Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000239 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000239
Unique NameTCONS_00000239
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3422

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000239 ID=TCONS_00000239|Name=TCONS_00000239|organism=Clytia hemisphaerica|type=transcript|length=3422bp
agaaaaataataaaaagaaacacaatGAACAATGGAGGGGAAGAAAAACA
ATTGCTCACTATATGGATTGAACCGAAAAAAGACGGTTCAAACAAAGTCC
GTGATATCACCACAAATACGACACAACCCAAGTGGGCCATTCACACTGCA
GATGATAAAGAGTGGAAAAGTGATTTTAGTGCAAATAACAACTTGGTTTT
AAGTCCAACAGAAAATGGTGACGGTACCCAATCTTCTGGATTTCCAAAAG
CTTCTTTATTAAAATACGAAATCAGGCATTTAACCAATTTAAAACAAATT
GAAGGTCCTGAACAATTTTTATCTAAGAATACGAAAAATCCATCGGTCCC
GATTACCGAGCAACGAGAAAACGAAAAAGCCGACGGTAAAAGCGACTCGG
AAGACGAGAATATGACCGAACGTTTACGATCAACTCGGTATTCGAGTAGT
AGAAACTCGGATGATTTACTCGGCCGTTCTTCTTACCGTTCAACCCGAAC
TTCTTACTCAGATGACATTGGTGGATTAACACGTGGTACTAGCGCAGGCA
GTAGCCGATACCGTAGAAGCGTACTAGACGACCCGCTCGATACGTACAGA
AGTAGCCGTAGCTCGAGACGCTTAGATGATTATACACCAACGACTGATTA
TTCAACGACGTCATCTTCCAGATACGACCGTCCATACCGTAGTACCACGT
CTGCAGACGAAACTCGCTCTTATCGGACAACGTCTCGCCGTACACTTGAT
GATCCGGTTATAGAATCACCGAGACGTTCTCGACGATCAAAAGTGAACGG
TATTGACACAGCGATAACGACGACATCTGTTACAGCCACGGTAGATGGAG
ACTGTAATAAGtgtaaagaaaaacaagaaagaatAATCCAAttagaaaat
gataaaaataaagagtttgaaaaatgtaaagaaaagGATTTAAGAATTGA
GGAACTAGAAAAACAATGCTCTAGGGACTCTGAAAAACGGAAGGAAAAGG
ATGAACGAATTCGAGATTtaattaaagaattaaaaaatgtttccgAAGAC
GTTAAATCGAAACAAGAACTGGTTAAAGANAAGATTTAATTAAAGAGTTA
AAAAATCTTTCCGAAGACGTTAAATCGAAACAAGAACTGGTTAAAGACCT
CGAAAGCGAGTTAAAAACGCAACGTACCAATTACGATCAGAAATTAAACG
ATTTACAAAGTTTGGAAAGCGAGTTTGTCGAACAGGAAGAAATTCAAATC
CGAATGGAAAAAGATTTAAATGATCGTGAGGAACGAATAGAACAGTTAGA
ACATGAAATTCAAGTCGAAAGAGACACGATAAAATCGAAAGAAGATTTAA
TCGAAGAATTAACGATTCAACTCGAAGAGCTTAAGGAAACTTTGGAAATG
AAAGAGGAGAAGATATTGGAattggaaaaagattttgagAACGCAAGTGT
TGCTCTTATGAACGGTATCAAACAAATGGAACAACAACCTCGATCTGGTG
AAGATATACACGAACTGGAGGCTCAATTACAAGATAGTTTAGATGAGCGC
GATGGTTTTATGAAAGAGATTAAGAAACTCGAACGAGAgctaaagaaaat
caataatagCCTGGAGGAAGAGAAAAATCAGACACGCAGGCTAGGAATTA
AACTTGAGGACGCAAATTACGAGATCGGGAGATTAAGACAGGAACTTATC
AACTCGCAACTGGAGAACGAAAAAATAGTGGAAGAAAACGAAGATTTAGC
TGTGGATAACGAGGATTTGATCAAAGAGCGAGATGAGATTATACAAATTT
ACGAGGAATTGTATCGAGAGAGTGAACGATTAAAACACGAGGTCAAAATT
TGGAAGACTGTGTTCGATAACAATAAAGATAACATTGATGAGGATGAAAT
GCGAGAAGCGATGAGCGAAGGTGACGCACTTGAGGAGAATGGGAAGGAGT
CTTCAGATGAAGAGgagCTGATAGAACTCGAAGAAGACCAATCATTGCTT
GTTCCTCCACGTGATGATATTCGAATCAAAGTCACAGATGTCTCAAAAGC
TTTCGaacaaagtgaagaaatttcaaGAGGTAAATTTGGTAAAGTATACA
AGATGGTAGCCCGAGCTACGGGTGACACCTACGCAGCAAAATACATCAAA
