACTGCAACAGGGAAAACGCCGGCCCATCCCA
AATTGGATGTGAAAAGCGCAAATGTGTTGGTGATTGATCATAATAATCAA
GTGGCTGCCATTTCTAGACATTGAAATCAACATTTGAAAACCAAAGCCGA
TTATTAGACGAACCTTCCAACCTCCACGAGAAGATTGCAGAACTGTTACA
GTGTTACTCTACTTACGTTACCCCCACCTTCAAGTGGGATTGTCAGTCTC
TTGGCAACCAAGTACCTTGACTACCTTTTACCCGAGACTAGCACACCACT
GGATAAGTATTTCACCATAGCTGAGGTGAAAGACTTGGGTTGGACTTCTG
AAATGTTCAAGTCGTATCAATCTAAAGAGCTTGCTTTACTGAAGACTTCA
TTAAAAAATGGAAGGTGATATTTTGAGACTTCCAGAAGTATCGAAACTAC
TTTACCAAATTTCGCGAGGGAATTTAAAACCCTACCAAGACGATATTATA
GAAAAATGGAAGGTGAATTTGGCTTCTTTGAAAAGAACATGCAAATAATG
TTATCTAAACACGGAAACGGGATAGTTCCTTTACAGTACGAAGCTTGCAC
GTCTACTCGAAAGTTGTATAACATTGGCGAAAAACGGGTTTAAAGTTTAC
AAGAAAACAGATTATTTCGCCAGTAGCGCTACCTGGTCTTGTTGAAGGCC
TTCTTAAAACTCACCAACTGCACGGAAGCGGTGGGTTTATGATTTATCAT
TCGGAAGATAAATCGAGTGGCCTCGATTTTCAAATGGAAGCCCCAGGAGA
TAAAACGGTTTTAATAGTGATTGCAGTTGTATTTTCCACCATTATTGGTC
TTACATTAATCATTGATATCAGTCTACGGAAAACCCATAAACCTTTGCAA
GTTGTGACCGATCACCCAGAATGCACTTCTTTGGTGAGGGAGCTCATGGA
CACGACCGATTCGAATGCAGTTGATGGTGCGGTTGCTGGAATGTTTTGTT
TGGCAATCACACGACCTGATCTAACAAGCTTAGCAAGTCTGATGGACCAA
CACTGAATAGTATACCGCATGCGAAAGTCGTACCCGGCTTGTTATGCGGT
ATTTTCAAAAAGCCAAGATGGTGCCAGGATGGATTTAAGATGAGTGGCAA
GAAATATCAAAACTTTGGGGATGATGCGAATATTGAAGAGCAAGAGGAAC
AACATTCACATGAACAACCTTCTATTTTCACTTGGTCATTCATTTGGTAA
TAAACAAATGACAAAATCAGGGGTGGTTTTGAACAATGGAATGAAGTTAT
TTCCTTCATCTTGGAAGGTTAAAAGATGACATAGATGGAGTAGTGAAGAG
CATCAAATCCACTGTTGACAATAAAATACCACGTCAAACTGCAACAGGGA
AAACGCCGGCCCATCCCAAATTGGATGTGAAAAGCGCAAATGTGTTGGTG
ATTGATCATAATAATCAAGTGGCTGCCATTTCTAGACATTGAAATCAACA
TTTGAAAACCAAAGCCGATTATTAGACGAACCTTCCAACCTCCACGAGAA
GATTGCAGAACTGTTACAGTGTTACTCTACTTACGTTACCCCCACCTTCA
AGTGGGATTGTCAGTCTCTTGGCAACCAAGTACCTTGACTACCTTTTACC
CGAGACTAGCACACCACTGGATAAGTATTTCACCATAGCTGAGGTGAAAG
ACTTGGGTTGGACTTCTGAAATGTTCAAGTCGTATCAATCTAAAGAGCTT
GCTTTACTGAAGACTTCATTAAAAAATGGAAGGTGATATTTTGAGACTTC
CAGAAGTATCGAAACTACTTTACCAAATTTCGCGAGGGAATTTAAAACCC
TACCAAGACGATATTATAGAAAAATGGAAGGTGAATTTGGCTTCTTTGAA
AAGAACATGCAAATAATGTTATCTAAACACGGAAACGGGATAGTTCCTTT
ACAGTACGAAGCTTGCACGTCTACTCGAAAGTTGTATAACATTGGCGAAA
AACGGGTTTAAAGTTTACAAGAAAACAGATTATTTCGCCAGTAGCGCTAC
CTGGTCTTGTTGAAGGCCTTCTTAAAACTCACCAACTGCACGGAAGCGGT
GGGTTTATGATTTATCATTCGGAAGATAAATCGAGTGGCCTCGATTTTCA
AATGGAAGCCCCAGGAGATAAAACGGTTTTAATAGTGATTGCAGTTGTAT
TTTCCACCATTATTGGTCTTACATTAATCATTGATATCAGTCTACGGAAA
ACCCATAAACCTTTGCAAGTTGTGACCGATCACCCAGAATGCACTTCTTT
GGTGAGGGAGCTCATGGACACGACCGATTCGAATGCAGTTGATGGTGCGG
TTGCTGGAATGTTTTGTTTGGCAATCACACGACCTGATCTAACAAGCTTA
GCAAGTCTGATGGACCAACACTGAATAGTATACCGCATGCGAAAGTCGTA
CCCGGCTTGTTATGCGGTATTTTCAAAAAGCCAAGATGGTGCCAGGATGG
