Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000241 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000241
Unique NameTCONS_00000241
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3393

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000241 ID=TCONS_00000241|Name=TCONS_00000241|organism=Clytia hemisphaerica|type=transcript|length=3393bp
GTTCTACACGACATTTCTGAAGAATACATGTCCAAAGGCGTTGCAAGAAA
AAGACGGTTCAAACAAAGTCCGTGATATCACCACAAATACGACACAACCC
AAGTGGGCCATTCACACTGCAGATGATAAAGAGTGGAAAAGTGATTTTAG
TGCAAATAACAACTTGGTTTTAAGTCCAACAGAAAATGGTGACGGTACCC
AATCTTCTGGATTTCCAAAAGCTTCTTTATTAAAATACGAAATCAGGCAT
TTAACCAATTTAAAACAAATTGAAGGTCCTGAACAATTTTTATCTAAGAA
TACGAAAAATCCATCGGTCCCGATTACCGAGCAACGAGAAAACGAAAAAG
CCGACGGTAAAAGCGACTCGGAAGACGAGAATATGACCGAACGTTTACGA
TCAACTCGGTATTCGAGTAGTAGAAACTCGGATGATTTACTCGGCCGTTC
TTCTTACCGTTCAACCCGAACTTCTTACTCAGATGACATTGGTGGATTAA
CACGTGGTACTAGCGCAGGCAGTAGCCGATACCGTAGAAGCGTACTAGAC
GACCCGCTCGATACGTACAGAAGTAGCCGTAGCTCGAGACGCTTAGATGA
TTATACACCAACGACTGATTATTCAACGACGTCATCTTCCAGATACGACC
GTCCATACCGTAGTACCACGTCTGCAGACGAAACTCGCTCTTATCGGACA
ACGTCTCGCCGTACACTTGATGATCCGGTTATAGAATCACCGAGACGTTC
TCGACGATCAAAAGTGAACGGTATTGACACAGCGATAACGACGACATCTG
TTACAGCCACGGTAGATGGAGACTGTAATAAGtgtaaagaaaaacaagaa
agaatAATCCAAttagaaaatgataaaaataaagagtttgaaaaatgtaa
agaaaagGATTTAAGAATTGAGGAACTAGAAAAACAATGCTCTAGGGACT
CTGAAAAACGGAAGGAAAAGGATGAACGAATTCGAGATTtaattaaagaa
ttaaaaaatgtttccgAAGACGTTAAATCGAAACAAGAACTGGTTAAAGA
NAAGATTTAATTAAAGAGTTAAAAAATCTTTCCGAAGACGTTAAATCGAA
ACAAGAACTGGTTAAAGACCTCGAAAGCGAGTTAAAAACGCAACGTACCA
ATTACGATCAGAAATTAAACGATTTACAAAGTTTGGAAAGCGAGTTTGTC
GAACAGGAAGAAATTCAAATCCGAATGGAAAAAGATTTAAATGATCGTGA
GGAACGAATAGAACAGTTAGAACATGAAATTCAAGTCGAAAGAGACACGA
TAAAATCGAAAGAAGATTTAATCGAAGAATTAACGATTCAACTCGAAGAG
CTTAAGGAAACTTTGGAAATGAAAGAGGAGAAGATATTGGAattggaaaa
agattttgagAACGCAAGTGTTGCTCTTATGAACGGTATCAAACAAATGG
AACAACAACCTCGATCTGGTGAAGATATACACGAACTGGAGGCTCAATTA
CAAGATAGTTTAGATGAGCGCGATGGTTTTATGAAAGAGATTAAGAAACT
CGAACGAGAgctaaagaaaatcaataatagCCTGGAGGAAGAGAAAAATC
AGACACGCAGGCTAGGAATTAAACTTGAGGACGCAAATTACGAGATCGGG
AGATTAAGACAGGAACTTATCAACTCGCAACTGGAGAACGAAAAAATAGT
GGAAGAAAACGAAGATTTAGCTGTGGATAACGAGGATTTGATCAAAGAGC
GAGATGAGATTATACAAATTTACGAGGAATTGTATCGAGAGAGTGAACGA
TTAAAACACGAGGTCAAAATTTGGAAGACTGTGTTCGATAACAATAAAGA
TAACATTGATGAGGATGAAATGCGAGAAGCGATGAGCGAAGGTGACGCAC
TTGAGGAGAATGGGAAGGAGTCTTCAGATGAAGAGgagCTGATAGAACTC
GAAGAAGACCAATCATTGCTTGTTCCTCCACGTGATGATATTCGAATCAA
AGTCACAGATGTCTCAAAAGCTTTCGaacaaagtgaagaaatttcaaGAG
GTAAATTTGGTAAAGTATACAAGATGGTAGCCCGAGCTACGGGTGACACC
TACGCAGCAAAATACATCAAAGTCACACCCAAACTTCGCGAAGACGTTCT
GAACACGATTGACATTATGAAGAAAATACATCATGTTCGGTTGATGAATT
TGTTTGATGTTTACGATCTGGGATCACAGATTGTCATGATTCTAGAATAT
GTTGGCGGAGGTATGTTATTTGAACGTATCGTGGAAAAGAATTCACTTAC
AGAAGCGGAATGTGCTTTATACATCAAACAAGTCTTGCAGGGATTACATC
ATCTTCATCTACAAAATATCGCACATCTTGAGTTGAAGCCTGAGAATATT
ATTTGCGTGAACCGTAGCAACATGGACATCAAAATCATTGACTTTGGATT
GGCTAAACAATTGTCACATGACAAACCAATCAAGATTACCGCTGGGTCGC
CGGAATTTGTGGcaCCGGAAATTTTGTCATTCGATCCTGTTTCCCTGAAT
AGCGATTTATGgAGTGTTGGTGTTATTACGTACATTCTATTGTCGGGTAT
TTCACCATTCATTGGAGATGATGACAACGATACATTGATGAATGTTTCCT
GTGGTGAATACGAATATGATGACCAAGCGTTCGGTCAAATCACCAATGAT
GCGAAATCCTTCATCGATAAACTGCTTGTCTCGAATCCTAAGAAAAGGGG
AAATGTTGGTCGCTGCTTGCAACATCCTTGGATAAATtccaaCTGGCAAT
CCAAACAAAGTAAAATCAACCTTGGCAACTTGAAGACGTTCTTGAAGAAA
CACAAAGAAAAGGTTAACGTCAGTGCTAGAGGTGCCATCCGTCGGTTCAG
TTCATTTGGAGTGGGCGGTCACGCCCATGGTTTATTGGGTGGACGAGGTG
GCTCTCCCGTCAGTGTCGGTAGCAGCCGATCGCCTTCAAAACATTTATTG
GTACCGAACGCCCTTCAATCATGCGTGataaatgaagatgaagaagaaga
ggaagaagCAGATGAGAATCAAAACATCCGGAATATCAATGATTCTTTAC
GGAGTGGCCCGATTTTTACTGTAACAAAGGAAGCGGAAAGGCCCCCTTCC
GGTGATTATGGTGAAGCATTACCGGATTTCAATACGGATACACCAGACGG
GTTGAGAAATTATTTACAGCAAATGATTAATACTGGGTTATTACCGGGCC
GTTCTGGACCACCGGACATGTCTGAACAGTTTAGTGATGAAGATCATTGA
AGGAATAAGAGGTCGGATGATAAAGTAGATTTCCAGACAGCGCGAAACGT
TCAAACAAGGTATATCAAACGTTCCTAACGTCTTTTAACGTTA
Run BLAST on NCBI

transcript from alignment at sc0000001:2079465..2127350-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000241 ID=TCONS_00000241|Name=TCONS_00000241|organism=Clytia hemisphaerica|type=transcript|length=47886bp|location=Sequence derived from alignment at sc0000001:2079465..2127350- (Clytia hemisphaerica)
GTTCTACACGACATTTCTGAAGAATACATGTCCAAAGGCGTTGCAAGGTA CGTCATTTATACCGGTTTTTATAAGAACAGTGAGGCTCAAAACCATCGAA AAAGGATTTAAGAACGTACCCAGCTGGCACACATCGATATTTTAACATAA ACCTAACGTTCTATGAACGTTGTGAACGTTGGATAGACGTTCAAAAAACG TTGTGTGCCAGCTGGGTAAATAATGCTAAACTTGGAATATCTGAATTTTC AGGCAAAAGTGTCAAAGTATCAAAAATGATGTATAAAGCCTGAAACCTCA ACCTTAGCCTTGAATAAAAACAATATGAGGATATAGTTGTATGGATACGA GCGCGTTAAATAGTTCGTTACATAATGGACACCATCGGGGAAATGTTTAG TGTCCGCTAATGAGGGGTTCTCCTGTAATACATATTCTGTCTGCCAAACA ACGTAGTATTTTTCTTTGCCTATACATTTTGCCATTTTAATAACAATATT AGATCGACCCATATTTCACACATCATTTTATCAACAAATCTCATGGTTTT GGTTTTACACAATTTAGTGGTTTTTTAGTTGATCATACACGTTTCTTTAT AAGAACAAACTATATAAGAATATAATGCTTCCATGGCCAAAAAAAATAAG AACAAGTTAAGAACATTTCAAGGTTTTGTGGACTCTAAAACACCCAATTT CTTATGAAATTGCACAAAAATACATAAAAAATGGGGAAAATAAGAACATG TTAAAAACATATTTTAGGCTTAAAACTCAAAAAGTTAAGAACATCCAAAG GCTTCAAAAAGTTTGGATATTCTTATAAAAAACATACAACAGTCACGAAA CCATATTGTGAGAGACGTATGCGATATTTATATGGTTTGTATTGGACCCT ATAGGTTGGACCTGAGGTTATATCTTCTATGGGATGTTTTCTCGTATACG CAACGTTTATGTTTTGATGAGATAATTTGGAAGTAAGTCACGAAATCTAA CTAAGGGTGCAAAATATTTTGAAGTTTTATGGAAAAAGAAACCAGCTAGG CGTTTCAACTGTTTTCGGTATAAATAGTGCCATGGACGTTGATGTGACAT TTTGGTCGGTGTGTAACGTAAAATGAAATATTTGATAGTTACTTCAGTGT TGTCCACTATGTTCAGAACAAGAGGACGTTATAAAGAAAGACAGGTCGAT ACAGTGACGCTCCACTATAAGCCATTTCATAGTCGTAAAGTGTAATGGGT AATCAGGACCACTGCACGCTAATGACGACTTACTATTGGTCCTAGCATAG TTAACTAAGCCCGTATTCACAAGGCTAGGACACACGGCTTATGGGAATAT AGCGTTTTCGGCGCTTTAAAGATTTTTTATATTTACGGATTTTAAGTTTG CCTTGGAATACTGGCTAGATTTCGTGAGCGATAGAAGTTTATAATTATTT TATCAGAAAACGTGTAGAAGAGGATGGGACTCATTGAATGCAAGATCTTT TTTCGATATCCAAGACCATTATTTTCGACAAGCTTTTTGATGAGGCTCAG CGACAGGGAACTCGAATTTTCGTTAAATCCTTGTGAAAGCTGAGTGGAAA TTGCAAAATAAAAATATTGTTCTATCTTACTCACCGCTAGGCTTTTAGGG GTTGGTAATCAAAATTGAATTTTTGATAATGATTTTGATTTAATCAACTA CGACTTACGATTGCACTTAACGTGCATAAGAGGAAATATGTAACAAGATT GGTAAAGATAACATTTCAAGCATTAGAAAATTTTTGATTCTATTTGCGGT TCGTTTTCTCATCTTGTTGTCTCGATGTAATTCTTATAATGTAAACCTAA ATTGTAAATGCAAAAAAACTCGAAGCTATGACTTACAATCGGCTTGTAGT CGTTAAAGATGAGGCCCGGAATTCCCGAGTTATTTTTTCCGAGTTAAAAA AACCGAGTTAAAAAAAACCCGAGTTATCCCGAGTTATGACGTCATTTTGG AATTTAGTGACGTCATTTTTCATTTCATAACTCGGTTTATTTTGCTTCCT TTAACTTTCCGAGTTATTTTCCATTTTTTAACTCGGGAATTTTTGCTTCC TTTGACTTTCCGAGTTATTTTTCTTTTTTTAACTCGAGAATTTTTGCTTC CTTTAGCTTTCCGAGTTATTTTTGAATTTTTAACTCGGGAATTTTTGCTT CCTTTAGCTTTCCGAGTTATTTTTCTTCATANNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTATTGATCC CATACCAACCTAAATCAAAGACATAACCATCCATTACCAACTAGAAAAAC CTTAACTTGCTTAATAAAATGAATAATCAACAAACAAGTGAATAATTAAA AAGCAAGAACTGAAGTTAAAACACCTATGGCTAAATCTTCATGATGCACC GACAAGCACGGAGACTTAGAAAATTTTTTGAAACTTTTCAATACTTTACC CCGATTCGAACCTACATGTTTCCGATTACGAATCACATAGTCTACACCAC TGGGCCACGACGGCTGCTGATATTCCGAAATTCAAGGTTATTTATGGAGT GACACATATAGTATATACGGGTGAACAGACCTCACGAGTTAGGCTAACTG TTATGATCGCCATTCCTCCAGGAAGACCCCACACACGGGTGCACCACCGG GAGGGTGCACAGCCGTCTGGGCGCATGTTAGGGATGAGCAGCAGCCAGCC TGCTGCCTATCCCTAACAAAACGCTGCGCTCGCCTGTGCGCTACGCGCAC AATATTTTGCCCGCGCGCACCCGCGCGGTGTACTTGCAAGGCCGGTGCAT CATGAAGATTTAGCCACTGGTGACAAAACCTGCTAGATAAACAAAGTGTA AGCCCTTCAAAAATATTACAGCATAAATAAAATCTCAAAAAATACAGCAG GTAGTGATGAGATAAAGCTATTTCAAAATTCATATTTCCTCCCTATTTCA