GTCACACCCAAACTTCGCGAAGACGTTCTGAACACGATTGACATTATGAA
GAAAATACATCATGTTCGGTTGATGAATTTGTTTGATGTTTACGATCTGG
GATCACAGATTGTCATGATTCTAGAATATGTTGGCGGAGGTATGTTATTT
GAACGTATCGTGGAAAAGAATTCACTTACAGAAGCGGAATGTGCTTTATA
CATCAAACAAGTCTTGCAGGGATTACATCATCTTCATCTACAAAATATCG
CACATCTTGAGTTGAAGCCTGAGAATATTATTTGCGTGAACCGTAGCAAC
ATGGACATCAAAATCATTGACTTTGGATTGGCTAAACAATTGTCACATGA
CAAACCAATCAAGATTACCGCTGGGTCGCCGGAATTTGTGGcaCCGGAAA
TTTTGTCATTCGATCCTGTTTCCCTGAATAGCGATTTATGgAGTGTTGGT
GTTATTACGTACATTCTATTGTCGGGTATTTCACCATTCATTGGAGATGA
TGACAACGATACATTGATGAATGTTTCCTGTGGTGAATACGAATATGATG
ACCAAGCGTTCGGTCAAATCACCAATGATGCGAAATCCTTCATCGATAAA
CTGCTTGTCTCGAATCCTAAGAAAAGGGGAAATGTTGGTCGCTGCTTGCA
ACATCCTTGGATAAATtccaaCTGGCAATCCAAACAAAGTAAAATCAACC
TTGGCAACTTGAAGACGTTCTTGAAGAAACACAAAGAAAAGGTTAACGTC
AGTGCTAGAGGTGCCATCCGTCGGTTCAGTTCATTTGGAGTGGGCGGTCA
CGCCCATGGTTTATTGGGTGGACGAGGTGGCTCTCCCGTCAGTGTCGGTA
GCAGCCGATCGCCTTCAAAACATTTATTGGTACCGAACGCCCTTCAATCA
TGCGTGataaatgaagatgaagaagaagaggaagaagCAGATGAGAATCA
AAACATCCGGAATATCAATGATTCTTTACGGAGTGGCCCGATTTTTACTG
TAACAAAGGAAGCGGAAAGGCCCCCTTCCGGTGATTATGGTGAAGCATTA
CCGGATTTCAATACGGATACACCAGACGGGTTGAGAAATTATTTACAGCA
AATGATTAATACTGGGTTATTACCGGGCCGTTCTGGACCACCGGACATGT
CTGAACAGTTTAGTGATGAAGATCATTGAAGGAATAAGAGGTCGGATGAT
AAAGTAGATTTCCAGACAGCGCGAAACGTTCAAACAAGGTATATCAAACG
TTCCTAACGTCTTTTAACGTTA
Run BLAST on NCBI

protein sequence of TCONS_00000239-protein

>TCONS_00000239-protein ID=TCONS_00000239-protein|Name=TCONS_00000239-protein|organism=Clytia hemisphaerica|type=polypeptide|length=691bp
MEKDLNDREERIEQLEHEIQVERDTIKSKEDLIEELTIQLEELKETLEMK
EEKILELEKDFENASVALMNGIKQMEQQPRSGEDIHELEAQLQDSLDERD
GFMKEIKKLERELKKINNSLEEEKNQTRRLGIKLEDANYEIGRLRQELIN
SQLENEKIVEENEDLAVDNEDLIKERDEIIQIYEELYRESERLKHEVKIW
KTVFDNNKDNIDEDEMREAMSEGDALEENGKESSDEEELIELEEDQSLLV
PPRDDIRIKVTDVSKAFEQSEEISRGKFGKVYKMVARATGDTYAAKYIKV
TPKLREDVLNTIDIMKKIHHVRLMNLFDVYDLGSQIVMILEYVGGGMLFE
RIVEKNSLTEAECALYIKQVLQGLHHLHLQNIAHLELKPENIICVNRSNM
DIKIIDFGLAKQLSHDKPIKITAGSPEFVAPEILSFDPVSLNSDLWSVGV
ITYILLSGISPFIGDDDNDTLMNVSCGEYEYDDQAFGQITNDAKSFIDKL
LVSNPKKRGNVGRCLQHPWINSNWQSKQSKINLGNLKTFLKKHKEKVNVS
ARGAIRRFSSFGVGGHAHGLLGGRGGSPVSVGSSRSPSKHLLVPNALQSC
VINEDEEEEEEADENQNIRNINDSLRSGPIFTVTKEAERPPSGDYGEALP
DFNTDTPDGLRNYLQQMINTGLLPGRSGPPDMSEQFSDEDH
Run BLAST on NCBI

transcript from alignment at sc0000001:2079465..2112567-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000239 ID=TCONS_00000239|Name=TCONS_00000239|organism=Clytia hemisphaerica|type=transcript|length=33103bp|location=Sequence derived from alignment at sc0000001:2079465..2112567- (Clytia hemisphaerica)