ATTTAAGATGAGTGGCAAGAAATATCAAAACTTTGGGGATGATGCGAATA
TTGAAGAGCAAGAGGAACAACATTCACATGAACAACCTTCTATTTTCACT
TGGTCATTCATTTGGTAATAAACAAATGACAAAATCAGGGGTGGTTTTGA
ACAATGGAATGAAGTTATTTCCTTCATCTTGGAAGGTTAAAAGATGACAT
AGATGGAGTAGTGAAGAGCATCAAATCCACTGTTGACAATAAAATACCAC
GTCAAACTGCAACAGGGAAAACGCCGGCCCATCCCAAATTGGATGTGAAA
AGCGCAAATGTGTTGGTGATTGATCATAATAATCAAGTGGCTGCCATTTC
TAGACATTGAAATCAACATTTGAAAACCAAAGCCGATTATTAGACGAACC
TTCCAACCTCCACGAGAAGATTGCAGAACTGTTACAGTGTTACTCTACTT
ACGTTACCCCCACCTTCAAGTGGGATTGTCAGTCTCTTGGCAACCAAGTA
CCTTGACTACCTTTTACCCGAGACTAGCACACCACTGGATAAGTATTTCA
CCATAGCTGAGGTGAAAGACTTGGGTTGGACTTCTGAAATGTTCAAGTCG
TATCAATCTAAAGAGCTTGCTTTACTGAAGACTTCATTAAAAAATGGAAG
GTGATATTTTGAGACTTCCAGAAGTATCGAAACTACTTTACCAAATTTCG
CGAGGGAATTTAAAACCCTACCAAGACGATATTATAGAAAAATGGAAGGT
GAATTTGGCTTCTTTGAAAAGAACATGCAAATAATGTTATCTAAACACGG
AAACGGGATAGTTCCTTTACAGTACGAAGCTTGCACGTCTACTCGAAAGT
TGTATAACATTGGCGAAAAACGGGTTTAAAGTTTACAAGAAAACAGATTA
TTTCGCCAGTAGCGCTACCTGGTCTTGTTGAAGGCCTTCTTAAAACTCAC
CAACTGCACGGAAGCGGTGGGTTTATGATTTATCATTCGGAAGATAAATC
GAGTGGCCTCGATTTTCAAATGGAAGCCCCAGGAGATAAAACGGTTTTAA
TAGTGATTGCAGTTGTATTTTCCACCATTATTGGTCTTACATTAATCATT
GATATCAGTCTACGGAAAACCCATAAACCTTTGCAAGTTGTGACCGATCA
CCCAGAATGCACTTCTTTGGTGAGGGAGCTCATGGACACGACCGATTCGA
ATGCAGTTGATGGTGCGGTTGCTGGAATGTTTTGTTTGGCAATCACACGA
CCTGATCTAACAAGCTTAGCAAGTCTGATGGACCAACACTGAATAGTATA
CCGCATGCGAAAGTCGTACCCGGCTTGTTATGCGGTATTTTCAAAAAGCC
AAGATGGTGCCAGGATGGATTTAAGATGAGTGGCAAGAAATATCAAAACT
TTGGGGATGATGCGAATATTGAAGAGCAAGAGGAACAACATTCACATGAA
CAACCTTCTATTTTCACTTGGTCATTCATTTGGTAATAAACAAATGACAA
AATCAGGGGTGGTTTTGAACAATGGAATGAAGTTATTTCCTTCATCTTGG
AAGGTTAAAAGATGACATAGATGGAGTAGTGAAGAGCATCAAATCCACTG
TTGACAATAAAATACCACGTCAAACTGCAACAGGGAAAACGCCGGCCCAT
CCCAAATTGGATGTGAAAAGCGCAAATGTGTTGGTGATTGATCATAATAA
TCAAGTGGCTGCCATTTCTAGACATTGAAATCAACATTTGAAAACCAAAG
CCGATTATTAGACGAACCTTCCAACCTCCACGAGAAGATTGCAGAACTGT
TACAGTGTTACTCTACTTACGTTACCCCCACCTTCAAGTGGGATTGTCAG
TCTCTTGGCAACCAAGTACCTTGACTACCTTTTACCCGAGACTAGCACAC
CACTGGATAAGTATTTCACCATAGCTGAGGTGAAAGACTTGGGTTGGACT
TCTGAAATGTTCAAGTCGTATCAATCTAAAGAGCTTGCTTTACTGAAGAC
TTCATTAAAAAATGGAAGGTGATATTTTGAGACTTCCAGAAGTATCGAAA
CTACTTTACCAAATTTCGCGAGGGAATTTAAAACCCTACCAAGACGATAT
TATAGAAAAATGGAAGGTGAATTTGGCTTCTTTGAAAAGAACATGCAAAT
AATGTTATCTAAACACGGAAACGGGATAGTTCCTTTACAGTACGAAGCTT
GCACGTCTACTCGAAAGTTGTATAACATTGGCGAAAAACGGGTTTAAAGT
TTACAAGAAAACAGATTATTTCGCCAGTAGCGCTACCTGGTCTTGTTGAA
GGCCTTCTTAAAACTCACCAACTGCACGGAAGCGGTGGGTTTATGATTTA
TCATTCGGAAGATAAATCGAGTGGCCTCGATTTTCAAATGGAAGCCCCAG
GAGATAAAACGGTTTTAATAGTGATTGCAGTTGTATTTTCCACCATTATT
GGTCTTACATTAATCATTGATATCAGTCTACGGAAAACCCATAAACCTTT