TTAAAGAATACTGTAAGTGACATGACAAGATTCTCAGAAAAATTCCTTCC NGAAAGTCTCTAAATGTTGACCTGAAGGTATATTGTTATTCGAATGTTTA CCCCCGTCTTTTTATAGAAATAATTCGAACATCAAACCCCATTCTGCGCA ATGTGAAGTGAAAGATACTGGACACTTGTTCGAAACTGAAAAACGTGCGA TGCAAAAATAAGAAGAGAAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNTTTAAAATAACTCGGAAAGTTAA AGGAAGCAAAAATTCCCGAGTTAAAAAATGAAAAATGACGTCACTAAATT CCAAAAATGACGTCATAACTCGGGATAACTCGGTTTTTTTTTAACTCGGT TTTTTAACTCGGAAAAAATAACTCGGGAATTCCGGGCCTCGTTAAAGATT GAGGGTATCTCGGAAGGATATATTCAGGACGTTACCTTAAATTACAGTCT TATCTATATAAGAATTATGGGCTTTTCCAGAAAAAAATGTTACCCCCACT GTTGAGGATATTGATTTTTCCTACTTTATTAGTAATTTGACTTTACGACC TATCTTTGGTTCAACTCACAAAAACTTTGATATTTTTGTTCACAGACTCG ATTTTAAGTCTTCATTTTACAGTTTAGTTCTTAAAGCCATAAATTGATAG CTAAACTGTAACCTTCGGGATTTTTACCGAGGTTTTCAAGAAAACAAATC AATTTAACAATCAATTGAACAATCAATTGAATTCAGTTTGACCTTTAGTA TTCTCAATAAAGCTTTTTGATCAGATCAGATATTTCCTATTACGGGAATT TAGTACAAATATATAGGCAAGAAGAACGGGCTAGTCGTTATTTTCCATAG CGAAAATCACGAGACTGGTGCGATGAAATAGTGACCAGACGGGCTAGAAG CAAATGATCAAACATTCCGAAGTCAGAAAAAATTTGAAGCTTTATGAATT ATGCCGCATTTAGACGATGGGTTGAAATTGAATCTGGTGCTTTCCCTGTT TTTGTGGTTTACATTTTTTCGAAATCTGCTGGTAGATGGGTGGGTCAATT TTATATCCAGAGCAACTTATGGAGGAAATCACGGCTTCAAATCCTACTCA CTTTTAGGATTGGCTTTTGGGTTTATACTTCAATGTTAAGGTTATCTCAT TTGATATAAAGGAGATGGAATTGGACGTTTAAGCGTAGACAGATAAAGAC TTGTTAATTAGGTGGTCATTAAATACAGATCATAAACACTCAAGTTAATC GTATAAGATTTTTGAGACGATCTTTTAATTAATTGGGTTAAAAAGTCTTT TTTGAAAATCTCAAACTAATCTATCTTTATAGATTTAGATAAAAAGGAAA AAAAGTACCTTGTAAAGCTGGGAAGAAGATCATATACTCGTCGTATACAG GAATCGTTTTGTCATTTTGGTTGTATGTGATTGATACGTGATAGGAGAGA AGCTTGTCCCAGTTCATCGGTATTACCTTTACAACAATTCATCAATTTGC CATCATTTCCATCCAGACATCAAACCTGATCATCTTTTGTCTGCATTATT GTGTCCACAGCTTTTTGAACCATTTTTTTTTAAGTAATTGGTCAAAAATA AAAGACTGATATTGAAATTAAGACAATACAATGTCTTATTTGAAGAATCG TAACAGACTGATGGCAGATTTGTACACCACTCCTCGAAGTCATACTAACA CCATGCATGGACAAGAAGGTTTGTTTTTCTATACTTTTACCATCCGTTAT AATAAACACAAATTCTTACTCAACAAACTGTTATTTAGGAGGTAAAGAAA AAACTGTGGGCTGAATTTTCTCATCGTCATATCATTCTTCAATCTAAGTC CAAAGCCCGCAAAGGGACCTAAGTCGGGAACAAACAATAACCCTCCCTCC AAAGCTCGTGATCAGCTATTGCAGTACCCAGTTCCTCAATCTCTAACATT GCTTACAGTCTCAAAATATAGAGAAATGTCCGTTTTCTCGAGCGTTTTGG CTTGAATTTGAAAAAATTCGATTGGCGATCAACTTTGGGCTGTACTTTTT TTTGAAAACATTCTATCAAAAGATGTGGAATAATTCTTCCAAAAGTGACC TTGTACATTTGCCAACAGCTCATTTGAAAAAAGACTTAACCTCGGTATGC AATGGGGTATTTTTAAAACAAATCATTAAAGGTTTCATTTTTACATAAGT GTGCCCATTTCATACCAGACACATATTTCATATCAGGACAGTGTCTGCCT GATTGTTATATTATGCTGATATAAGCAAAAAATGTTTTTCTTTTCCTCTT TCTGACCAATCTTGCTCCACACCCGTGTCAATCCAATGTGAAAAAGCTTG TGAATTAAAACTGATGAGTAAGCAAAGGATGCTTTCTTATTTTAAAAAAA CCTTTAAACTGTTTTCAATGAGGCTCGGAAAACACGAGTTAAAAAACACG AGTTAAAAAACACGAGTTACAAAAAANNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN CAATTTATGGTGCACCTTAAATTGACGAGTTAAATTTTCATGAAACCAAG TTGGTCAAAAATTCTAAAATTCAGATTAAAATAGGCATACATTCAATATA TTATAAGTATGGTTTTTATGATTCTGGTAACGCTCATGATTGTACCTACA ATCATTGACAAAACCTTTGGCACAAAGCCCAAAGATGAGATTCCTCCCCC CCCTCTCCCCCCCCCCTAAACAATGTTGTCGGAGGGGGCTAAAGACTGGT CAAGCAATATTTCTTTCCCAACAACATTGTTCGGAGGGGAAGGGGAGTTT ATTGCCCTGTATCTAAATTTGACCGCCGGAAATGTGCCATACTATATTGG CAACGATTGTACATCCATCAGTGATTGGTGCATGTGGCTCTGGCTGCACA AGAGATCGATGAGAACCAGAAAGTTGCTGGTCTCCATCAAAAAGTATACA GTTGAAAATCCTTCCATGTCTTAACCTTAATCCAAAAAAAAATTGGCTCC TGACTTTGAGGTTGATTTATAATTACCCATGGTCGTATAACTTTAATTTT ACACTATAATTTAACAATCTTAAATATAGGCGAGAGAGCATTGCCAAGTG TTTCTTTCCGCCCTCTCAAAATTAATCTATCAAACGGGGATTTACTCATC GCGTAACTGTGCAATTTTNATCCGCCCTCTCAAAGTTAATCTATCAAACG GGGATTTACTCATCACGTAACTGTGCAATCTTATACATTTAGCATTGCCA GACGCTCACCAGGGATGCTGATAGTATCAAAATGTAGACAGCTACTTTAT TCACAGTCATATCAAATTGCTAATATACACGTCGTTTTTATAAGCACAAT TTTATATAGAACACCAGACTCAAATGTGACTAAAACCTAAAATATATGAA GTACTATCTAAAGCTTAGATATCCAGCTTTCTCAGAAAAAGGCTTATTTT ATTCCATTTTTAAAGGCTTAGTTAAGGAAAGTAACTAAGATTCAAGACGG TATCAAGAACAACTCTAAACCTAACTTTACTGGTTCTTATAAAATAAATC ATAACGTAAAACATATCCATAGTTATTACCTTTTTAGACGTGATAAATCA TATATCAATCTGGTCTTTATTTTTGTACTACTTATGAAATAATAGTGATT TATATTTTTTATGTGTGATACACTTGTAGTGTGTGTACTACTAGTGTTCT TGATAATGTTTCTAATGCAAATGGTATTCTTGGGGCTTTGTTGATTATAA GGTGTTCTTTTTCAAGGGCGGAGACTAGAGTTTGGAATCTTCTCACCTTA ACGGTTCCCCCTTAATGCAAAGGTTTCTATGTAGGAAGTATCTATAAAGG TCCAACCTGTCGGTAATCTCGAAGTAGTTCTTATAATGTTCTTGAAATTC CTAGTGGTATTCTACAGGGTATTCTAAGGGTTTTAATTATTTGTTCTGTT TCAAAGGGGGGGGTTCACGCTTGGCGGAGGAGCCGAATCAGGTCTTTTTT TCAGACGAAGTGGTGGAATTTGGCACGGACAGAATTTCGGAAATTATATT TTATGTCAGGGACAGGAAATTTGGTGGTTTTAGTCCGGTGAAAACGGAAC TTAATAAATTGGGAGAAAAATATTCAGGATTGCTTGAATTTTATATGGAA ATCTGGATTCTAACAGAATTTTTTTTCGGTGATGGAATTTTGATTAATTG AAGGAATTTGCGGAAAAAAAGATGATGTAATAAAAGAATCGGGTACCCCA TGAAACCCTCTTTCAATAACCGAAGGAAGGGTAGGCTACTTCTCATACCC AATGCTAAGGTTTAAGTGTTTAAAAGTGTTTAAATAGTGCTCAACGTCAA CGAATGTAGAACATATCTATAGAGGTCTTCTCGTCAGACTTAGACTAGGG AATTCTTAGCCTGGTACAACCGTTCAGTCAACGTTACGCGCATGCTACGG TTGTTAGTTGAATGTTATGATGACACTTTGCATCAGTAGGGCTACTTTCA TGGAACAATCGCCTTCGGATGTTGTTAATTTTTTGAGTCATAAACATAAA AATGTTCTTGACATATGTTCTTATTTTCCCCATTTTTTATGTATTTTTTG TCCATTTTCCTAAGAAATTGGCTGTTTTCGAGTCCGCAAAGCCTTAAAAT GTTGTTAACTTGTTCTTAAAATTCTGGCCATCGAAGCCTTATGTTCTTGT ATAATATTTTCTTATAAAAAAACCTGTAGTGGCTTTGCTTCCTGTGGTTA GACAAAAACCTCCAAAATTTTAGACCAGCAGAAAGTAGTTATCAGAGTGA GGTGAACTTGATTACCCTCGATTTCCTTCAACCGTGAAATTGTTCTATTA CCGATCCCACCAAACTCGTACCCAATCCTTAAGACACCCCCTTCTCACAG ACCCGGTAGGATTTCTTTAGCCAGTGGGGACAAAAAGAACGAACCAAAAC TCGAGGGGGATTGACATTCCCATTTTTGGCTGGGGAGTTCAATTCTTTAG TTTTCAAGTCAGAAAATTCAATTGGGTTGGGGAACATTTTGCAGTGAGGA TTGGTTTATTTGATTATTTTCAGTGGGAACAATAGTTGGATTATAATTTT CCACTGGGGACGATATTTTGGCCAAATTTTCCAGTGGGAAGGGTTCCCAG TGAGTCTGTGAGAAGGGGTGTCTTAAGCGCAAAGGTTCATAGGTAGGAGG TTTAAATGGGTCTTTAATACCAGAACACCGGACACTTAAACTTGATTGAG AATCAACGAAAACACTGAACCCCTAGATTTATTTGTAGTTAGTACAGCAG AGTCTCTTTTATTTGAATTTCTATAGCTCGTATGTCCTCTCCGAATAAGT TTTCTTGTCCCTACAGTTAACAATATAAAGCTTACTTCATAACTTGAAAT TTCCTTAACTCGAACAACTTTGTGTTCCCCGTGCGTCTTCGAGTTACAGA GACTCAAATGCGACCGACTACACGTTTTTTTATAAGAACAAGCTGTATAA GAACAAAAGGCTTCGATTGCCAGACCTCGCGGACTTAGAAACACGCAATT TCTTAGAAAAATGGACAAAAATATTCACAAAAATCGTGAAAGTAAGAACA TGCTAAAAACGTTTTTAAGCTTAAAAGTCAAAAAGTTAAGAACATTCAAA GGCTTCAAAAATGTCGGATGTTCTCATAAAAAAACGTTTAATATAGTTTA GTTCAGGAAACAAAATCATTGAATAAGTGAGAATTCTTTTGCATAAAGAA TGACATCCATTTGCTAAAAATTTGGTAAATAAATACTGGCGTCACAGCAA AATGGTAGTCTTGTTACCACGTAGCTACTGAACTCTAAAATAATCACTAG AACGGATTTTTCCCCATCAACTTTAGTCTGAAAAATGAAGTCGGCTTGTG TCGTAAAACGATACAGATTTTGGCTGAGAGAGAGAGAGATTGCATCTGTA TCAAAATGATAGCCTAAGCTTTCAATTTGATTTTTCTCACACATTATATA CGGATGTCTAATCCAGTCTTTGTTTTAGAGTTCTGTGCATTTCAAATTTC ATGCGACTAGAATTGTTGTATTTCTGAAAAAAGACAGAAGTTTACTTAAC CCTTTTCATTTGTTGATTGTTTGTCTAAAGATTTAGGATTTTTTTCATAT ATGCGATTGCAATTTGAATAAGGCCAATGCAAATAAAGATTTTTTTGTAG TTTGGGTATATCAAAAACATTTTGAATAATGATTTCTAGATCTTGTTGGA TTGATACTGGTTTTTGCTGATGACGATTTTGTAGCTTTTTTTCAAGGTTG TTCGTTGCGTCGTTGAGTCAAAGTGTAATTTTTGAATAATTTTTATAATT AAGCTGTTTCTGATGGTTTGTTTCATGAATTGTTTTAAATTTAGTCAAAT AGTCAGACAGGCAGCCATATAGATAATTAGACTATTGCGGAAATCTACCT GATTAAAGAACCCGGTGGGATACTTAGGTAAAAAGAGGTACGGGGGTGTG CCGCTTTTTGAGGGAATTTGGTTGAAAAATGGAAAATTTTAAGAAAGTAT TAAAATTTCACTCCCATTTCACTTATTTCGCCAATTCCGGCAAAATTTTC ATAAAAACGAGTCCCATGTGTGGTCGATTTTTCGAACCTCAGCGAATAAC TGGTATGCAGATATCGTTTTATAAATGAATCTCGAAAGAAAGATACGGGC TTTCGTCGTTGCCATCGGGGTTGCCAAAATGAGTTAAGAAAAAACAAAGA AAAGCCGACATTTTTTGAATTTTTTGGACCATTATTTTTTTGCCGAAAGT TAGCCTTTTAGAGGAAAAAACTCAGGGTTATCATTTTTCAAATAATTTCC CGGCAGGTGCCCCTTCTCGTCCTTTATTACACACTTTTGTGAGGTCTAGA TATTTTCCTATACGTCATTTAGTTGTTAATTGATGATGCACTTTCACAAA TTTGAAACTGTACACTATATTTCTTTATTTTGACCGCAATCTTGGAAAGT