AGAAAAATAATAAAAAGAAACACAATGAACAATGGAGGGGAAGAAAAACA ATTGCTCACTATATGGATTGAACCGAGTAAGTTACGTATTTATTTTCTGT ATTTTTATCGCTGGGTCGAGGATGAAGTTTTTCTTGGTCTAATTTCCTAG TTGGTATACAAACATTGTTTCAACGTCCATCGAACGTGATATTGACGTTT TGTGTCAGCTGGATAATTAACCATTGAGTTTAAAGCCCGAAGGGCTAGAG TAGAATGTCTAATCTTTCACAGGCAAGAAAAAGTGAAGCCACTTATTTCC TATCCAGAACGCGCCTAGAACGCGCCGTAATAATGACGACGGATTGTATC TGGCGGTTCTTTTTTTTTTTTTTTTGGGCTANNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTTTTTTTTTTGAGGACTACA TTTTTTTGAATCTAGCGATAGATTTTAGTTTCAATCCAGCGTTTGTGTAA AAACAACGCGTGGGCGTTCTGGATTGGAAATAAGTTGCTTCATTTCCCAT CCAGGAGTCTAGAGTCTAGCCCTTCGGGATTTGAAGTCGATGTAATTTAC CAGGCTAGCCTTGGGTGATTATCTGATTCCATTGCAATTAGATATAGCGA AAAGCTACAATCATGGTCAGAGTATGTTGACACTTCTTAGTATTAAGAGT TCGGGCGAGAAAGACATTCTCAGACTTTTCTCAGATCGAATATTTTGATC CGTCATCCAAAATGCAGTGCAAATCTTAAGCCTGGTTTGAAAGTTAAGAT CCCTCTCTAGCCTGCAGTAGCGTTCCAATACATCTCTGTCTAACTGGAAA ATATTAGAACCTTTAATGCCTTGAAGTACCTACTTAATTTGATGATCACA TCTCTCGTGTTACTCTGCTGAACTAATTAAACATTATAACAAGCCAGTTT TCTAAAGATTCCAAACTGGCATCGTATTTGTGGTATTTTTTTATGAAACG TGCGGTTTATTGTTGTTGATATTTAAGCTGTAGTATCAACAAGTTCTCAC TTAATATTTTCTGCAAACACACTGCAATGTTATTTGACTTAAAATTGAAT ACATTCTACTATTATGCTATCGTTTCATTCATTTTGGAGAAAGTTCTAGG AAAAACCAGTGGTAATTTGGTATGTCGATTTTGTTGTTTTAATAGCCTTA AATACCAATGAAAAATACTTTTCACGGTAACTATCACACCCTCTTCTCAC AGACCCGGTAGGATTTTTTCAACTAGTGGGATAAAAATAACGGACTGAAA CTCGATGGGGATTGATATTCCCATATTTTTAATGGCTGGGGAATTCAATT CAGTTAGGATGGGAAAAATAGTAAATATATTGCAGTGAGGTTTGGTTTAT TTAATTATTTTCAATGGGGACAAAATTCGGAAGATAATTTTCCCAGTAGG AAGGGCGTTCCCAATGGGTCTGTGAGAAGGGGGTGTACTATCAATAACTA TCCTTTTCTAATAAAATCTAATTTTTCCCTTTAAATTTATAGTCTTTTTT TCCCCCAGACCCTTTTTTCCCCAACAAGACATTGTTTTAAGAATCTCACA TCTATCTTTTCCTTTTTCATGATTTTCCGGATTCGAAGGGTTTTTATTTC AAGATCTGAAACCTCCTAAAATGCAATAGAACCCGTAGCAAAATTTCGAT ATCAGTAATAAGATAGATAGCATGTGTTCAGTGATAAATTCTGAAATCAG TTTATCTCTTAATCAACAACTCGCGTCGGCCCCTTGATCTTTCTGTAATT TTATATATTTTTATGTAAGAATAATAGTTAAAGAAAATATAAATGACTTA GGATTTGGGTGGATTGGTTTGCGAGATGGTGGGGTATGTACAAGCCAAAA TCTCTTAGAGGGATTTGCTCAATGTTCATGTATATCTACATGTGAATAAG AATTAATTCATGAATCTACATCGAGGGAACTGAACCACATGAGTGAACTT ATTATTGTAATTTCATACCCTGCAAGACTTTCCCTCGCAGACAAGTCTAC CAATGTAAAGTAGACTTATCACATTTTTATCAACTTCTCTACTCATCATA ACTTATCACTTTCTTTATTAATTTGGTGATAGGTGACAAGTATGTGAGTC GTAGACAGACATTCATTGCCCACTCCGTGCTGAGTAACCAAAAGTTTATT CCTGTTACTTTTACGACTTTTTGGTAAAGAGACGATATTCGAGTGCCCAA CTATTAGCAGATGGGTAGTAATCCCTAAGTCCAACCCCCGGGGAATACGC TCTATCCCCTTCCCGAACGCAAGAAATACACTTAAGAACATCACCAGCAT ATTTGAGGTTCTGCCCATAGTTGCAGAACTTTGCTCCCTTTACGGGCCAT CCACTCGTTGCTGTGCTTAGCTTTTGGTCCCGTCATAAACATCTGAAATT CATTCATATAAATGATACTTAGACAAAATTGGTGCTGGGTATGTGCGGAC