GCAAGTTGTGACCGATCACCCAGAATGCACTTCTTTGGTGAGGGAGCTCA
TGGACACGACCGATTCGAATGCAGTTGATGGTGCGGTTGCTGGAATGTTT
TGTTTGGCAATCACACGACCTGATCTAACAAGCTTAGCAAGTCTGATGGA
CCAACACTGAATAGTATACCGCATGCGAAAGTCGTACCCGGCTTGTTATG
CGGTATTTTCAAAAAGCCAAGATGGTGCCAGGATGGATTTAAGATGAGTG
GCAAGAAATATCAAAACTTTGGGGATGATGCGAATATTGAAGAGCAAGAG
GAACAACATTCACATGAACAACCTTCTATTTTCACTTGGTCATTCATTTG
GTAATAAACAAATGACAAAATCAGGGGTGGTTTTGAACAATGGAATGAAG
TTATTTCCTTCATCTTGGAAGGTTAAAAGATGACATAGATGGAGTAGTGA
AGAGCATCAAATCCACTGTTGACAATAAAATACCACGTCAAACTGCAACA
GGGAAAACGCCGGCCCATCCCAAATTGGATGTGAAAAGCGCAAATGTGTT
GGTGATTGATCATAATAATCAAGTGGCTGCCATTTCTAGACATTGAAATC
AACATTTGAAAACCAAAGCCGATTATTAGACGAACCTTCCAACCTCCACG
AGAAGATTGCAGAACTGTTACAGTGTTACTCTACTTACGTTACCCCCACC
TTCAAGTGGGATTGTCAGTCTCTTGGCAACCAAGTACCTTGACTACCTTT
TACCCGAGACTAGCACACCACTGGATAAGTATTTCACCATAGCTGAGGTG
AAAGACTTGGGTTGGACTTCTGAAATGTTCAAGTCGTATCAATCTAAAGA
GCTTGCTTTACTGAAGACTTCATTAAAAAATGGAAGGTGATATTTTGAGA
CTTCCAGAAGTATCGAAACTACTTTACCAAATTTCGCGAGGGAATTTAAA
ACCCTACCAAGACGATATTATAGAAAAATGGAAGGTGAATTTGGCTTCTT
TGAAAAGAACATGCAAATAATGTTATCTAAACACGGAAACGGGATAGTTC
CTTTACAGTACGAAGCTTGCACGTCTACTCGAAAGTTGTATAACATTGGC
GAAAAACGGGTTTAAAGTTTACAAGAAAACAGATTATTTCGCCAGTAGCG
CTACCTGGTCTTGTTGAAGGCCTTCTTAAAACTCACCAACTGCACGGAAG
CGGTGGGTTTATGATTTATCATTCGGAAGATAAATCGAGTGGCCTCGATT
TTCAAATGGAAGCCCCAGGAGATAAAACGGTTTTAATAGTGATTGCAGTT
GTATTTTCCACCATTATTGGTCTTACATTAATCATTGATATCAGTCTACG
GAAAACCCATAAACCTTTGCAAGTTGTGACCGATCACCCAGAATGCACTT
CTTTGGTGAGGGAGCTCATGGACACGACCGATTCGAATGCAGTTGATGGT
GCGGTTGCTGGAATGTTTTGTTTGGCAATCACACGACCTGATCTAACAAG
CTTAGCAAGTCTGATGGACCAACACTGAATAGTATACCGCATGCGAAAGT
CGTACCCGGCTTGTTATGCGGTATTTTCAAAAAGCCAAGATGGTGCCAGG
ATGGATTTAAGATGAGTGGCAAGAAATATCAAAACTTTGGGGATGATGCG
AATATTGAAGAGCAAGAGGAACAACATTCACATGAACAACCTTCTATTTT
CACTTGGTCATTCATTTGGTAATAAACAAATGACAAAATCAGGGGTGGTT
TTGAACAATGGAATGAAGTTATTTCCTTCATCTTGGAAGGTTAAAAGATG
ACATAGATGGAGTAGTGAAGAGCATCAAATCCACTGTTGACAATAAAATA
CCACGTCAAACTGCAACAGGGAAAACGCCGGCCCATCCCAAATTGGATGT
GAAAAGCGCAAATGTGTTGGTGATTGATCATAATAATCAAGTGGCTGCCA
TTTCTAGACATTGAAATCAACATTTGAAAACCAAAGCCGATTATTAGACG
AACCTTCCAACCTCCACGAGAAGATTGCAGAACTGTTACAGTGTTACTCT
ACTTACGTTACCCCCACCTTCAAGTGGGATTGTCAGTCTCTTGGCAACCA
AGTACCTTGACTACCTTTTACCCGAGACTAGCACACCACTGGATAAGTAT
TTCACCATAGCTGAGGTGAAAGACTTGGGTTGGACTTCTGAAATGTTCAA
GTCGTATCAATCTAAAGAGCTTGCTTTACTGAAGACTTCATTAAAAAATG
GAAGGTGATATTTTGAGACTTCCAGAAGTATCGAAACTACTTTACCAAAT
TTCGCGAGGGAATTTAAAACCCTACCAAGACGATATTATAGAAAAATGGA
AGGTGAATTTGGCTTCTTTGAAAAGAACATGCAAATAATGTTATCTAAAC
ACGGAAACGGGATAGTTCCTTTACAGTACGAAGCTTGCACGTCTACTCGA
AAGTTGTATAACATTGGCGAAAAACGGGTTTAAAGTTTACAAGAAAACAG