CAGCAAAAACATTATTTTTCTGTCATAATAGAGACTACACGTCCTTTTTT TATAAGAACGTGAACATTTTTTGAAGGCTTCTGATGTTCTTATTTTCACC ATTTTTAGAGTATTTTTGTCCATTTTCTTAAGAAATTGGCCGTTTAAGAG TCCCAAAAGCCTTAAGGTGTTCTTAATTTGTTCTTAATTTTTTGGCTATT GAAGCCATATGTTCTTATATAGTTTGTTCTTATATGAAAAGAAGTGTAGA GACTATGAATATGACATCAATCGATTAAGAAACGATTACTTTAAAGTTAA GTAGCTTAGCCTACTTGATACTTTTTTCTCTCTCTCTATTTTTCCATTAA ATTTTTGTACTACAGTACAATAATGCTTCCTTTTTTCGTTTTATTTTGAA CTCTTTCTCATCTCATCACGTCAAATTTCTTGTGTAACGGAAAATCTTGT CACGCACTCAGTCACATAGTTTTGAACAGACAGTGTTTGGATTTTTTGAC AAGTAACTATTTTTTTTGCCGGCAGCTTTTTTACCGACGAGTTTTCTAAC GATATTTTTATGCTAATTTTGAAATTAGACTCGATGTAATTCTGGAATCA TGGATTCTCATTTCCTGAAATTTATTAGTTCTGTCACGTCGACTTCAGAA AAGGAAGCTTGGTCATAGACATTGGTGCTTGGTATGTAGCAACAGTAATA TGGTAAAAGTTGAGATTTTCACATTCTAGAGTCTCTCCAAAATGAGCCGT AAGCAAGAATAAGTTGCAACATTCTCTTTAAAAGTGAGGAATTTTCTTTG ATAAAAATCAATAAGAATTTTCTGTTCAATCTGGTCAATAATTCGATAAG ATTGTATTCATTGACTCAAACTTCAAGAGGTTTACTCAGAATTTGATTTT TTCAGTTCTTCAGTTCTTGCTGATTAAAGGGTGAAATCGAAAAAAAATGA GCCATTTGTATAACAGCGCGTGATCTAAATTGTCATCTAAAGAACTTAAA TACATAGTATATGACAACCCGAATATTTTTCGAGTAAAACTATGAATCAT TTGTAGCACTAAATTGTCATGTAGTTAACAAAAATATAATGTATACCCTT TCTAGATTTGAGGTGCTTTGTTGATGGTTTTTATAAGCAAATCAACTAGG AGTGCGAACCTTATGTCTTGCCGCGGTTTAAAAATTGGAGTTTATCGAGG CCCCAAGCGGTTTTCGTGATGACGTGGTAGGGACTTTTTTGCAGCGTGAT TACGTGATTTGGAAATTTTTTCTTTGTGATTGCGTGATGAGAGGTCAAAA CGTGATCGTGATTTGAAATTTTTTTGAGCTGTGATACGTGACTTGGACTT TTTCAAAGGGATGCGTGATTGTCCATTCTTTTGCTAATTTGCGTGATCGT GATTGAAGACAAAAAATTGCGTGATATCATGATCAGATATACTGCTGGGG TGGGACTCTTTATTAGAGACCTGAAACTTTTTGAATGAAATAATATTGAC AAAGATACGAGTTTTCCAAATTTTGTCAAATTTTTTCTCATTTTTAAAGC AATGAAATAATGCACCCAACGAACTTTTTTTTGCAACTAGACCTGAAACT GGCAATATGTGAAAAAGGTACTCGGAAAAGCCCCGTACCACTCTTTTGTC ACGCGTCCCTTTAATTCAAATCAAAGTAAGCGATACTAGACAGTACACCT TTTCGACAGTAGTCGCGCGGTCAGGTGCGTGCCACTTTATTATTTAATTT TCCCCCTAAACTCGATCCAATCTTTTTTTTACACATTTTTCTATCGTCTA TTTGTGTGAAAAAAAGACTGGGACGGTTTAGGGTGGTAAAAGGGACAAAA AAAATGCCTGCACGGCAATTGGTGGCTACGATCGAAAAGGTGTATTCAAA TGGATAGTGAAATTCTCCTTTCGGAGTGTTCTTTAGTTTAAAGAACTTTT ATAGAGAATTTATCAAAGCTAAAAAGCTGGAGATTTCTTATAAAGAACTA TTTTCATTATGGCATATCATCATCATTTTTGACTCACAAAGATTATTGAT GAAATAAAACCTTTTAGTTTGAACATCGAAAAAAAGGGATCCGAACTTAA AACGTATTTCGTGGGTGTAAGCGATTTGACTTCTTATGATAAGATAAAAA ATGATTGACTTTGTATATTATAACATTTCATTTTTAAATTATGAAGGCAT TGATTACGTCAAGATAGATGATATCTTTTTCGGTCATGTTTTATTGGTTA GTATTGAGATGCTAGTAGAGGGTAATCAGTACCGAGCTTATGTATGTGGG TTTTTCTGCGACAGAGACGGTAAGGTTCTAATTTGACTAGATCCTGAACA ACTGAGGACGACGGTAAATCAGCACTTTTACTGTCCTCGATATTGTGGGT CAGAACTGCGGGTTATTCCAAAACGCTTCAGTCACTCTACCGTCTTCAAA AGTGCAAATACATAAACTCGCTAGCAATGCACACACCAACGAAACTACAT CCCAGCTGGCAAAGAATGTTGTTTTAACGTCCACATAACGTTAGGTGGAC GTTGTGAACGTTAGATTAACGTTGAAACAACGTTGTGTGCCAGCTTGGAA GGTTGTTTATTGATGTGCATTTGATTTTTAAAGGGGATTGAATTTTTATC GAATAAGAGAGTGGTGTATGGTACGGAATAGTAGAGTGTCGTTTATGAGT TTCTTGTTGACAGCGACTTTCAATATTATATCGAACAATGAGGCTTATCG AATAGTAGAACGTCGACTTAGGGAGCGGCAACTATATACATCACCGCAAA GATCCAATCTCCCAAGTATGAGGAAACACGTTTGTTGACTGGCCTTTAAA ATGTTTGAGATCTGTAGGGCTAGTATTCCAATATCAGAAGACAACGCATG CGTATTTTGTCGGTTCAAATATCGCACGGAGCTAAAAAACTACCGGGTTT ACAACTATCTGGGTAGACCAAGCTGTAAACAGAAACATCAAAATGAGAAA ATAATTTACAATGGATATCCAGGCTAACGTAGGGCCTGTAGAGCCTTCTA TAGATAGAGATTCATTCTATATGAAAGGGCCTGATCTCAAAACTTTAGGA CCACCAAATAAGATTCTCAGACATTTTGGAATTTGGGCCTTTTGCTTTGA TTTCCGGAATGGCTACATTAGTTTTTTATACTATCAGTTTTTTTTCATTG ATTTCCTCAGTATGTATGGATACATCAGGTTGGATATAATTGAATAAATT TCAATCAAATTCAATAATATGATTGATTTTCTATCGATCGACTTTACTTC AAAGACTTTTTCTGACCTGATGTATTTTTTAAGGGTTCGACCTATTTGCC ACGGAAAAAAAATGGAAGGTTCGACCTATTTGCTAGATGTCTATTTGTTC AAACTTAAAAAAAACATCTGAAAAATAGTTCGAGACCTCTCTTGTTGGCA AATGCCGACACCGGCAAAGAGATCGAAAATGCTCTTATCGGCATATGCCG ACGGCGGCACGGAAACTGTTAAGCAATTTGAGTAAAAGTTTGGTCTTGAT CAATCTAAATATACTTTATTTTGAAAAAACGCTAGAAAAATAATAAAAAG AAACACAATGAACAATGGAGGGGAAGAAAAACAATTGCTCACTATATGGA TTGAACCGAGTAAGTTACGTATTTATTTTCTGTATTTTTATCGCTGGGTC GAGGATGAAGTTTTTCTTGGTCTAATTTCCTAGTTGGTATACAAACATTG TTTCAACGTCCATCGAACGTGATATTGACGTTTTGTGTCAGCTGGATAAT TAACCATTGAGTTTAAAGCCCGAAGGGCTAGAGTAGAATGTCTAATCTTT CACAGGCAAGAAAAAGTGAAGCCACTTATTTCCTATCCAGAACGCGCCTA GAACGCGCCGTAATAATGACGACGGATTGTATCTGGCGGTTCTTTTTTTT TTTTTTTTGGGCTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNTTTTTTTTTTTTTTGAGGACTACATTTTTTTGAATCTAGCG ATAGATTTTAGTTTCAATCCAGCGTTTGTGTAAAAACAACGCGTGGGCGT TCTGGATTGGAAATAAGTTGCTTCATTTCCCATCCAGGAGTCTAGAGTCT AGCCCTTCGGGATTTGAAGTCGATGTAATTTACCAGGCTAGCCTTGGGTG ATTATCTGATTCCATTGCAATTAGATATAGCGAAAAGCTACAATCATGGT CAGAGTATGTTGACACTTCTTAGTATTAAGAGTTCGGGCGAGAAAGACAT TCTCAGACTTTTCTCAGATCGAATATTTTGATCCGTCATCCAAAATGCAG TGCAAATCTTAAGCCTGGTTTGAAAGTTAAGATCCCTCTCTAGCCTGCAG TAGCGTTCCAATACATCTCTGTCTAACTGGAAAATATTAGAACCTTTAAT GCCTTGAAGTACCTACTTAATTTGATGATCACATCTCTCGTGTTACTCTG CTGAACTAATTAAACATTATAACAAGCCAGTTTTCTAAAGATTCCAAACT GGCATCGTATTTGTGGTATTTTTTTATGAAACGTGCGGTTTATTGTTGTT GATATTTAAGCTGTAGTATCAACAAGTTCTCACTTAATATTTTCTGCAAA CACACTGCAATGTTATTTGACTTAAAATTGAATACATTCTACTATTATGC TATCGTTTCATTCATTTTGGAGAAAGTTCTAGGAAAAACCAGTGGTAATT TGGTATGTCGATTTTGTTGTTTTAATAGCCTTAAATACCAATGAAAAATA CTTTTCACGGTAACTATCACACCCTCTTCTCACAGACCCGGTAGGATTTT TTCAACTAGTGGGATAAAAATAACGGACTGAAACTCGATGGGGATTGATA TTCCCATATTTTTAATGGCTGGGGAATTCAATTCAGTTAGGATGGGAAAA ATAGTAAATATATTGCAGTGAGGTTTGGTTTATTTAATTATTTTCAATGG GGACAAAATTCGGAAGATAATTTTCCCAGTAGGAAGGGCGTTCCCAATGG GTCTGTGAGAAGGGGGTGTACTATCAATAACTATCCTTTTCTAATAAAAT CTAATTTTTCCCTTTAAATTTATAGTCTTTTTTTCCCCCAGACCCTTTTT TCCCCAACAAGACATTGTTTTAAGAATCTCACATCTATCTTTTCCTTTTT CATGATTTTCCGGATTCGAAGGGTTTTTATTTCAAGATCTGAAACCTCCT AAAATGCAATAGAACCCGTAGCAAAATTTCGATATCAGTAATAAGATAGA TAGCATGTGTTCAGTGATAAATTCTGAAATCAGTTTATCTCTTAATCAAC AACTCGCGTCGGCCCCTTGATCTTTCTGTAATTTTATATATTTTTATGTA AGAATAATAGTTAAAGAAAATATAAATGACTTAGGATTTGGGTGGATTGG TTTGCGAGATGGTGGGGTATGTACAAGCCAAAATCTCTTAGAGGGATTTG CTCAATGTTCATGTATATCTACATGTGAATAAGAATTAATTCATGAATCT ACATCGAGGGAACTGAACCACATGAGTGAACTTATTATTGTAATTTCATA CCCTGCAAGACTTTCCCTCGCAGACAAGTCTACCAATGTAAAGTAGACTT ATCACATTTTTATCAACTTCTCTACTCATCATAACTTATCACTTTCTTTA TTAATTTGGTGATAGGTGACAAGTATGTGAGTCGTAGACAGACATTCATT GCCCACTCCGTGCTGAGTAACCAAAAGTTTATTCCTGTTACTTTTACGAC TTTTTGGTAAAGAGACGATATTCGAGTGCCCAACTATTAGCAGATGGGTA GTAATCCCTAAGTCCAACCCCCGGGGAATACGCTCTATCCCCTTCCCGAA CGCAAGAAATACACTTAAGAACATCACCAGCATATTTGAGGTTCTGCCCA TAGTTGCAGAACTTTGCTCCCTTTACGGGCCATCCACTCGTTGCTGTGCT TAGCTTTTGGTCCCGTCATAAACATCTGAAATTCATTCATATAAATGATA CTTAGACAAAATTGGTGCTGGGTATGTGCGGACGGTAAGGGTCGGCTTTT CACCTTTCAAAGTCTCTCTAAGGGTCACCTTTTCAGCAAAAATCAGTCTC TCTAAGGGTCACCTTTTCAGCAAAAATCAGTCTCTTTAAGGGTCACCTTT TCAGCAAAAATCAGTCTCTTTAAGGGTCACCTTTTCAGCAAAAATCAGTC TCTTTAAGGGTCACCTTTTCAGCAAATATCAGTCTCTCTAAGGGTCACCT TTTCAGCAAAAATCAGTCTCTTTAAGGGTCACCTTTTCAGCAAAAATCAG TCTCTCTAAGGGTCACCTTTTCAGCAAAAATCAGTCTCTTTAAGGGTCAC CTTTTCAGCAAAAATCAGTCTCTTTAAGGGTCACCTTTTCAGCAAAAANN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNCCCCCCCCCCCCGTTTGCTGACGTTATGTTATCAAATGT TGCATTATACTAACAAGTATGCTTCCTTTCGACCAATCCAGGTATTTTGA TGAGCTTTTTGACACGAGAAAGAATTCTGAATTTAAAGAATGATAACGAG ATTAGGGAGGAGCTTTAAGATAACATGACCACGTTTCACTCCTTGTTAGC TGAGATAATGATTTGTACAATTACTTGGATATTTGTTGGAATTTTTCATT CAGGAACACTTTCAGTAAAAAAGCTTTCTCCTTATTGAGAGCAACAAGGA GACACCGCTGGTCCATATATGGACTTGTATATATACAACTACTTTCTCAA GGTAGGTCTAAAAATCTTCCAGTCCTTTTTTAAAATCGTCTTTTCTACTA CTGAACCAGGAGGAGCTTTAAGATAACGTGAACATGTTTCTTTCCTTGTA ATCTTGCCGAGAAACTTGATTGTTAAATCATAAAAAGCTTTTCTGCCAAC TCCAATCAGTAAGGAGCCGCAGCTTGTTTTCCATATATAAAGCTTCTCCG GGTGGACCTTAATCTCACAGATTTTCTTCTAAAATTTTCTTTCCTAAACT