GGTAAGGGTCGGCTTTTCACCTTTCAAAGTCTCTCTAAGGGTCACCTTTT CAGCAAAAATCAGTCTCTCTAAGGGTCACCTTTTCAGCAAAAATCAGTCT CTTTAAGGGTCACCTTTTCAGCAAAAATCAGTCTCTTTAAGGGTCACCTT TTCAGCAAAAATCAGTCTCTTTAAGGGTCACCTTTTCAGCAAATATCAGT CTCTCTAAGGGTCACCTTTTCAGCAAAAATCAGTCTCTTTAAGGGTCACC TTTTCAGCAAAAATCAGTCTCTCTAAGGGTCACCTTTTCAGCAAAAATCA GTCTCTTTAAGGGTCACCTTTTCAGCAAAAATCAGTCTCTTTAAGGGTCA CCTTTTCAGCAAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCCCGTTTGCTGAC GTTATGTTATCAAATGTTGCATTATACTAACAAGTATGCTTCCTTTCGAC CAATCCAGGTATTTTGATGAGCTTTTTGACACGAGAAAGAATTCTGAATT TAAAGAATGATAACGAGATTAGGGAGGAGCTTTAAGATAACATGACCACG TTTCACTCCTTGTTAGCTGAGATAATGATTTGTACAATTACTTGGATATT TGTTGGAATTTTTCATTCAGGAACACTTTCAGTAAAAAAGCTTTCTCCTT ATTGAGAGCAACAAGGAGACACCGCTGGTCCATATATGGACTTGTATATA TACAACTACTTTCTCAAGGTAGGTCTAAAAATCTTCCAGTCCTTTTTTAA AATCGTCTTTTCTACTACTGAACCAGGAGGAGCTTTAAGATAACGTGAAC ATGTTTCTTTCCTTGTAATCTTGCCGAGAAACTTGATTGTTAAATCATAA AAAGCTTTTCTGCCAACTCCAATCAGTAAGGAGCCGCAGCTTGTTTTCCA TATATAAAGCTTCTCCGGGTGGACCTTAATCTCACAGATTTTCTTCTAAA ATTTTCTTTCCTAAACTGCCGAACAGTAGCTTAGTAGACATGAAAATGAA ATTATGGTATGATCATAATCTAACCTCTTAATCGTTATAATGTTGTTTTG AGAGGCCTCCCTCAAAAGGTTGGCACTGTGGTTTTCTTCTTATCTTTTTG TTCGTCGTATTCAAATTTTGTTGCCTGTATCTCTGAAATTGTGCATTTCT TTTATACTTGTCAGTTTGACTTGAATCAGAAGAAGTATTGACGATGTTGG TGGTAGTAATAGGATGGTACTAAATCGTTGTTCGTCCCCGGGGGGGTGGG GCACTTTATTTATTAAAAACGACCGTAACGGATCCTTGCAGGGCAGAGAA AATTTGGCCAAAATTGAGTAAATTTAGACGAAAAATCGACCAATACGGTG CATTATCTTGAAGATTTTTGACCATTTTAGTGAAAACATGCTCAGATTTA CCAAATTTTAAACGCTAGACCTTTTTGTTCATTTCGACTTTTTCAGTGCA CTTGGGGAAGCTTGGAAAAAGGCCCCTTATGGGCCGCACGAACGGTAGGA TGTTTTCCTTGAGTGGCCCTCGGGGGTTCGTTTAACCTCCCGGGGAATCA CCTAGAAAAATAAAGAGTACGGATATGTTTCGTCTTTAAGGGGGGTCGAA CCTTTAAAATTCCACTAAGAAATGATAAAACATAAAATCTACTTTCAATC TCACCAAGAGCTGCAATAACAGAAAAGAACCCCAATGTTTGTCCTTCAAA AGGCTGCAATTCGTAAAAAAGTCTTGATAAGGGACTATAAATGATTTTTA ACCGCTCAGCTGATAGGAAATCCGTGTGTCCTAATTTTATTCTGAATTTC ACATTTTCAAAATCCATCACTTATAGCTTACCCTCACGGACTAGTCCTAA ATTCTGACCTTAAAATTGTCGCAAAATTATTACTGTAAACTTAAAAGAAG GGGAGGGGGCAGAGTAACTCAACCTATTATGAAAAATTTATATATTTTCA ATATTTATCTTCTACTACTTGCAAAACTCAATTGAAAAATGTTAGTATCT TAGCGAGGGTATGTCACTGTTGTTTACGATAAGCAAGAATTGAAGGAGAC GCCGAAACAGTGCACAGTGTTAGGTGATAAATATTATTCAAATACAACAA AAATATTTACAAAATTACACACGAAAAATTTATTACGATGAGAATATTTA GTGAGCAATATGAATTTTATGATACTGTCTGCATATTATTTTATACTTCT AAGGTTTTTGTTTTTTGGATTGATTTTAATAAATATTTCCAATAAGTAGG GATTTGTTTATGATACAATTTCACTGTTATTAGATAAATTGTTTTTAAAT GCATCGACCTCCGTCTAAGTGGTGTATAGCAGTTCAACTTTCCAAACAAT TCAATATCTGATTATTATTACGTGCAAAGACCGTGCGGGCTTGACGGGGT GCCGGTATTAGCTCTTTCCGATGTCGGTGGTTCGGTATTTGAAGAAAACA