ATTATTTCGCCAGTAGCGCTACCTGGTCTTGTTGAAGGCCTTCTTAAAAC
TCACCAACTGCACGGAAGCGGTGGGTTTATGATTTATCATTCGGAAGATA
AATCGAGTGGCCTCGATTTTCAAATGGAAGCCCCAGGAGATAAAACGGTT
TTAATAGTGATTGCAGTTGTATTTTCCACCATTATTGGTCTTACATTAAT
CATTGATATCAGTCTACGGAAAACCCATAAACCTTTGCAAGTTGTGACCG
ATCACCCAGAATGCACTTCTTTGGTGAGGGAGCTCATGGACACGACCGAT
TCGAATGCAGTTGATGGTGCGGTTGCTGGAATGTTTTGTTTGGCAATCAC
ACGACCTGATCTAACAAGCTTAGCAAGTCTGATGGACCAACACTGAATAG
TATACCGCATGCGAAAGTCGTACCCGGCTTGTTATGCGGTATTTTCAAAA
AGCCAAGATGGTGCCAGGATGGATTTAAGATGAGTGGCAAGAAATATCAA
AACTTTGGGGATGATGCGAATATTGAAGAGCAAGAGGAACAACATTCACA
TGAACAACCTTCTATTTTCACTTGGTCATTCATTTGGTAATAAACAAATG
ACAAAATCAGGGGTGGTTTTGAACAATGGAATGAAGTTATTTCCTTCATC
TTGGAAGGTTAAAAGATGACATAGATGGAGTAGTGAAGAGCATCAAATCC
ACTGTTGACAATAAAATACCACGTCAAACTGCAACAGGGAAAACGCCGGC
CCATCCCAAATTGGATGTGAAAAGCGCAAATGTGTTGGTGATTGATCATA
ATAATCAAGTGGCTGCCATTTCTAGACATTGAAATCAACATTTGAAAACC
AAAGCCGATTATTAGACGAACCTTCCAACCTCCACGAGAAGATTGCAGAA
CTGTTACAGTGTTACTCTACTTACGTTACCCCCACCTTCAAGTGGGATTG
TCAGTCTCTTGGCAACCAAGTACCTTGACTACCTTTTACCCGAGACTAGC
ACACCACTGGATAAGTATTTCACCATAGCTGAGGTGAAAGACTTGGGTTG
GACTTCTGAAATGTTCAAGTCGTATCAATCTAAAGAGCTTGCTTTACTGA
AGACTTCATTAAAAAATGGAAGGTGATATTTTGAGACTTCCAGAAGTATC
GAAACTACTTTACCAAATTTCGCGAGGGAATTTAAAACCCTACCAAGACG
ATATTATAGAAAAATGGAAGGTGAATTTGGCTTCTTTGAAAAGAACATGC
AAATAATGTTATCTAAACACGGAAACGGGATAGTTCCTTTACAGTACGAA
GCTTGCACGTCTACTCGAAAGTTGTATAACATTGGCGAAAAACGGGTTTA
AAGTTTACAAGAAAACAGATTATTTCGCCAGTAGCGCTACCTGGTCTTGT
TGAAGGCCTTCTTAAAACTCACCAACTGCACGGAAGCGGTGGGTTTATGA
TTTATCATTCGGAAGATAAATCGAGTGGCCTCGATTTTCAAATGGAAGCC
CCAGGAGATAAAACGGTTTTAATAGTGATTGCAGTTGTATTTTCCACCAT
TATTGGTCTTACATTAATCATTGATATCAGTCTACGGAAAACCCATAAAC
CTTTGCAAGTTGTGACCGATCACCCAGAATGCACTTCTTTGGTGAGGGAG
CTCATGGACACGACCGATTCGAATGCAGTTGATGGTGCGGTTGCTGGAAT
GTTTTGTTTGGCAATCACACGACCTGATCTAACAAGCTTAGCAAGTCTGA
TGGACCAACACTGAATAGTATACCGCATGCGAAAGTCGTACCCGGCTTGT
TATGCGGTATTTTCAAAAAGCCAAGATGGTGCCAGGATGGATTTAAGATG
AGTGGCAAGAAATATCAAAACTTTGGGGATGATGCGAATATTGAAGAGCA
AGAGGAACAACATTCACATGAACAACCTTCTATT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000133XLOC_000133Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000245-exon-sc0000001-1575043694:2179167..2179540TCONS_00000245-exon-sc0000001-1575043694:2179167..2179540Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1575043694:2178428..2178529TCONS_00000245-exon-sc0000001-1575043694:2178428..2178529Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1575043694:2177030..2177259TCONS_00000245-exon-sc0000001-1575043694:2177030..2177259Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1575043694:2175687