GCCGAACAGTAGCTTAGTAGACATGAAAATGAAATTATGGTATGATCATA ATCTAACCTCTTAATCGTTATAATGTTGTTTTGAGAGGCCTCCCTCAAAA GGTTGGCACTGTGGTTTTCTTCTTATCTTTTTGTTCGTCGTATTCAAATT TTGTTGCCTGTATCTCTGAAATTGTGCATTTCTTTTATACTTGTCAGTTT GACTTGAATCAGAAGAAGTATTGACGATGTTGGTGGTAGTAATAGGATGG TACTAAATCGTTGTTCGTCCCCGGGGGGGTGGGGCACTTTATTTATTAAA AACGACCGTAACGGATCCTTGCAGGGCAGAGAAAATTTGGCCAAAATTGA GTAAATTTAGACGAAAAATCGACCAATACGGTGCATTATCTTGAAGATTT TTGACCATTTTAGTGAAAACATGCTCAGATTTACCAAATTTTAAACGCTA GACCTTTTTGTTCATTTCGACTTTTTCAGTGCACTTGGGGAAGCTTGGAA AAAGGCCCCTTATGGGCCGCACGAACGGTAGGATGTTTTCCTTGAGTGGC CCTCGGGGGTTCGTTTAACCTCCCGGGGAATCACCTAGAAAAATAAAGAG TACGGATATGTTTCGTCTTTAAGGGGGGTCGAACCTTTAAAATTCCACTA AGAAATGATAAAACATAAAATCTACTTTCAATCTCACCAAGAGCTGCAAT AACAGAAAAGAACCCCAATGTTTGTCCTTCAAAAGGCTGCAATTCGTAAA AAAGTCTTGATAAGGGACTATAAATGATTTTTAACCGCTCAGCTGATAGG AAATCCGTGTGTCCTAATTTTATTCTGAATTTCACATTTTCAAAATCCAT CACTTATAGCTTACCCTCACGGACTAGTCCTAAATTCTGACCTTAAAATT GTCGCAAAATTATTACTGTAAACTTAAAAGAAGGGGAGGGGGCAGAGTAA CTCAACCTATTATGAAAAATTTATATATTTTCAATATTTATCTTCTACTA CTTGCAAAACTCAATTGAAAAATGTTAGTATCTTAGCGAGGGTATGTCAC TGTTGTTTACGATAAGCAAGAATTGAAGGAGACGCCGAAACAGTGCACAG TGTTAGGTGATAAATATTATTCAAATACAACAAAAATATTTACAAAATTA CACACGAAAAATTTATTACGATGAGAATATTTAGTGAGCAATATGAATTT TATGATACTGTCTGCATATTATTTTATACTTCTAAGGTTTTTGTTTTTTG GATTGATTTTAATAAATATTTCCAATAAGTAGGGATTTGTTTATGATACA ATTTCACTGTTATTAGATAAATTGTTTTTAAATGCATCGACCTCCGTCTA AGTGGTGTATAGCAGTTCAACTTTCCAAACAATTCAATATCTGATTATTA TTACGTGCAAAGACCGTGCGGGCTTGACGGGGTGCCGGTATTAGCTCTTT CCGATGTCGGTGGTTCGGTATTTGAAGAAAACAACGTCAATATTTTGGTG TCAAAAGTCTTACCCTATATGGTGACAAAACAAAGATTTTAGCTTTGTTA CTGTCTGTGTTGACAGTGATTAAATAGTAATGTGTCGGTATCTCGGTGTT GGGGACACCATACGCTCACCCCAAAGTTGTGTAGCTAGGTTAAAGAGGTT TACGATTCAGACTTTCTGCTGAGATAATCTAAGATATGAAACTGATGCTG AAAACCTTTAAAGCTACTCTTACTTAGGAGTACTTGATCCCCTGGGGTAA AAGAGTTGGCGGATAAAGGGTATGCGTGGATTGGACCTCTAAAAACCGAC CCTTAGAGAGACTGATTTTCGCTGAAAAGGTGACCCTTAGAGGAGACTTT TTCTGATTTTTGTGACCTTTAGAGAGACTTTGAAGGGCTAAAAACCGACC CTTACCGACCGCACATACCCAGCACCCATTTTTGCCTAAGTACCCCCCCC CCCTGGGTACTTGACCCTTAGACTGTTTTATTAATCAATCGTCAAGATTC AGGCTTTGACTCATGCCACCAAAAATAAGGTTTGAAATTTCAACTGAATG GTTATCAGGTCTCCATAATGTCCCATAATAATATCTGACATTGTAAAATT CTTCAGCGTTCAAAACTTCAACGTTTTTGTAAACCCTGTCGCCATTCATC CATATGTTTAAACGAGTTCTAGATCTTTGTGTGACTTGCATTTTTATATC GTATGTCGTGTTCAATTCAATAGGATCCGACCATAATTGCATAAAGTTGT CAGAGGTGCTGTTTCCATATAGGGTGAATTCGATTTTTCCTTCTATTTGG TTGTAAGCAACTACTGGCTGCCGACATCCGTATTGGTCTAATGTTGAGTT GCAGAATTGGATAATACCGTGCCATTTACCACCATCATCCCGACCATCAT TCATGATCTTTCGATGATATAAGATTTTGACTGAAAATTGTATGTGCCAT GATTTAGGCCAGCGTGGAATGACACCGAGTTGTATCGCGTTGTTATAGGT TACAGGCTCTGAAATAAATCGTGAAAAGAAGAAAAATGGTCTATTTCAGA AAAATTTGTGCATGGGGAAGTTGAGGAAGTCATTTTCGGGAATGGATTTT TTATTGGATTATTCATTTCCATACCACCCTGGACGTCACACTTCCTCAAC ATAGGGGGTACAGACTATATCTGGAATAGACCAATACAAAAACTCGAAAT TTCAAATTAATTTTAAGTACAATCATGATTCTGGAGTGCTTTACTGCTTA AACAAATTGATGGTAGACTTTTTCAAAATAGGGTACAAAGCAATAAGGTA TGTCGGAAGCTAGAGTCGAGCCTCAAAAGAAGCATACACGCAGGGGGGGT GAAGCAGTTAGTACAAGACATCATGCCGGTTAGTACCGTGGTGGTGTGCC ATATGAATTGGATAAAATCACTTAGTACTCAGATGTACTAACTGCAAAAA AGGGTGGTCCCCTGCTAAAAATTTGCCAAATTTTGGTACTAACTGTGTAA AAAATAGGATTTTGTGAGAAAATTTTAAAAAAAAGACCGTATTTTACCAA AAAAATTTTTTGGGAAGTAGATTTTTTTTTTCAAATTTTCAAAATTTTTT TTATAAATCTTAAAAACAATATGCTGGTTGCAATAGAAATTTGATTTTCT AAAATGTTGTTTTTTCCTATTGAAAGCTATGGAAAATTGAATCATTTTTA AGATATTAAATTTTATTTTATTTGATTTTATTGAATTTATGAAGGTCAAA AGCCTTTTTCAAGGCTAAATTCAGTTAGTACTAACTGTACTAAGTGTACC AAGGTGGTGGTGTTACTAACTTCTTCCGAGAAAGCAGTTAGTAGGCATGA TGTCTTGTACTAACTGCTTCACCCCCCCCCCCTGATTCACGTCTTTTTCA TAAGAACATCCAAAAATTTTGAACCCTTCAGATATTCTTAACTTTTTGAA TTTCAAGCCTATAAATGTTCTTAACATGTTCATTTTTTGAGTATTTTTGT CCATTTTTCTATGACATTCGGTGTCCTAGAGTAATCAAAGCCTTAAAATG TTCTTAACTTGTTCTTAATATTTTGGCCATCGAAGCCTTATGTATGTTCA TATATAGTTTGTTTTTATAAAAAAACGTGTACTGGCTTCTCATATGAAAA AAAAGCTTACCTTTAGTCCTGTAAAACAGTAGTTCTTTGATCGTCGAGAC AACATTACTCTTCCAGGCATTCAATTTCTTCGAAGCATACACTGTTATAT CCTTAAAATAAGTAGGTTCCCAAAACTTGATTGCAAAGCTTCTCTGGTAA ATTTGATTCATGAACAACATCAGCTGATATGTACCATTGAATCGAACAAG ATTGATATCAACAGATACCCATTTATTAAGTGGAGCTTTATACTTTCCGT TTAACCATCTTTTACCAATTTCACCGGACATCTCCACAAAAATAAATCTC CTCTGAGATAAACCGATCTCAATTTTTCCTCGTCGTCCAATCAGATCGAA TGTTAGTATAGAAGAATGTGAATTTGGTTGATGATTGGAAAAGTAGACTT TGAAGGATAATTTCCATTGTTCAGGCATGTAGGGAAGCTCGTGAATCACT TTACCTTGCTCACAGATAATTTCTAATGCGAAAAAATTAATTTGAGATCC AAACAGACTGCAAGCCATTGAGTTTAAGGCCGAAAGCTAGAGACGAATCT TATCTGAAGTCTTAGGATTTCCGCCACATTTGTAACGTCGAATTGAAACC AACACTTTCTTTATTTCCCCGTATGGTATATTTTTATAGATTTAATTTCA ATCTGGGGTTTATGTGAAAAACACGTGTTTCAAACTTTTCAGATTGAAAT AAATGGCTTCAATTCCCATCCAGGAGTTTCCCACTCGGGGCTTTGAGCTC AATTCCAAGTATGGGAGAGAAAGATTCTCAAATGAAGAAAATTATTCATT GGATTTTGTTAGCCACGACCTCGACTTTAAAAGCTTGAATTTAATAATAA TTTAATGACGATTAGGTTCATACCTTCAGTTTTGTTTATTGCGTCACCTT TTGATACGATTTGTGTTTGTTCTGCCTAGAAATAAAAAAATACATAGTGT CGGAGTAAAGGTACTGCTATACTGGATTTTTCGACTTAGGAAAAATAAAA TTTCTCTTCTCATTTATCCTAAAAAATTTAAGCTTGTTTGATTCAGTAAC TAGGATAAATCTGCTGCTAAGTTGTGACTGATTAACAGTATTCCACGGCA AACTTAAAATCCGTAAATATAAAAAATCTTTAAAGCGTCGAAAACACTAT ATATTGCCATTAGCCGTGTCTAGTCTTGTGAATATGTTAGTTAACTAAGC CAGTCCCCAATTGAGACTTCGATAGAAACTTTCATCCCCACTGAAGGTTG GTTAGAAATTCTCATCAGAGCTGTGAGACAGGGGTGTGATTGTGAAAATA CAATCCCCTTAGAGACTGTTCATCTGACGTTTCCAAACCATCTAAAAAGA ACGACAAATAATTATTAAAAATCGAAAAAAAGAACGACAAACCCTAACCC TAACTATCAAAGAACGACAAATTTAACCATCCCAAACCCCCGACCTTGGT CAGTGACTACTACCCCTAAATATTAATTTCTTTTTGTATTTTACGCTATT TAACAACTAGCGGTTTAAAGAACGATAAATTACGCATGTGTATAAATATC TATTTGGGTGGACATTAGATGAACTAACTCTTACCTCCTTTTTCTCATAA TAAACCCATCCATCAGCTTCGACAAACTCTCTGACATCGCCATCACGAAA ACTTTCTCTGTATAAAATACAGACTTGACTATTTTGATGATAATTTGCAG ACCAGCATTCTGTGTGAGCTGAACAATGTATAACGCACTGACCATGTGTT TTAGCTTGATCTTGATGTAAAAATAATGTAGTGTTTGGTGCCAATCGTTT GTTTTTTAACGGTTTTGCAAATTTGAAATTAACAAATTGTGTGGAAACAA GTTTCGCGAATGAGAGCGATATTATGCAAATTATTTTCCACATCACTTAT ACGCGAGATTTGAGTTTTACAATTTGACCAAAAATCTTTCTTTTTGAGCA TACCCTATTTTCCTTTCGAATAGATACAATTTTTATTATTTTGTTCCCTA TTTTATATTTCTTTAATGAAATTATTTATTAATTAATAACAAATTTTACT CATTGGTTCTGAATAATTTTTTTTCGAAAATATTTTGGGATGATTCGCCG AGTAATGTTTTTATATTTTTTTGAAAAGCAATTTACATTTAATTATAAAC AAAACTTAAGTTGAAACCCCCTCAGTCAACTAGGATTATATTTTCAGCCA ACACAGTTAGGAGTAGAAAGAAAATGAAACATCCCTATAAATAATATTTT TCACAAGAATACTTAGAAATAACAAATTATATCACCAACAATTTTTGATC TAGTAAATATTAACCAATCAATTTTGTAACAAATTTAAAGAATCTTTTCA ATCTATTTTGTACCTCTTTAATTTTTAACATTGTCTCAATTCAATTTTTT TCTATAATTTAGGTCTACAGATTTCAAGCTTTTTCTCTATTTAACAACAG ACGCCGCGGCACCGGGGGGCCAGTCGGACCACATTTTTTCTCATTTTTTT GCTAATCAAGCCAAATTTTATATTTTTCACTAACCCCGGGACAATATATC CTTCACCGCCCCCCCCCCTCATGTACAAAAATTTTTCTTGAAGAGCCTAA TTCATGTTTCCGTGATTCGAATTAAAGCATTTCATACCCCCTGGTTTAAT TGACTCTTTGTAATTTTAAGCGAACTAGAGAGAGATTCAAATAATAATTC TGAAATACACCGTAATTTCATCCTCGTTAGGGATTAGAAAACAAAGTTTA TTACGGCTAAAAAGATAGGATTCACAAGGCTTAAAGAGCAAGAATTTTCT CAGCCCCATTTAGCTCCAGCCCTTTAATTATGATAGTTGAATATATAGAT ATGGTTCTCACAATTGACCATATCACGAAATTTAATATCAAGTTGGAAAT AGTTTCAAATTATATTACATACAGTATCAAAATGTATGGAGAGATACTCA TGCTGAGTTTGAGTTGAAATAAAATTGCAAACGTCTTTTTTTGTCGTTCA TATCTCTCTTTGAAGTTGATGTAAATGGAAAAGTTTATTACTATCGTTAT AATTTTTTATAAGAACAGTTCTCCTCAAACTTCTTTCTCCACCAATTTGA AAAGTTTGATGATACTGCTTGGTGTATCGAAGTTTAAATGTCCTGTCTCA CAAAGCCCCTTATATCCATCGATAACAAAATTAATCTGAATTTTTATTCC CCGCGTTGGAAGAATAACCTTGAAAATTCCGCCTGGAAAAGTGCTTTAAA CAATAAATCTTCAAACTCCCTAAAATCAATACTTCTACATCCCGCACCAT TTAACTCCTTCTTCTGTCCCAACTGGCTGATAAGATCTGTAGCCGGTTGA CAAGGAGACAGAAGGTGTCCTTATCTATAGATTAAGGAATATACATAGGA