ACGTCAATATTTTGGTGTCAAAAGTCTTACCCTATATGGTGACAAAACAA AGATTTTAGCTTTGTTACTGTCTGTGTTGACAGTGATTAAATAGTAATGT GTCGGTATCTCGGTGTTGGGGACACCATACGCTCACCCCAAAGTTGTGTA GCTAGGTTAAAGAGGTTTACGATTCAGACTTTCTGCTGAGATAATCTAAG ATATGAAACTGATGCTGAAAACCTTTAAAGCTACTCTTACTTAGGAGTAC TTGATCCCCTGGGGTAAAAGAGTTGGCGGATAAAGGGTATGCGTGGATTG GACCTCTAAAAACCGACCCTTAGAGAGACTGATTTTCGCTGAAAAGGTGA CCCTTAGAGGAGACTTTTTCTGATTTTTGTGACCTTTAGAGAGACTTTGA AGGGCTAAAAACCGACCCTTACCGACCGCACATACCCAGCACCCATTTTT GCCTAAGTACCCCCCCCCCCTGGGTACTTGACCCTTAGACTGTTTTATTA ATCAATCGTCAAGATTCAGGCTTTGACTCATGCCACCAAAAATAAGGTTT GAAATTTCAACTGAATGGTTATCAGGTCTCCATAATGTCCCATAATAATA TCTGACATTGTAAAATTCTTCAGCGTTCAAAACTTCAACGTTTTTGTAAA CCCTGTCGCCATTCATCCATATGTTTAAACGAGTTCTAGATCTTTGTGTG ACTTGCATTTTTATATCGTATGTCGTGTTCAATTCAATAGGATCCGACCA TAATTGCATAAAGTTGTCAGAGGTGCTGTTTCCATATAGGGTGAATTCGA TTTTTCCTTCTATTTGGTTGTAAGCAACTACTGGCTGCCGACATCCGTAT TGGTCTAATGTTGAGTTGCAGAATTGGATAATACCGTGCCATTTACCACC ATCATCCCGACCATCATTCATGATCTTTCGATGATATAAGATTTTGACTG AAAATTGTATGTGCCATGATTTAGGCCAGCGTGGAATGACACCGAGTTGT ATCGCGTTGTTATAGGTTACAGGCTCTGAAATAAATCGTGAAAAGAAGAA AAATGGTCTATTTCAGAAAAATTTGTGCATGGGGAAGTTGAGGAAGTCAT TTTCGGGAATGGATTTTTTATTGGATTATTCATTTCCATACCACCCTGGA CGTCACACTTCCTCAACATAGGGGGTACAGACTATATCTGGAATAGACCA ATACAAAAACTCGAAATTTCAAATTAATTTTAAGTACAATCATGATTCTG GAGTGCTTTACTGCTTAAACAAATTGATGGTAGACTTTTTCAAAATAGGG TACAAAGCAATAAGGTATGTCGGAAGCTAGAGTCGAGCCTCAAAAGAAGC ATACACGCAGGGGGGGTGAAGCAGTTAGTACAAGACATCATGCCGGTTAG TACCGTGGTGGTGTGCCATATGAATTGGATAAAATCACTTAGTACTCAGA TGTACTAACTGCAAAAAAGGGTGGTCCCCTGCTAAAAATTTGCCAAATTT TGGTACTAACTGTGTAAAAAATAGGATTTTGTGAGAAAATTTTAAAAAAA AGACCGTATTTTACCAAAAAAATTTTTTGGGAAGTAGATTTTTTTTTTCA AATTTTCAAAATTTTTTTTATAAATCTTAAAAACAATATGCTGGTTGCAA TAGAAATTTGATTTTCTAAAATGTTGTTTTTTCCTATTGAAAGCTATGGA AAATTGAATCATTTTTAAGATATTAAATTTTATTTTATTTGATTTTATTG AATTTATGAAGGTCAAAAGCCTTTTTCAAGGCTAAATTCAGTTAGTACTA ACTGTACTAAGTGTACCAAGGTGGTGGTGTTACTAACTTCTTCCGAGAAA GCAGTTAGTAGGCATGATGTCTTGTACTAACTGCTTCACCCCCCCCCCCT GATTCACGTCTTTTTCATAAGAACATCCAAAAATTTTGAACCCTTCAGAT ATTCTTAACTTTTTGAATTTCAAGCCTATAAATGTTCTTAACATGTTCAT TTTTTGAGTATTTTTGTCCATTTTTCTATGACATTCGGTGTCCTAGAGTA ATCAAAGCCTTAAAATGTTCTTAACTTGTTCTTAATATTTTGGCCATCGA AGCCTTATGTATGTTCATATATAGTTTGTTTTTATAAAAAAACGTGTACT GGCTTCTCATATGAAAAAAAAGCTTACCTTTAGTCCTGTAAAACAGTAGT TCTTTGATCGTCGAGACAACATTACTCTTCCAGGCATTCAATTTCTTCGA AGCATACACTGTTATATCCTTAAAATAAGTAGGTTCCCAAAACTTGATTG CAAAGCTTCTCTGGTAAATTTGATTCATGAACAACATCAGCTGATATGTA CCATTGAATCGAACAAGATTGATATCAACAGATACCCATTTATTAAGTGG AGCTTTATACTTTCCGTTTAACCATCTTTTACCAATTTCACCGGACATCT CCACAAAAATAAATCTCCTCTGAGATAAACCGATCTCAATTTTTCCTCGT