..2175765TCONS_00000245-exon-sc0000001-1575043694:2175687..2175765Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1575043694:2173037..2173104TCONS_00000245-exon-sc0000001-1575043694:2173037..2173104Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1575043694:2171472..2171545TCONS_00000245-exon-sc0000001-1575043694:2171472..2171545Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1575043694:2170774..2170853TCONS_00000245-exon-sc0000001-1575043694:2170774..2170853Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1575043694:2170306..2170401TCONS_00000245-exon-sc0000001-1575043694:2170306..2170401Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1575043694:2169719..2169803TCONS_00000245-exon-sc0000001-1575043694:2169719..2169803Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1575043694:2168947..2169071TCONS_00000245-exon-sc0000001-1575043694:2168947..2169071Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1575043694:2168206..2168288TCONS_00000245-exon-sc0000001-1575043694:2168206..2168288Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1575043694:2167483..2167647TCONS_00000245-exon-sc0000001-1575043694:2167483..2167647Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1575043694:2167115..2167209TCONS_00000245-exon-sc0000001-1575043694:2167115..2167209Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1510915933:2179167..2179540TCONS_00000245-exon-sc0000001-1510915933:2179167..2179540Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1510915933:2178428..2178529TCONS_00000245-exon-sc0000001-1510915933:2178428..2178529Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1510915933:2177030..2177259TCONS_00000245-exon-sc0000001-1510915933:2177030..2177259Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1510915933:2175687..2175765TCONS_00000245-exon-sc0000001-1510915933:2175687..2175765Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1510915933:2173037..2173104TCONS_00000245-exon-sc0000001-1510915933:2173037..2173104Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1510915933:2171472..2171545TCONS_00000245-exon-sc0000001-1510915933:2171472..2171545Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1510915933:2170774..2170853TCONS_00000245-exon-sc0000001-1510915933:2170774..2170853Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1510915933:2170306..2170401TCONS_00000245-exon-sc0000001-1510915933:2170306..2170401Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1510915933:2169719..2169803TCONS_00000245-exon-sc0000001-1510915933:2169719..2169803Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1510915933:2168947..2169071TCONS_00000245-exon-sc0000001-1510915933:2168947..2169071Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1510915933:2168206..2168288TCONS_00000245-exon-sc0000001-1510915933:2168206..2168288Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1510915933:2167483..2167647TCONS_00000245-exon-sc0000001-1510915933:2167483..2167647Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1510915933:2167115..2167209TCONS_00000245-exon-sc0000001-1510915933:2167115..2167209Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1491911889:2179167..2179540TCONS_00000245-exon-sc0000001-1491911889:2179167..2179540Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1491911889:2178428..2178529TCONS_00000245-exon-sc0000001-1491911889:2178428..2178529Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1491911889:2177030..2177259TCONS_00000245-exon-sc0000001-1491911889:2177030..2177259Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1491911889:2175687..2175765TCONS_00000245-exon-sc0000001-1491911889:2175687..2175765Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1491911889:2173037..2173104TCONS_00000245-exon-sc0000001-1491911889:2173037..2173104Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1491911889:2171472..2171545TCONS_00000245-exon-sc0000001-1491911889:2171472..2171545Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1491911889:2170774..2170853TCONS_00000245-exon-sc0000001-1491911889:2170774..2170853Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1491911889:2170306..2170401TCONS_00000245-exon-sc0000001-1491911889:2170306..2170401Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1491911889:2169719..2169803TCONS_00000245-exon-sc0000001-1491911889:2169719..2169803Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1491911889:2168947..2169071TCONS_00000245-exon-sc0000001-1491911889:2168947..2169071Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1491911889:2168206..2168288TCONS_00000245-exon-sc0000001-1491911889:2168206..2168288Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1491911889:2167483..2167647TCONS_00000245-exon-sc0000001-1491911889:2167483..2167647Clytia hemisphaericaexon
TCONS_00000245-exon-sc0000001-1491911889:2167115..2167209TCONS_00000245-exon-sc0000001-1491911889:2167115..2167209Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000245-proteinTCONS_00000245-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2167115..2179540 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