ATAGATAACTAGCATCCAATTCAGATACATTGGCATTTAGAGGATATTTA ATTGAGAGAAGAAAACTTAGGTTCAAAAATAAATCAAAATAAATCAACTG AAAATCTGATTTTATTGAATAACATTTTCATGTTGGCAAATAAATTTCGA GTAGAGAGGATTCACCAAGAAGAAAAGCGACCTACTTTCGTTCAATGAGA CTTTAAAGCTCCATCAGCAATTTAGTGGAAGTTCTCAAAATTCAAGCTCG TTGAAGTTTTCTGATGTGGTGTGATTTAAGGTCGTTTTCTTGCGTTGGAG AGCATTTTGGAACTTATTTTAAATGAAAGTCTAGGCAATCAGGTCCATGA TATAGGGCTTACTTATGACACTTTATCAAAGCTAAAAACTTATACATGGC ATGATGATATAGATTTACGATTTCAATCTCGAGTTATAGCAGATTGAAAT TGTTCTTAAAAGAAAAACTTCTAGAAATACTTTTGGATATTTTGTGTCCC TCCCCTTTATAAAAATACGTTATCAAAGTGTTTTCTTAACGTTTTTGTAT ATCGGTTATAAAAAAAGTTTGTTTTTAATATTGGTTGATTGGTTAGAAAA GATTAGTCCTGTAGTTTTTATAAACCTTGTGAATTCGTTTGAAGCTTTTT GCATGTTATTTTTTCTTATCCCATAAAAATCACGATTTTATGGAAACAAA TGATGTCGGGAAAAATCTGCTTGTTGGGTTACTGGAAATTGGAATTAACG ATGAAAAAAAATTATAATCTTGACGGGCATATCTGATGTCGGGTAGAATC TGCTTGTTTAGATGGAATGAATATCTATGAATTTAGCAAAGACATTGTAC AGCTTAACATTTATATACTCAGTAATTGCATGTTTAAAGTAAGCTTTTGT CCTAGTTGACAAACAATATTAATGCAAAGTTTATGCCTAACGTCCTTTAT GGACGTTGAATGAAAGTTTTTATGACGTTCTGTTCTAGGTGGATCAAAAT TTGAAACATTTGAATACTATTGGTCTTTCTTTTGTGTTTTGTTTATTGCT GATATTCATGATATGCACCATTGCAATGTCTTCCATTCCACCCAATAGCT GATTGGTTGAAAGTGACGTATTGACTGATTTTACGTCACTTACAACCAAT GAGCGATTGGTTCCGTGATGTAATGTCAGAAGAATACTAGTTTCGTTCTA TTTAGAATTTAGAATTAGATTTTCAGATTTTTTGGCTTTTTTCAATTGCA TTTAAAGTTCACACTTTGCATTGTCATGTCCTTATTTGAGACCTTTACAG TCTTTAGGAGTACGGATCCTTTTTTGGAGCGCCAGTGGCACAACCTCAGC GTCAAGATCCCTAGAATCTCAGGACCGGTGGAAGCGGGGAAACTAGGGAG ACTTCAGCCTCTCCACTTTTGAGCAAATGAGATTTGTTCTCGAATTCCTA GCGAATTTTATCACATTTTGAGCCTTCAGCCCCCCACGTTCACGGTTGAT TCCGCCGGGCCTGAATCTTCAAAAGTATTGTCTGTATTTCTCTTTCTACC TACGATCTATCATCAACGTGATTTCAGTATTTTTCTGGAGATTATCCTCA TCTACAGCTCCCCTCAATTAAAAATGTCATTTGCTGTAATTGAGCTTTTG ACGTGAAATGGTTTTGCTAATTATTGATTTAAATTCCCATCTTACAAACT AGATTATACTTTTTGCTCTCTATCTATTTTGCTTTGTACTATATCCAACA GCATATTAGCCGTTCGTTGAGGAAAATCTGTCTGTATTTGTGTGTCCTTC TACTGTCAAATAATGTAACGAGACTGAAAACATCACCGTGAATTTTGAGG TGAAATTATCGGTGAAAAGTTATCTTTCATCATAAATCCTTGAAAGAATG GGACTTTTTAACGATTTTTCGCCCAAAAGAAAAAAGGTGATTTTTTCCTG TGAGAGTCAAAATTGGTAGCATTTTCTCGTCGTTTTTGGTGTTTGATATA TAGGAGATATCAACAGCAAAAGCAACAAAACGATTTTTCAATGTTTCGTT GTTCTACGTTATGGACGATACTTTGATGTTTTTTGATGACGCACAACTTG GTGGATTCCGATATTGGTTGACTGATCCGTTGAATTATGATGTTTTGGAA AATTATCATCTCCGTATATTCTTGCAAATTGTTCATACCAGTCCATTGGG AAAATAAATAAGGCTCGATTGTTCTTAATTTTTTATACTCTTAGCCTCAA ACGTTCTCATGTACCCTTTTTTAATACTTCAACTCTCAAATATCTTACTT TAAACTCAGAAATTCCAGTCTCATGTTTGTTCTTAAATTGCTCTTCTTTT TTGAGCTATGAGCCTCGTTGTTCTTATGAAAAAGGATAGTTTTAAATGAT GATTGTCAATTACAATGTAAATTGGTCACGAGTCAATTTTTCTTATCTCA ATATCTGATGCTATAATTTAATTTGATCAGATGGAGATTTTTTGATATCA TCTCTCGTTGTTTCAATCTACGTTTGCTTATGTTGTGAATATGCAGAGCG TTGGTTGGGGGTGGTTGAAGATGCAAATTGCCAATTGGCACACAAAGCGT TGATCTAACGTTAATCTAACATCCATATCGTCCATTAATGTTGTCTTTTA CCGTTGAAGCAGCAATGTGTGTCAGTTGGGCGAATTGCAAAGAAGTTCTG TGACACCTGGGCTGGGTTAGCAAAGGTGGATCGATTCTTCGATCGATTTA AAAGTGTGCTTAAGAAGTAACCCCCCCCCCCCCTNTTGGGCGAATCGCAA AGAATTTCTGTGACACCTGAGCTGGGTTAGCAAAGGTGGATCGATTCTTC GATCGATTTTTAGTGTGTTTAAGAATTAAACCCCCCCCATTAAGTAGATT GAATAAACGAGTTTCTGAAATTTCTACTTATCTAACTTTTCCGGTTCGAT CTTCCATTATTCGACTTGCATTTTGTATTGCGAACTAAAGTCCCTCAACC TGGAAAATCTTGCGAAATACTTATTTAGAGACGTATTTAAAGTCTATTCA CGATAAGTGTGCACTCTTTTTTCTTTTACCTATAACTTTTGAAGGAATTC TTCAAACTTTATAAATTTGGTATCGTTGGAGAGATATTTGTGAGTGGAAC AATTTGAAATAAAACAATTTTCAAAAAAATTCTAAAAATGAAGATGAAAA TGAAGAAGAAAAAAATGAAGATCTTGTAGAAAAGTGCTATAACTTTCATT TTCACTGGAGAGATTCTTTGATCTTTGGAGGTTATCATTGTGAAGAAATT TCACTAAAATATTCATTCAATACAAAGTTATGATACAAAGTTAATAAGTG ATTGACCCCAAAAAACAGCAGAAAACAGCAGAAAACAGCGTTTTTAGACN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNATAATCAAGGTTTCACTTCAGTGAAAATGATAGT TATAGCACTTTTCTACAAGATCTTCATTTTTTTCTTCTTCATTTTTATCT TCATTTTTAGAATTATTTTAAGGAATTTTTTATTTCAAATTGTTCCGCTA ACTAATATCTTTCCAATGATACCAAATTCATAAAGATTGAAGAATTCCTT CAAAAGTTATAAGTAAATGAAAAAAGAGTGCACACTTATCGTGAATAGAC TTTAGAGTACTACAGTATATAAGATCGAATTAGATAGAGAACTGTATTGA GTTTGGACGAATATCTAGGGCTGTTTAAAGGAGAGAAGTCATGGGAATAT ACTTCACTTACAAGGGTTTGTTAAGTGTTTTGAATCTGTGCTTAATTTCC AAGTACAATTTGTATCAAAGAGCCTACAAAGACAGGATGTCTTGAACAGA AAATCAGATTTGTAATTTCATTGAGCCAAGCAATCTAAATTTTTATGTTT CCGTCATATCAAAGAATTTAGACAACCCTGTCTGAGGTGCACCTATCATT TGGGCCCGTTGAAAGCCCCAGTGCAAAAGACCAGTCAAATCTTAGAAATA TACGGTGAAAATGGTTCAAATTGTTGTCATATGTCCTATTTTTCCCTGTC TTGACAGTATTTTTGAATAGTTTCGAATCTTAAACTTTATATTTATTACA TTATAAGTCAAGAAAGCTATAAACTTTTGTGGTCCCTGAGTATTTTCCTT CATTTAAAAACATAACAAAATGCTTGAAGAAAAGAGAAAGCTTTAAGAGG CTATCAACACCAAAAAACTGTCTTCAAAAGTGACCGTACTTTGATAAGGT TGATAGGCTTGATGAGTGGTTTTTCTACTGGTTTTCCTTCATTCAGCTCT TAAGAGTTTTTGATGAGTGTCTTGAAATGTCCTGTGATGTATAGTCTTGT TTTGGTTGGTTGGATCTATCAATGTAAAAAATAATTTAGGTAGCGGGCGA AATATTTTTGAAAGGAAGCAGCTAAGGGGATGCTGATGCTTATTTCATTT GACGACTTTCGAAGAGTTAGGAATGTAAATGAAGCCATTCTATTGGTTAC ATTCAAGTGTTACGTCACTTCTACCCAATAGAATGGCTGCGTTTCTTTTC GGAGCGAAACGGAACCGTCACGTGCGAACATGGTCTATAACATCAGCCAT CTGGCACGCAACGCATTATTTGACGTTCATCTAACGTTTTTGTAAACGCT CTTGGTATTGGATAAACGTTGCTTTGTGTCGAATGGGCAGGAATGGTCAT TTAGGGGGTGTTGTGAAAGATAATGGGCTTCAACACTAGCTCATTAAATC ACTGATAAGTAGAAATGATGGTTTAGCAAATCTAGCAGTTTTATCTTTCT TGACTTATTACGTACACGCTTTATTTATAAGAATATCCAAAATTTTTGAA GCCTGTTCGAGATGTTTTTAACTTTTTGAGTTTTAAGCCTAAAAATGTTC TTAATATGTTCTTATTTTGAGTATTTTTGTCCATTTTTCTATGAAAATAT TCTTAACTAATTCTTGAACATTTTGGCCATCGAAGCCTTATGTTTTTATA TAGTTTGTTCTTATAAGAAAAAAGTGTATTCTCGACCCGGTGTTGTAATT TTTCAAAGTTGAAGCATTCCGACTCAAAAAGTTTTAGAGATTGATCTATT AAAGATGTTGTACAATTGACAATCTTCATAAAATGATTTATCACCAAGCG CGATAACCTTTTTTTACCGCGCTCGATTTTTAGATGACAAACTTCTTTTT TATCGATTCTGACATAACAACATCAGCAATACATTATTTCCCTCTCGTTT TAATCTCTACTCTGCTTTTCAGAGATAAGTTGGTATATAATCTTGAAAAG AATTTCTAATTGCCCCTTACAAGGATCAATTTCTCAGAGTGATTTACATT TTGTTAACGCTTGTAAATTTTTCTGTTGATTTTCATGGATNCTCAGAGTG ATTTACATTTTGTTAACGCTTGTAAATTTTTCTGTTGATTTTCTTGGATC GAAAGTTTCGAGTTGTTTTAAGAGTGTTCAACTGGCTTGAAACACTGTGT TTTAACGTCTATCTACCGTCTTTGAATCTAACCTCATATGTTTTAGTCGC AAATCACGTTGTTTCAAATTCTACCTAATTCCTATAACATCAATAAACGA ACGTTAAAACAACGTTGCTTGCTATTTGAATAGGTGCGAGTTGGTGTTAA CTATATATTTTCGACGAATTGAGCTTTTTTCGATATAAGATTCTTCTAAG TCTTTGGTGAAATCTAGGTTTCATTGGCTTGTGATCATAACTACAATGTA CAGGTACAAAAGGATGCTTTTTACGTCTTCAAATTGAACACAATTCTACA AAATTGGAAAAATCTTGCCTAATTTGTTGTTTAATATCAATTTCTGTCAT AGAGGGAGACAAAAAAAATTGCTTTGACCCACTGTAATTAGCATTGGTGT GTCCACTAAATTCCACAATTCTGTTTCTAAGTAATGGAATGTGACCGTGC TTTTGTAATAAATTCACAAAATATCACAAAAAAGTGGCGTAATACTTTTC ACTGTTAGCTTGCTGATAAATTCGCAAGAAAAAATTATGGATATTTTTTT CATATTATGGTTTATAAGGATTGCCACTGAGGTTAGTTTCCTGTTATTTG GCTCAGGTTTTTACTTTTTTTTCTCAACTGATTTGCGATTTGGATTTTTG CTTTTTTGCTTAAGATTTCTAGCATATTTGATATTTAATTTTGAAACTTT ATTTCAACTTCATTTTTATAAGGTTGGGATTTACACTAAATGCATCTCTC TATTACGGGTTTCGAAAAGAATCTGACGTGCTGGAGTTTCAAAAATATTT GAATCGTAGCAAGTGTATTTTTTATGAGAGATGATTACATCTATAGACTA AACTTTAGTTCCATTTTCGAAGTTTTGAGAATTTTAAGTAATAAAAGTTT GAATCGCCGATAGTTAACCTGATAACAGNCGAATTAAAGAATTTTAATTA ATAAAAGTTTGAATCGCCGATAGTCAACTGTGACCCGTGAAATGATTTGT CTTCCAAAGATATTTTTAATTATTGAATGTGTCTTAATGGTTATGGTAAA ATGTTTGTAATTTTAGGAACGACATCGCTTTAGTTCGAGTAATGGCCCCT ACGTGGAAGAGGTTATTTTGTCAGTTTTTTTGTCAAAATTTCTTCCGACG GTTTGATGGATTTTGTTAGTACACATCTTACAGGCAATCCCTGCATGATT TGTTTAAAGACCACGTTTACATGCTACAGTTTTGGTTCGCTGCGAAACGA AATGAAGCCATTCTATTGGTTACATTCAAGTTTTACGTCACTTCTAACCA ATAGAATTGCTTCATTTTGTTTCGGAGCGAAACGGAACCGTTACGTGCGA ACATGGTCTAAAAAAGAATGAATTTTAAGTTTTGAGGGCATTGTTTTAGA AATTCAGGACAAGCTACTGTGCGATATTTGATGATAACTATCATGCCTCA ATGAGTATACTATCAAACCAAGTTGTATCACATAACTTTCCTCGACTTTA ATTTTCTCTTGTCAATGAAGCTATCAATCGGTAGCAGGACAGTCTAGATG