CGTCCAATCAGATCGAATGTTAGTATAGAAGAATGTGAATTTGGTTGATG ATTGGAAAAGTAGACTTTGAAGGATAATTTCCATTGTTCAGGCATGTAGG GAAGCTCGTGAATCACTTTACCTTGCTCACAGATAATTTCTAATGCGAAA AAATTAATTTGAGATCCAAACAGACTGCAAGCCATTGAGTTTAAGGCCGA AAGCTAGAGACGAATCTTATCTGAAGTCTTAGGATTTCCGCCACATTTGT AACGTCGAATTGAAACCAACACTTTCTTTATTTCCCCGTATGGTATATTT TTATAGATTTAATTTCAATCTGGGGTTTATGTGAAAAACACGTGTTTCAA ACTTTTCAGATTGAAATAAATGGCTTCAATTCCCATCCAGGAGTTTCCCA CTCGGGGCTTTGAGCTCAATTCCAAGTATGGGAGAGAAAGATTCTCAAAT GAAGAAAATTATTCATTGGATTTTGTTAGCCACGACCTCGACTTTAAAAG CTTGAATTTAATAATAATTTAATGACGATTAGGTTCATACCTTCAGTTTT GTTTATTGCGTCACCTTTTGATACGATTTGTGTTTGTTCTGCCTAGAAAT AAAAAAATACATAGTGTCGGAGTAAAGGTACTGCTATACTGGATTTTTCG ACTTAGGAAAAATAAAATTTCTCTTCTCATTTATCCTAAAAAATTTAAGC TTGTTTGATTCAGTAACTAGGATAAATCTGCTGCTAAGTTGTGACTGATT AACAGTATTCCACGGCAAACTTAAAATCCGTAAATATAAAAAATCTTTAA AGCGTCGAAAACACTATATATTGCCATTAGCCGTGTCTAGTCTTGTGAAT ATGTTAGTTAACTAAGCCAGTCCCCAATTGAGACTTCGATAGAAACTTTC ATCCCCACTGAAGGTTGGTTAGAAATTCTCATCAGAGCTGTGAGACAGGG GTGTGATTGTGAAAATACAATCCCCTTAGAGACTGTTCATCTGACGTTTC CAAACCATCTAAAAAGAACGACAAATAATTATTAAAAATCGAAAAAAAGA ACGACAAACCCTAACCCTAACTATCAAAGAACGACAAATTTAACCATCCC AAACCCCCGACCTTGGTCAGTGACTACTACCCCTAAATATTAATTTCTTT TTGTATTTTACGCTATTTAACAACTAGCGGTTTAAAGAACGATAAATTAC GCATGTGTATAAATATCTATTTGGGTGGACATTAGATGAACTAACTCTTA CCTCCTTTTTCTCATAATAAACCCATCCATCAGCTTCGACAAACTCTCTG ACATCGCCATCACGAAAACTTTCTCTGTATAAAATACAGACTTGACTATT TTGATGATAATTTGCAGACCAGCATTCTGTGTGAGCTGAACAATGTATAA CGCACTGACCATGTGTTTTAGCTTGATCTTGATGTAAAAATAATGTAGTG TTTGGTGCCAATCGTTTGTTTTTTAACGGTTTTGCAAATTTGAAATTAAC AAATTGTGTGGAAACAAGTTTCGCGAATGAGAGCGATATTATGCAAATTA TTTTCCACATCACTTATACGCGAGATTTGAGTTTTACAATTTGACCAAAA ATCTTTCTTTTTGAGCATACCCTATTTTCCTTTCGAATAGATACAATTTT TATTATTTTGTTCCCTATTTTATATTTCTTTAATGAAATTATTTATTAAT TAATAACAAATTTTACTCATTGGTTCTGAATAATTTTTTTTCGAAAATAT TTTGGGATGATTCGCCGAGTAATGTTTTTATATTTTTTTGAAAAGCAATT TACATTTAATTATAAACAAAACTTAAGTTGAAACCCCCTCAGTCAACTAG GATTATATTTTCAGCCAACACAGTTAGGAGTAGAAAGAAAATGAAACATC CCTATAAATAATATTTTTCACAAGAATACTTAGAAATAACAAATTATATC ACCAACAATTTTTGATCTAGTAAATATTAACCAATCAATTTTGTAACAAA TTTAAAGAATCTTTTCAATCTATTTTGTACCTCTTTAATTTTTAACATTG TCTCAATTCAATTTTTTTCTATAATTTAGGTCTACAGATTTCAAGCTTTT TCTCTATTTAACAACAGACGCCGCGGCACCGGGGGGCCAGTCGGACCACA TTTTTTCTCATTTTTTTGCTAATCAAGCCAAATTTTATATTTTTCACTAA CCCCGGGACAATATATCCTTCACCGCCCCCCCCCCTCATGTACAAAAATT TTTCTTGAAGAGCCTAATTCATGTTTCCGTGATTCGAATTAAAGCATTTC ATACCCCCTGGTTTAATTGACTCTTTGTAATTTTAAGCGAACTAGAGAGA GATTCAAATAATAATTCTGAAATACACCGTAATTTCATCCTCGTTAGGGA TTAGAAAACAAAGTTTATTACGGCTAAAAAGATAGGATTCACAAGGCTTA AAGAGCAAGAATTTTCTCAGCCCCATTTAGCTCCAGCCCTTTAATTATGA