10.9351 10.3526 6.91241 6.32816 30.2536 22.1824 21.8762 21.4541 19.194 20.9854 21.0645 20.003 12.3112 11.7693 9.92653 10.6378 17.0621 17.7522 7.819 10.773 12.6825 12.8346 13.4375 14.7469 16.0577 16.2576 17.919 13.5983 5.82363 5.0184
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000101GGT_peptidase
IPR029055Ntn_hydrolases_N
Vocabulary: Biological Process
TermDefinition
GO:0006751glutathione catabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0036374glutathione hydrolase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006751 glutathione catabolic process
molecular_function GO:0036374 glutathione hydrolase activity
Blast
BLAST of TCONS_00000245 vs. Swiss-Prot (Human)
Match: GGT7 (Glutathione hydrolase 7 OS=Homo sapiens GN=GGT7 PE=1 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 2.130e-19
Identity = 118/433 (27.25%), Postives = 197/433 (45.50%), Query Frame = 3
Query:  462 QDGFKVLIVIAVVFSTIIGLTLIIDISLRKTHKPLQ--VVTDHPECTSLVRELMDTTDSNAVDGAVAGMFCLAITRPDLTSLASGGFMIYHS--EDKSSGLDFQMEAPG---DKTIISP--------VALPGLVEGLLKTHQLHGSTKLARLLESCITLAKNGFKVYKKTVEGEFGFFEKNMQIMLSKH--GNGIVPLQEGDILRLPEVSKLLYQI---------SRGNLKPYQDDIIEKVKDLGW--TSEMFKSYQSKELALLK---TSLKNGVTLLTLPPPSSGIVSLLATKYLD-YLLPETSTPLDKYFTIAETLKSTFENQSRLLDE--PSNLHEKIAELLQKDD---IDGVVKSIKSTVDNKIPRQTATGKTPAHPKLDVKSANVLVIDHNNQVAAISSSLGHSFGNKQMTKSGVVLNNGMKLFPSSW 1649
            QDG  V++   + F+T + + L++ I         Q  VVTD   CTSL  E++    S+ VD AVA   CL I  P  + L  GG M+ H    ++S  +DF+  APG   ++T+           V +PG+V+GL + HQL+G    +++L     +A++GF V              NM     +    +G  PL  G +L  P+++++L  +         + GNL     +++ + +  G   T E F +Y     AL++     +  G  +L+ PPP +G   + A   L+ + L    +       +AETLK      SRL D    S + E + ++L K +   + G +   ++     +P     G   A        A VL++  ++ + A+ SSL   FG+  +T SG++LN+ M  F  SW
Sbjct:  104 QDGLTVIVTACLTFATGVTVALVMQIYFGDPQIFQQGAVVTDAARCTSLGIEVLSKQGSS-VDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIRRNESHLIDFRESAPGALREETLQRSWETKPGLLVGVPGMVKGLHEAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLARALAEQLPPNMSERFRETFLPSGRPPL-PGSLLHRPDLAEVLDVLGTSGPAAFYAGGNLT---LEMVAEAQHAGGVITEEDFSNYS----ALVEKPVCGVYRGHLVLSPPPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALASRLGDPVYDSTITESMDDMLSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTA--------AQVLIMGPDDFIVAMVSSLNQPFGSGLITPSGILLNSQMLDF--SW 517          
The following BLAST results are available for this feature:
BLAST of TCONS_00000245 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GGT72.130e-1927.25Glutathione hydrolase 7 OS=Homo sapiens GN=GGT7 PE... [more]
back to top