TGGTCAAAGAAATGCATTTTAAATAGGCTTAATACCCTCTTAAACACTGC AGAGTCATTCAAATCCATTGCCGTGTGTTAGTTTTATCTAAGAACCTTTA AACACTCAAAAATCGAGATGTGAGAAGTCAATTTTTTCGCATAAGTGTGT TGTGCATGTACAAAGACTTTTGCTAGATATTTAGTCATTGACATTTAAGG TACTTGAAAGTTATTGATAATTAGTTACGAGCCATGCCATATAAATTGAA ATTCTGACTTTTCTTTTAAAGTTCCGACCGAAAACATATTCTTATAACAA ATCAATACTTTGATGTTAAATGAACTGAGTCAATTAATTGATTGCGATGG ATTTGTAAAATTAGGGATACTGCTAATTAAAGGCCTTTTTGATTGCATTT ATGTATGATAATTTTGTAGTATTTGAGGAAAATCGAATTTGAAAAAGTTT TGGAATCTTTTCGCAATGCAAACGTTGTTACGCCGTGTTCAATGTAGACT AGCAAACTAGTCTGTTAATTAATCATGTCAGACGGTGGGAACATAAAGGC GGGTGGGCGTTTGTTAGAATAGGAGCTGCGTTGGAGAACGAGCAAAAGTT GATGAGAGGCTGCTGATTAAGGACATGTTTTTTTTTTACTGTACCAAAAT CAGGTTTTCAAAAATCGTGAAAATCACTTTATTTTAATTATTTCGTCATT CGCAATAAAATTTTCCCAAAATTGAAATTTGGGAAGGGCTTTAAAATGAG CTATTTGAAATTTCAAAATTCGGAGTATTTCAGGATTAATTAATCATAGA GTGTTTTGAATCATATCTCACTCCATGACTCATTCTTCGGTCCTGAGGAG GTTTCTATGCATTCCTGAGGTAGCCTAAAATCATAAAATAGCCTGAGGAG TAATTTTTTTAAAGGCCGGAGTGAGTTATGATCAAGACTTTTTTAATCAT TTTTCACTCATTTTAACAATTCCCGTTTTCTTTAGTTCGTTCCTTTCTTA TCAACTAAACAAAAATCTCAAATCACCTCCCCGATAGATGGGGATGGATA GACTTGTCAGGAAAATATATACTAAAAATATAATTCTACAATTAGCACCT AAATTCAATCCTTCAGCTACACCTTGATATAAGTTTCGTATATAAACTGG ACACGACAAAGGCCAAATATAGAGCCGACTTTATAAATCCGAAATAGACT ATGATTTTTTTCATCCTGAAATACTCCGGATTCAACAAGTTCCATAAAAG CTATTAAGATCGGACAAAAAGTATCGGACAGAGCTACTAATCTATTTTCT TATTTTTGAATAACGATAAGAAAGGGTTTAGCTGTATCTGTTAGTGTCGA TTTGAACCGGGTTGGTTGAAAATCGGCATTTTGGTACAGTAAAAAAAAAC ATGTCCTTAACAGCCCTTGCCGCCAACAAAACTTCAGCCTACGCTTACCT AACTCCTACGCTCACTTTTCCCGCGTGATACCGTTCTAGCCCGACTGGCG TGCCAGTTTATGTTTAATGTGGATGTGCATGAAATATGCGTTTTGTTGAT ATCTTAGCTTGAAAAGGGAGCTTTAGAGGTCGTTTAATTAACCTTCTCAA CGTCCGATGAACATTGTCTTGACGTTTGACATCAGCTCTTGACTATTTGC CATTTTTCTTTACTTGATGAATTGCTTGAAAGAGATTTTTTCATTTTTTA AAGGAAAATTTGATAGTTTTCACCAGATCTCCTTATTACATATAGGTAAA ACTCAGAAATTCTGTTTCCACTTTGATGTTTTTATTGAATTTAAATGTGC TAAAAATGGGGAATATTTAAGTTTATTTTTCATCTGCTTGAGAAACATAA GTTTTGAATTTTTCAAACTCACGAAAACTTACGTTGAATAATGGGTAAGT AGATGTTTCCTGAGATGATGAACATAGGCGATTTTAGACCCTGTCGAACT TATCAGATAAAGAGATTTGTAATTGTAATTTCATTGTTTTTTAACGAGCG TTGCACTCCTTCGCATGTTTCCGACGTACTTGGTCTATTGTCTTAAATCC GCCGGTGATAAAGGGCTGTAGGATAAAATGGTAAATCGATAAGATATTTT TAGAAACATTTTCTTAAATGTACCTACTGCTGATCTGATATATTCCCATT TGTCCACTATTTCTCTCAGTTTGAACCACAAATGATTTTGTAGTTAAGAG ATGCTGGCTAAATCGATCTGTCTAGTTAAGGTGCAGTCCGCAGTGCTGAT GAGTCCCAATAAGGACAAAATGCATATACTGCTCTGCTACTCAATCTCCT GAATTAATATATTTGGACAGAAATTCTTATTTCTTCACGCATGCATGAGA GGACGGCTGGTTGTAGGTGCAGATATGTGATTCAATGCTGATTGAACCTC AAATTTGAACATTTGAAAAGACTGTCTTATGGGTGGGGATCGCAGAGTGG TGGATCTCAGGGGGTTCAAAACATAAGACGAGGAGTCTTTCATTTCCTTA CAAGGAAGATGGATAAAGAAACACTCTGTATATCTTTCAGTGGGTGTAGA AACCATTTCCCTAGGATAGGCTTAATAGCTTGTTGGTTGCTACATATATG TCAATTTTATACAATCATATTTTTCTGTTTACACGTTTATTTTTTTATAA GAACATCCAATATTTTTTAAGCTTTTGAATTTTCTTAACTTTTGACTTTT AAGCGTAAAAATTTTCTTAACATGTTCTTTGTGTTCGCCATTTTTTGAGT ATTTTTGTCCATTTTTTTTTCGGGAGTCTGCAAAGCCTCAAAATGTTCTT AACTTTCTTAATATTTTGGTCATCAAAGCCTTATGTTCTTATGTAGTTTG TTTTTATATATAAAAAACGTGTATTCATGAAGAGTTTGGAACTTTCCTCA AAACCTTTTACTTCTTGTCGTTATAGAAAAAGACGGTTCAAACAAAGTCC GTGATATCACCACAAATACGACACAACCCAAGTGGGCCATTCACACTGCA GATGATAAAGAGTGGAAAAGTGATTTTAGTGCAAATAACAACTTGGTTTT AAGTCCAACAGAAAATGGTGACGGTACCCAATCTTCTGGATTTCCAAAAG CTTCTTTATTAAAATACGAAATCAGGCATTTAACCAATTTAAAACAAATT GAAGGTCCTGAACAATTTTTATCTAAGAATACGAAAAATCCATCGGTCCC GATTACCGAGCAACGAGAAAACGAAAAAGCCGACGGTAAAAGCGACTCGG AAGACGAGAATATGACCGAACGTTTACGATCAACTCGGTATTCGAGTAGT AGAAACTCGGATGATTTACTCGGCCGTTCTTCTTACCGTTCAACCCGAAC TTCTTACTCAGATGACATTGGTGGATTAACACGTGGTACTAGCGCAGGCA GTAGCCGATACCGTAGAAGCGTACTAGACGACCCGCTCGATACGTACAGA AGTAGCCGTAGCTCGAGACGCTTAGATGATTATACACCAACGACTGATTA TTCAACGACGTCATCTTCCAGATACGACCGTCCATACCGTAGTACCACGT CTGCAGACGAAACTCGCTCTTATCGGACAACGTCTCGCCGTACACTTGAT GATCCGGTTATAGAATCACCGAGACGTTCTCGACGATCAAAAGTGAACGG TATTGACACAGCGATAACGACGACATCTGTTACAGCCACGGTAGATGGAG ACTGTAATAAGTGTAAAGAAAAACAAGAAAGAATAATCCAATTAGAAAAT GATAAAAATAAAGAGTTTGAAAAATGTAAAGAAAAGGATTTAAGAATTGA GGAACTAGAAAAACAATGCTCTAGGGACTCTGAAAAACGGAAGGAAAAGG ATGAACGAATTCGAGATTTAATTAAAGAATTAAAAAATGTTTCCGAAGAC GTTAAATCGAAACAAGAACTGGTTAAAGANAAGATTTAATTAAAGAGTTA AAAAATCTTTCCGAAGACGTTAAATCGAAACAAGAACTGGTTAAAGACCT CGAAAGCGAGTTAAAAACGCAACGTACCAATTACGATCAGAAATTAAACG ATTTACAAAGTTTGGAAAGCGAGTTTGTCGAACAGGAAGAAATTCAAATC CGAATGGAAAAAGATTTAAATGATCGTGAGGAACGAATAGAACAGTTAGA ACATGAAATTCAAGTCGAAAGAGACACGATAAAATCGAAAGAAGATTTAA TCGAAGAATTAACGATTCAACTCGAAGAGCTTAAGGAAACTTTGGAAATG AAAGAGGAGAAGATATTGGAATTGGAAAAAGATTTTGAGAACGCAAGTGT TGCTCTTATGAACGGTATCAAACAAATGGAACAACAACCTCGATCTGGTG AAGATATACACGAACTGGAGGCTCAATTACAAGATAGTTTAGATGAGCGC GATGGTTTTATGAAAGAGATTAAGAAACTCGAACGAGAGCTAAAGAAAAT CAATAATAGCCTGGAGGAAGAGAAAAATCAGACACGCAGGCTAGGAATTA AACTTGAGGACGCAAATTACGAGATCGGGAGATTAAGACAGGAACTTATC AACTCGCAACTGGAGAACGAAAAAATAGTGGAAGAAAACGAAGATTTAGC TGTGGATAACGAGGATTTGATCAAAGAGCGAGATGAGATTATACAAATTT ACGAGGAATTGTATCGAGAGAGTGAACGATTAAAACACGAGGTCAAAATT TGGAAGACTGTGTTCGATAACAATAAAGATAACATTGATGAGGATGAAAT GCGAGAAGCGATGAGCGAAGGTGACGCACTTGAGGAGAATGGGAAGGAGT CTTCAGATGAAGAGGTAAGGAGAATTTGGTATTTGATCTTCCATCTTACG CTTCTATCCATCCTGGATCCTAGTACCCCTCGTGGTTCTTTCAAAAGGGG GAAGGGGAGCTTACTTGATTTATCGATAAAGAAATAGAACAGGAGTTTTC CAACTAACCGGGCTTACCTGTTATACTCGGGTATAATCGGAATCCCAGTT AAAACATTGCAATGGTGCATCTCATGAATTACTGCCGAAAACGGGTTCAC TTATATTCATGATATGCACCATTGCAATGTCTTCAACGGATACAACAGCT GATTGGTTGAAAGTGACGTATTGACTGATTTTACGTCACTTACAGCCAAT CAGCTTTTGGGTCCTCAATGTAATGTCAGAAGACAATGCAATGGTGCATA TCATGATTACTACACTTGAAGCTCTCTAATTCGACGTACTAAGTCGCCAT TGACTTAGCTACCGTAGTACAGTGGTAGAGCATCTGGCTACGGTTCGCAA GGTTGCGGGTTCAACCCCCAGCCGGGTCATACCAAAGATTCCCAAAATGG TACTTGATGCCTCTCTGCTTGATGCTCAGCAACTANNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGCTATCGAAAGAGGA GCCTTCGGGTCGCCTCCGACTGCGGTCGCAGACTTACTTACTTAAGTCGC CATCAACAAGTAGGTTACTCTCCCAGCAGCAACTGTAGTACTACTTTACT ACTAACCAGCGTATTCTTTTTATTTTCAGGAGCTGATAGAACTCGAAGAA GGTAAGTGATTCTGTATTTTTTTCCTATCAAAAAAGAATATTGACCCTTA AAGAGAAAAAAGGATTTCTTAGGTGTAAAAACTGTACTCTTACCGCTCAT AGATACCCAGCAGCAATCTTTCCTATATATCTAAATTCTTGATATGCGAA CGTATCTTTTCTAACGTAAACACCCGAAAAAAGCAGGGATTTGACCCCTG TTTGTTACTAAAAATAGAAACAAAGTGGAAAAAATTCGGCCTTTTTGGGG GCTTTCCTTAGAAAATATGAAGATTAACTCTTTAATCTAACAGGGACATA TTTGTTTACTTCTAGACCAATCATTGCTTGTTCCTCCACGTGATGATATT CGAATCAAAGTCACAGATGTCTCAAAAGCTTTCGAACAAAGTGAAGAAAT TTCAAGGTCTGTTTAATCTTGCAAATTGATGTCATTTTTTAATATTTTCA ATTAGTTTTAGCCAATGAACGGAGAACCGTAATTATCATCAAAATTTTTA TCAACGCTTCTTGGCATGTTCTGAGCATAGACATAGTTCGTTTCGTGTTT TTCAATTTTTGAATTAGCACATAAATTTATTGATATTTGCTTTAGATAGA TAGAGATGATATTTTACGTGGATAGCCCAGTAATCTAGGACTTTTAGACA ATCTTTCGATTGTTTTCACGGGGTCCACGGCCAGCCGGCTCGGCTATCTA TGAACTGAACGTTGGAAGGAGCGGGGATTTGAACCACGAATCCCTGGTTT GAAACGCTGACGCCTTTGACCACTTGGCCATCGCTAATTTTACTCACTGA TTGTGAGTTGCAATATATTGACAACAAAAAGGATCTTCTTGAAAGAAATT ACATAGGTTAGGACGATAGTACATTTTCTCCATCCCGGACATGGGAATTT CGATTCCTCCCGAGAAGTTTTAGAAATATTTTCTACAAGCTGTCAGTTAC ATTTATTTCATTTTAAATCTTTCAGAGGTAAATTTGGTAAAGTATACAAG ATGGTAGCCCGAGCTACGGGTGACACCTACGCAGCAAAATACATCAAAGT CACACCCAAACTTCGCGAAGACGTTCTGAACACGATTGACATTATGAAGA AAATACATCATGTTCGGTTGATGAATTTGTTTGATGTTTACGATCTGGGA TCACAGATTGTCATGATTCTAGAATAGTAAGTTTTCCTATTTCAAAAATT AACTTTTTTGGCCATTGTCGTGTTTTAGGCCAATAAAAAGAGGCGATTTA TAAGACGCGGGATTTTCACGACCAACTAAAGTCTCTAGGCCAAACAACAA ACTTTTTCTATCTTTAAAGATTTCTAAATATCGTACACGAAAATCCTTTG CCTATGAACTTACATCCGAAAATGGTCATGTTTTCGTGTATATTAGAGCC CCCTCTTTTCCCAGCTGCCACACAGAATGTCATAACACGTCGTTAGATGA CATTAAAATAAGGTTTAATACAAAAAAAGGATCCTATTTATTGAAAGTCT