TAGTTGAATATATAGATATGGTTCTCACAATTGACCATATCACGAAATTT AATATCAAGTTGGAAATAGTTTCAAATTATATTACATACAGTATCAAAAT GTATGGAGAGATACTCATGCTGAGTTTGAGTTGAAATAAAATTGCAAACG TCTTTTTTTGTCGTTCATATCTCTCTTTGAAGTTGATGTAAATGGAAAAG TTTATTACTATCGTTATAATTTTTTATAAGAACAGTTCTCCTCAAACTTC TTTCTCCACCAATTTGAAAAGTTTGATGATACTGCTTGGTGTATCGAAGT TTAAATGTCCTGTCTCACAAAGCCCCTTATATCCATCGATAACAAAATTA ATCTGAATTTTTATTCCCCGCGTTGGAAGAATAACCTTGAAAATTCCGCC TGGAAAAGTGCTTTAAACAATAAATCTTCAAACTCCCTAAAATCAATACT TCTACATCCCGCACCATTTAACTCCTTCTTCTGTCCCAACTGGCTGATAA GATCTGTAGCCGGTTGACAAGGAGACAGAAGGTGTCCTTATCTATAGATT AAGGAATATACATAGGAATAGATAACTAGCATCCAATTCAGATACATTGG CATTTAGAGGATATTTAATTGAGAGAAGAAAACTTAGGTTCAAAAATAAA TCAAAATAAATCAACTGAAAATCTGATTTTATTGAATAACATTTTCATGT TGGCAAATAAATTTCGAGTAGAGAGGATTCACCAAGAAGAAAAGCGACCT ACTTTCGTTCAATGAGACTTTAAAGCTCCATCAGCAATTTAGTGGAAGTT CTCAAAATTCAAGCTCGTTGAAGTTTTCTGATGTGGTGTGATTTAAGGTC GTTTTCTTGCGTTGGAGAGCATTTTGGAACTTATTTTAAATGAAAGTCTA GGCAATCAGGTCCATGATATAGGGCTTACTTATGACACTTTATCAAAGCT AAAAACTTATACATGGCATGATGATATAGATTTACGATTTCAATCTCGAG TTATAGCAGATTGAAATTGTTCTTAAAAGAAAAACTTCTAGAAATACTTT TGGATATTTTGTGTCCCTCCCCTTTATAAAAATACGTTATCAAAGTGTTT TCTTAACGTTTTTGTATATCGGTTATAAAAAAAGTTTGTTTTTAATATTG GTTGATTGGTTAGAAAAGATTAGTCCTGTAGTTTTTATAAACCTTGTGAA TTCGTTTGAAGCTTTTTGCATGTTATTTTTTCTTATCCCATAAAAATCAC GATTTTATGGAAACAAATGATGTCGGGAAAAATCTGCTTGTTGGGTTACT GGAAATTGGAATTAACGATGAAAAAAAATTATAATCTTGACGGGCATATC TGATGTCGGGTAGAATCTGCTTGTTTAGATGGAATGAATATCTATGAATT TAGCAAAGACATTGTACAGCTTAACATTTATATACTCAGTAATTGCATGT TTAAAGTAAGCTTTTGTCCTAGTTGACAAACAATATTAATGCAAAGTTTA TGCCTAACGTCCTTTATGGACGTTGAATGAAAGTTTTTATGACGTTCTGT TCTAGGTGGATCAAAATTTGAAACATTTGAATACTATTGGTCTTTCTTTT GTGTTTTGTTTATTGCTGATATTCATGATATGCACCATTGCAATGTCTTC CATTCCACCCAATAGCTGATTGGTTGAAAGTGACGTATTGACTGATTTTA CGTCACTTACAACCAATGAGCGATTGGTTCCGTGATGTAATGTCAGAAGA ATACTAGTTTCGTTCTATTTAGAATTTAGAATTAGATTTTCAGATTTTTT GGCTTTTTTCAATTGCATTTAAAGTTCACACTTTGCATTGTCATGTCCTT ATTTGAGACCTTTACAGTCTTTAGGAGTACGGATCCTTTTTTGGAGCGCC AGTGGCACAACCTCAGCGTCAAGATCCCTAGAATCTCAGGACCGGTGGAA GCGGGGAAACTAGGGAGACTTCAGCCTCTCCACTTTTGAGCAAATGAGAT TTGTTCTCGAATTCCTAGCGAATTTTATCACATTTTGAGCCTTCAGCCCC CCACGTTCACGGTTGATTCCGCCGGGCCTGAATCTTCAAAAGTATTGTCT GTATTTCTCTTTCTACCTACGATCTATCATCAACGTGATTTCAGTATTTT TCTGGAGATTATCCTCATCTACAGCTCCCCTCAATTAAAAATGTCATTTG CTGTAATTGAGCTTTTGACGTGAAATGGTTTTGCTAATTATTGATTTAAA TTCCCATCTTACAAACTAGATTATACTTTTTGCTCTCTATCTATTTTGCT TTGTACTATATCCAACAGCATATTAGCCGTTCGTTGAGGAAAATCTGTCT GTATTTGTGTGTCCTTCTACTGTCAAATAATGTAACGAGACTGAAAACAT CACCGTGAATTTTGAGGTGAAATTATCGGTGAAAAGTTATCTTTCATCAT AAATCCTTGAAAGAATGGGACTTTTTAACGATTTTTCGCCCAAAAGAAAA