TCTTCTCCAAACATGTTCGTGACCAATCAACAATTTACGTAAGACCTGCA TTGTGGTGGGCAACAGCATCCTAGGGTATATCAGGGAAGCAATAGAGATT TCTAACATTATGTAAGCAAACCTTCGAATCTTTAGAGGCAATCCCTTACG CAACTCGAACGTTTGCTACCGGTTTTTGTCAGTAAGGGCAAATTTTTAAC AGTTTTTCTCTGGCTTAAATTTTCCACGGCTGGGGTTTTACCGTAGAAAA TATTACGTCATAAATTTTTTCACTGTTTTTCTATTCAGTGTTGGCGGAGG TATGTTATTTGAACGTATCGTGGAAAAGAATTCACTTACAGAAGCGGAAT GTGCTTTATACATCAAACAAGTCTTGCAGGGATTACATCATCTTCATCTA CAAAATATCGCACATCTTGAGTTGAAGGTATGACCAATTTTTATTACTTC AAAAATTCTTCATTGTTCGCAATCTTAGGTTTATCTTCCACAAAAATGGT ATATCTAGTATTGCAACTTTTCAAACCCGTCTAGTCTGGGTGTAGCCTGT CCTGTCAGTAAAAAAAACTAGCACATCTGGTATTGAAGACAAGGTTGAAG GTATCACCGATTTTGTATTTCCTTTGAAAAAATTTCATTTCTTAATTCAA TCTCTCACAATTGATGACATATGCACGATGTCTCAACTTTTGAAATCAGT CTAGTTAAGATAAAAATGAACTCCGTCTTGTTAGTAAGAGGGGTTTTGTT CAAATGACCCAACCACAAAATACTGAAATGCCGGTAGTTTTTTCTTGAAA AGGTTCCTCAAATACACCGATCAAAAATGTTATGATGAGTTTCGGAATAC CAGAAAATCGGCCTTTTGATACCGAAATACCGGTCATTTTTTCGTCAAAC AACGAAATATACCGGCCAATACTGGATTTTTTTCAATGGAAGATATCTAA AAATTTTTTCCATTTTAACCGTATAGCCTGAGAATATTATTTGCGTGAAC CGTAGCAACATGGACATCAAAATCATTGACTTTGGATTGGCTAAACAATT GTCACATGACAAACCAATCAAGATTACCGCTGGGTCGCCGGAATTTGTGG GTAAGTTATGTGAAAATGAAATCCATTTTTTTCCTTCGTCTTTCTTTTCT TCAGCGTTTGGGTAATCAAATAACAGATAATCCATTCTGGGCATACCACG CTCCGTTCTAAAGAAATATGATGAATGTAACGATCCTACCTTGTTGATCA GCCAAAACAATCAAAACCGCGTAGCCTTTTGCTTGAAAGCGAAAGCGAAA GTGACCGCGTAGCCTTTTGCATGAAAGCGAATGCGAAAGCGAATGGGTGT TAATGTTTATACGAACGAAGTTTGTTTTGGTGTGATTGTTTTGCTTTAGC ACCGCTTCTAAAAGCTCATTAATATTCATCCAAAATCTGGATTAAAAAGA TCAAAGTGCTAGCCTGGGCAGAATCTCTTACAGTACTATGACTTTTAGAG TGAATACGTGCCAGCGTGGAGTAATCAGATTCTGATCGGAGATAAGCGTT TGGGATGGGTGTGCATGCACAATGGGAATAACCGAAATAGAAACATTGTC ATCATTCATAAAAAATTTTTTCTTTACAATTATAGCAACTAAACAGAAAA AACAAAACCGTCCTTTAATAATTTTCATTCGAAAAGATTAACTCTACTGG ATTAGATAGATCAAGACTACCCCCGGGCAAAAACCTCCATAACCCCGGTA GCCGAAAATGGGTNTTCACTTATTTTCTAATCGTTGAACCGAAAATAACT TTATTTATTTACTGCACCTTCAGATAAACACACGGAAAGACAGAAAAATT TGAGAAATTTTGATATTTTTTGAGACAGGTTTTGACCACTTTTATTTAGC TTAGTAATTCATCGTTTCAAGTGTGTAGACTAAAAGCATGCGAGAAGCCT AAATGGAAACTACGTTTAAAGTAAGCAAAATTAAAAGCCACCGAAAAAAA AAATGCCTTCTATAAACCTAAGTTCCTCGAAGTATATAATAAATTCTCTA AATCTTCCGATATGTATCTGTTTTTGACCCCGACTGATTTCCATCTGCCG TGTTTCATTATCAACCGANNNNNNNNNNTGCCTTCTATAAACCTAAGTTC CTCGAAGTATATAATAAATTCTCTAAATCTTCCGATATGTATCTGTTTTT GACCCCGACTGATTTCCATCTGCCGTGTTTCAATATCAACCGATCCGGAA CACCAAGATTTGCAGCTGCAAACGCTCCGCCCGAGGGCAAACTATGAACA CCATATTGCTTTTGGTCCAAACCTATGTCTTTTATCACCTTCTTGATATC GTCACGTACCGAACTGTAAGAAATTGGCTGATCTTTATTCCATAGACGAT TGTTTCGTTTGGATTTAGTTACTCCTCTAAAAATAAAATTCTCAGAATAA TTTTTTATGTTTGCCAATTCGAGGTACCTTTCCAAACCTTTTACCGGACA CAGGTTTGAATTAAGTCTCGCAATGTAAACCCAGTGGCCCTGTCTGTATA TGTCAGTTTTACTGCTTTGGATAAAAATTGTAGCATGATCATGAAGGAAT TTTATATCTGATCTTCTAAGCTTTTGGCATTCATCGAACCGTAGAAAAGC TGAAAAGGATAGCAAGCATATCGCTAAAGTCCTTGAATTTTTGAGGCTAG AACCAACGTCTAATTTTTCAAAAATTTCTCTCAAATCTTCGACTACAAAA TTTGTCTTCTTCTTTGGTGTATACGCCAATAACCGTTTAAAGGCTTCCAA TAGGTGCTTTACAATTGTAGAATTCCCGATCAAATACCCCGAAATAGCAT GAAAATGTTTTATGGCGCAATAAGACGCTTCCAAGACTTTCCCGATTGAA ATTGGGACATCAGAAATAAGATTAAATGTTGCTCTTGAGTAGGTAAAGGG TTCACTTCCTGGAAACTACGACTCCATTCTTCCCATTTTTGGAAATAAAA CTGATACTTAGCCACGGTGTTATTGCTTCTGGAATTCAAAAGAATTCCTG GTAATTGCTCAGAGAGACTCTTTAGTGCTGGATCCTGGACATCAAAATAG TTTCCTAATACGGTTTCTGAATCTGAGCTAAAAAGTAAAATTTTTTGTTA ATTTTCTGCATTGAGAAGAAAAAAACATTTATTTTTACCGAACACACGTT GATTGTCACACTTGTAATTTTAAAGCTAGAATTGGGATTTCTAATTTTTC ATTTCCCATCAGAGAACCTTGGAATCATCCTTTTGTGATTAATGCGACTT GATTTGCAAAATATCTACAATCCTTGACAAAAGGCTTAAAAGAGCTATTA TCCCTGATCAGAAAGGTCCAAAAGGCTGCCGATGGCCAGAACGGTATTAT TAAAGTCCCTGTTGTTCCAGGTTTGGCTNTGCCGATGGCCAGAAGGGTAT TATTAAAGTCCCTGTTGTTCCAGGTTTGGCTGCTAGGAGATGTTTAATAC ACTTTGTTATTAAATAAATAGGTGGCACCATTAGAGCATTTTCCCCAGAC CAATCAAAACTGAATGCGTCTACTTTGAATGAAAATGGACAAAAGTATTT TGAGCAAAAACGTGCCCATTTAGTGTTAGAATTATCAGCAAAAAGATCTA CAGAAAAAGGTCCCCAGAGTCTATTTAAAAAGGAAAAGAATTCTTTTGAA ATTTCCCAGTCATCATAGTCAATACTCTTACTTACTGTGTCCGCATCTCC ATTTAATTTTCTAGCGATCCACGTAATTTTTAGAAAAATTCCTTTTGCCT TACACAAGTTATAAATTGTATTTGCTAAAAATTGTAGTTTTTCCTTATTA CTTCCAACTTTAACAATTCTTGCAGCGGCAATGTTGTCTGTGTGCCAGAG AACATTGTTCCCTTGTAGTTTTGAATTGAAAGCATGCAGCGTAAAAGCTA TTGCTAATAATTCCCTGAATGTTGAACTCTCGCCTTGTTCATGAGGCCAT AAATTTCTGAAACTTATATCATTATCCGAGATTGCTCCTATTCCTTTGTC NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNGTCTTGGTGTTTCAGTTGTGATCGTTGATGCACTAGATTGCTTG AGCTTTTTCTCTCCAAATAATAAGCTTGAAAATGTTTCCATTTTTCCCAC ATACAATATACAAGAGAGTTAGAACGACGTGTGATTAGTTTTAAAATGTC TACCATTTTTATTGCACGCGAGAACAAGAATTTCAAATTGTTAATTTACA GAACGATAGCAAAGGCTATTATCTTTCGGATGCCGTAAATAAATTCACAT ATGTTAAGCTTTATTATGTTCTTTTCTTTTAGCACCGGAAATTTTGTCAT TCGATCCTGTTTCCCTGAATAGCGATTTATGGTAAATATTTCTCGTACCC CGAATTTCGAAGAGCAGAAACATTTAAGACCTTCTTGATTGATTGATAAA TTTATGCTGGTTCGACCCTTTCTAAACCTGATAAACCTGCTTATTGTCTG AAACTTCATCTAAATTTCACACATTCACGTAAACTTTTCTTTCAAATTTT ACGCATCTATCTAGGTAAATAAGAAATCCCATTCGGGCAAATCTCAGATA CCCCTTAGCAACGCCGAATTAACAAATATCCAAATATTTTATCTTTTTAG GAGTGTTGGTGTTATTACGTACATTCTGTAAGTATTTTAATAAGCTTTCG TGTTTTAGTTAAAATTATTCAGCGAAATCTAAAATCTTTTAACTGTTTAA GGAGAAGAGCTAAAACTTACCAAAAGACTGCAATCTTTTACGACGCAAGA TGTCACGATGAAAATATTTTTCCTGTTTTTTTAAGAAATTGAACAGTCGA CTTATGACAGGCTAGCTCTAAAGCTCTAAAACAGTATCTAATAACATAAA AAGTTGTATTATTTTCGGCTCTATTCACATACTGAATTTCAAAGATATGT GACGTTTTTTGCAAACTTTTGCGAGACTTTAGCTTAAGTGCTTGCGTGCA ACATTGGGTACAAAGTCCAAATATGCGTTTCCCGTAAATTTTATATGAAA AGTTATGGCTATTCTGTATGGAGGCTAAACTATAAATGTTCTAAATTATC AACTCTCCTTTCCTCCTACAACTCCGCATTGTCGAGTGCCTGATTCAATG ACAACCACCTTCCCAGCAGACACACAACGTTGTTTCAACGCTAATCTAAC GTTCATAAAACGTTAGGTTAACTTTAGGAATAGCTTTATGTGCCATCTGG ATTAGCTATCTTTACAACTCAATCGCTTGCTTTATCCCCTAGACGTTCGA GTTATGGACACTTGACTGTAATCATTTTTAACCAAATTATTTTTTTTCAG ATTGTCGGATATTCACCGACATAGATAGTGAGTTTATGTTTTTGAGACTG GACTGTAATCATTTTTAAACAGAACATTTTTTCCTTTACTCTCTATTCAG ATTGTCGGGTATTTCACCATTCATTGGAGATGATGACAACGATACATTGA TGAATGTTTCCTGTGGTGAATACGAATATGATGACCAAGCGTTCGGTCAA ATCACCAATGATGCGAAATCCTTCATCGATAAACTGCTTGTCTCGAATCC TAAGTAAGTGCAGTCTCTTTCTTATTCGATGCTCTAGGGACCAAGAATTT TATTCGAATTAGAGAAAGTTTCAAATTACACACATTTTATACTATTTCCC ACATATTTTTGTTCGAATTATAGAAAATTGACAGCAATACAATGCCACTA AGGTTTTTTTATATCCTACAGATTTCTATATTTGTAGAGAAAAGCTCGAA AATCATCCATCAAATTTCGCTTTCCTTTAAGTATTCAAGTCAATTTGAAT GGCTTTAGTCTGTTGATATTCTCTAAAGAGTTTATAATTCTTCGTGCTAA TAACTGTGGTTTACAATAGGCTAACTAACGTTAAAAATTTGGTTATGCTT CTATTTTCAGGAAAAGGGGAAATGTTGGTCGCTGCTTGCAACATCCTTGG ATAAATGTGAGTTTTCTGGCTAGTTATTACCGAACCAGACTTTAGTTTTT ATAAAGAGGATCTAAGGCTCCCTATCCCTCTATCTATGATATGCACCTGT TGTGATGTCTTCCAAGGACCCGACAGCTGATTGGTTGCAAGTGACTGATT TTACAAATCAGCTATTGGATCCATGATGTAATGTCAGAAGACACTGCAAT GGTACATTTCATGAATATATTCCTATCATCCTTCAAAACGTGGGGAGATT CGGCTTCGAGTTTACCAGGAAGGATTTACGTCAAAATGCCTGAAGTCTTT GCATTGGTCCAAATAATTTTGACGTCATTTCCTTGTATTCATTACCAATT CCCTCAAAACCCAACCTGGTTGTTCATGTTCGGTAGCACAGATATTCGAG GCATGGACTTTTCAGCCTGTTAGAATCTTGCTGAGATTCACTTTTTTCAA AAATCTTTTATTTTTTCAGTCCAACTGGCAATCCAAACAAAGTAAAATCA ACCTTGGCAACTTGAAGACGTTCTTGAAGAAACACAAAGAAAAGGTACCT TTTTTAAACCTTTTGGCTAAACTTATCTGATTCCATTTATTGTGCCTAAT TTGATCTCAGACTCCTGACCAAGCATTGTAACACTTTCAGTGTTGTCGCC CTTATATAAATGTTTCATTCGCCTCTAAATAACATTTGAATTTCGTTTTC TCTAGGTTAACGTCAGTGCTAGAGGTGCCATCCGTCGGTTCAGTTCATTT GGAGTGGGCGGTCACGCCCATGGTTTATTGGGTGGACGAGGTGGCTCTCC CGTCAGTGTCGGTAGCAGCCGATCGCCTTCAAAACATTTATTGGTACCGA ACGCCCTTCAATCATGCGTGATAAATGAAGATGAAGAAGAAGAGGAAGAA GCAGATGAGAATCAAAACATCCGGAATATCAATGATTCTTTACGGAGTGG CCCGATTTTTACTGTAACAAAGGAAGCGGAAAGGCCCCCTTCCGGTGATT ATGGTGAAGCATTACCGGATTTCAATACGGATACACCAGACGGGTTGAGA AATTATTTACAGCAAATGATTAATACTGGGTTATTACCGGGCCGTTCTGG ACCACCGGACATGTCTGAACAGTTTAGTGATGAAGATCATTGAAGGAATA AGAGGTCGGATGATAAAGTAGATTTCCAGACAGCGCGAAACGTTCAAACA AGGTATATCAAACGTTCCTAACGTCTTTTAACGTTA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000130XLOC_000130Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000241-exon-sc0000001-1575043694:2127304..2127350TCONS_00000241-exon-sc0000001-1575043694:2127304..2127350Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1575043694:2089787..2091674TCONS_00000241-exon-sc0000001-1575043694:2089787..2091674Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1575043694:2088550..2088571TCONS_00000241-exon-sc0000001-1575043694:2088550..2088571Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1575043694:2088145..2088235TCONS_00000241-exon-sc0000001-1575043694:2088145..2088235Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1575043694:2087375..2087575TCONS_00000241-exon-sc0000001-1575043694:2087375..2087575Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1575043694:2086624..2086762TCONS_00000241-exon-sc0000001-1575043694:2086624..2086762Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1575043694:2085951..2086074TCONS_00000241-exon-sc0000001-1575043694:2085951..2086074Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1575043694:2082320..2082368TCONS_00000241-exon-sc0000001-1575043694:2082320..2082368Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1575043694:2082024..2082050TCONS_00000241-exon-sc0000001-1575043694:2082024..2082050Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1575043694:2081098..2081250TCONS_00000241-exon-sc0000001-1575043694:2081098..2081250Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1575043694:2080695..2080740TCONS_00000241-exon-sc0000001-1575043694:2080695..2080740Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1575043694:2080157..2080231TCONS_00000241-exon-sc0000001-1575043694:2080157..2080231Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1575043694:2079465..2079995TCONS_00000241-exon-sc0000001-1575043694:2079465..2079995Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1510915933:2127304..2127350TCONS_00000241-exon-sc0000001-1510915933:2127304..2127350Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1510915933:2089787..2091674TCONS_00000241-exon-sc0000001-1510915933:2089787..2091674Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1510915933:2088550..2088571TCONS_00000241-exon-sc0000001-1510915933:2088550..2088571Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1510915933:2088145..2088235TCONS_00000241-exon-sc0000001-1510915933:2088145..2088235Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1510915933:2087375..2087575TCONS_00000241-exon-sc0000001-1510915933:2087375..2087575Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1510915933:2086624..2086762TCONS_00000241-exon-sc0000001-1510915933:2086624..2086762Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1510915933:2085951..2086074TCONS_00000241-exon-sc0000001-1510915933:2085951..2086074Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1510915933:2082320..2082368TCONS_00000241-exon-sc0000001-1510915933:2082320..2082368Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1510915933:2082024..2082050TCONS_00000241-exon-sc0000001-1510915933:2082024..2082050Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1510915933:2081098..2081250TCONS_00000241-exon-sc0000001-1510915933:2081098..2081250Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1510915933:2080695..2080740TCONS_00000241-exon-sc0000001-1510915933:2080695..2080740Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1510915933:2080157..2080231TCONS_00000241-exon-sc0000001-1510915933:2080157..2080231Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1510915933:2079465..2079995TCONS_00000241-exon-sc0000001-1510915933:2079465..2079995Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1491911889:2127304..2127350TCONS_00000241-exon-sc0000001-1491911889:2127304..2127350Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1491911889:2089787..2091674TCONS_00000241-exon-sc0000001-1491911889:2089787..2091674Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1491911889:2088550..2088571TCONS_00000241-exon-sc0000001-1491911889:2088550..2088571Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1491911889:2088145..2088235TCONS_00000241-exon-sc0000001-1491911889:2088145..2088235Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1491911889:2087375..2087575TCONS_00000241-exon-sc0000001-1491911889:2087375..2087575Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1491911889:2086624..2086762TCONS_00000241-exon-sc0000001-1491911889:2086624..2086762Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1491911889:2085951..2086074TCONS_00000241-exon-sc0000001-1491911889:2085951..2086074Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1491911889:2082320..2082368TCONS_00000241-exon-sc0000001-1491911889:2082320..2082368Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1491911889:2082024..2082050TCONS_00000241-exon-sc0000001-1491911889:2082024..2082050Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1491911889:2081098..2081250TCONS_00000241-exon-sc0000001-1491911889:2081098..2081250Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1491911889:2080695..2080740TCONS_00000241-exon-sc0000001-1491911889:2080695..2080740Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1491911889:2080157..2080231TCONS_00000241-exon-sc0000001-1491911889:2080157..2080231Clytia hemisphaericaexon
TCONS_00000241-exon-sc0000001-1491911889:2079465..2079995TCONS_00000241-exon-sc0000001-1491911889:2079465..2079995Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2079465..2127350 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.02461e-07 0.456359 7.92295e-08 0.311071 13.0876 6.1337 13.7114 12.0987 5.08678 12.2092 5.99185 5.80571 10.2731 8.95295 2.86579 6.15645 4.88569 9.5128 10.2293 7.88108 6.8049 4.8536 2.33915 8.69856 13.328 11.3362 2.14178 2.54956 1.2902 0
Blast
BLAST of TCONS_00000241 vs. Swiss-Prot (Human)
Match: MYLK (Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4)

HSP 1 Score: 268.085 bits (684), Expect = 2.766e-73
Identity = 127/302 (42.05%), Postives = 209/302 (69.21%), Query Frame = 1
Query: 2011 VSKAFEQSEEISRGKFGKVYKMVARATGDTYAAKYIKV-TPKLREDVLNTIDIMKKIHHVRLMNLFDVYDLGSQIVMILEYVGGGMLFERIVEKN-SLTEAECALYIKQVLQGXXXXXXQNIAHLELKPENIICVNRSNMDIKIIDFGLAKQLSHDKPIKITAGSPEFVAPEILSFDPVSLNSDLWSVGVITYILLSGISPFIGDDDNDTLMNVSCGEYEYDDQAFGQITNDAKSFIDKLLVSNPKKRGNVGRCLQHPWINSNWQSKQS-KINLGNLKTFLKKHKEKVNVSARGAIRRFSSF 2907
            VS  ++  E +  GKFG+V+++V + T   +A K+ K  + K +E++   I IM  +HH +L+   D ++  + IVM+LE V GG LFERI++++  LTE EC  Y++Q+ +G+ ++H Q I HL+LKPENI+CVN++   IK+IDFGLA++L +   +K+  G+PEFVAPE+++++P+   +D+WS+GVI YIL+SG+SPF+GD+DN+TL NV+   +++DD+AF +I++DAK FI  LL  + K R +  +CLQHPW+  + ++ ++ K++   +K ++ + K +   +A  AI R SS 
Sbjct: 1460 VSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSM 1761          
The following BLAST results are available for this feature:
BLAST of TCONS_00000241 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MYLK2.766e-7342.05Myosin light chain kinase, smooth muscle OS=Homo s... [more]
back to top