AAGGTGATTTTTTCCTGTGAGAGTCAAAATTGGTAGCATTTTCTCGTCGT TTTTGGTGTTTGATATATAGGAGATATCAACAGCAAAAGCAACAAAACGA TTTTTCAATGTTTCGTTGTTCTACGTTATGGACGATACTTTGATGTTTTT TGATGACGCACAACTTGGTGGATTCCGATATTGGTTGACTGATCCGTTGA ATTATGATGTTTTGGAAAATTATCATCTCCGTATATTCTTGCAAATTGTT CATACCAGTCCATTGGGAAAATAAATAAGGCTCGATTGTTCTTAATTTTT TATACTCTTAGCCTCAAACGTTCTCATGTACCCTTTTTTAATACTTCAAC TCTCAAATATCTTACTTTAAACTCAGAAATTCCAGTCTCATGTTTGTTCT TAAATTGCTCTTCTTTTTTGAGCTATGAGCCTCGTTGTTCTTATGAAAAA GGATAGTTTTAAATGATGATTGTCAATTACAATGTAAATTGGTCACGAGT CAATTTTTCTTATCTCAATATCTGATGCTATAATTTAATTTGATCAGATG GAGATTTTTTGATATCATCTCTCGTTGTTTCAATCTACGTTTGCTTATGT TGTGAATATGCAGAGCGTTGGTTGGGGGTGGTTGAAGATGCAAATTGCCA ATTGGCACACAAAGCGTTGATCTAACGTTAATCTAACATCCATATCGTCC ATTAATGTTGTCTTTTACCGTTGAAGCAGCAATGTGTGTCAGTTGGGCGA ATTGCAAAGAAGTTCTGTGACACCTGGGCTGGGTTAGCAAAGGTGGATCG ATTCTTCGATCGATTTAAAAGTGTGCTTAAGAAGTAACCCCCCCCCCCCC TNTTGGGCGAATCGCAAAGAATTTCTGTGACACCTGAGCTGGGTTAGCAA AGGTGGATCGATTCTTCGATCGATTTTTAGTGTGTTTAAGAATTAAACCC CCCCCATTAAGTAGATTGAATAAACGAGTTTCTGAAATTTCTACTTATCT AACTTTTCCGGTTCGATCTTCCATTATTCGACTTGCATTTTGTATTGCGA ACTAAAGTCCCTCAACCTGGAAAATCTTGCGAAATACTTATTTAGAGACG TATTTAAAGTCTATTCACGATAAGTGTGCACTCTTTTTTCTTTTACCTAT AACTTTTGAAGGAATTCTTCAAACTTTATAAATTTGGTATCGTTGGAGAG ATATTTGTGAGTGGAACAATTTGAAATAAAACAATTTTCAAAAAAATTCT AAAAATGAAGATGAAAATGAAGAAGAAAAAAATGAAGATCTTGTAGAAAA GTGCTATAACTTTCATTTTCACTGGAGAGATTCTTTGATCTTTGGAGGTT ATCATTGTGAAGAAATTTCACTAAAATATTCATTCAATACAAAGTTATGA TACAAAGTTAATAAGTGATTGACCCCAAAAAACAGCAGAAAACAGCAGAA AACAGCGTTTTTAGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATAATCAAGGTTTCACT TCAGTGAAAATGATAGTTATAGCACTTTTCTACAAGATCTTCATTTTTTT CTTCTTCATTTTTATCTTCATTTTTAGAATTATTTTAAGGAATTTTTTAT TTCAAATTGTTCCGCTAACTAATATCTTTCCAATGATACCAAATTCATAA AGATTGAAGAATTCCTTCAAAAGTTATAAGTAAATGAAAAAAGAGTGCAC ACTTATCGTGAATAGACTTTAGAGTACTACAGTATATAAGATCGAATTAG ATAGAGAACTGTATTGAGTTTGGACGAATATCTAGGGCTGTTTAAAGGAG AGAAGTCATGGGAATATACTTCACTTACAAGGGTTTGTTAAGTGTTTTGA ATCTGTGCTTAATTTCCAAGTACAATTTGTATCAAAGAGCCTACAAAGAC AGGATGTCTTGAACAGAAAATCAGATTTGTAATTTCATTGAGCCAAGCAA TCTAAATTTTTATGTTTCCGTCATATCAAAGAATTTAGACAACCCTGTCT GAGGTGCACCTATCATTTGGGCCCGTTGAAAGCCCCAGTGCAAAAGACCA GTCAAATCTTAGAAATATACGGTGAAAATGGTTCAAATTGTTGTCATATG TCCTATTTTTCCCTGTCTTGACAGTATTTTTGAATAGTTTCGAATCTTAA ACTTTATATTTATTACATTATAAGTCAAGAAAGCTATAAACTTTTGTGGT CCCTGAGTATTTTCCTTCATTTAAAAACATAACAAAATGCTTGAAGAAAA GAGAAAGCTTTAAGAGGCTATCAACACCAAAAAACTGTCTTCAAAAGTGA CCGTACTTTGATAAGGTTGATAGGCTTGATGAGTGGTTTTTCTACTGGTT TTCCTTCATTCAGCTCTTAAGAGTTTTTGATGAGTGTCTTGAAATGTCCT GTGATGTATAGTCTTGTTTTGGTTGGTTGGATCTATCAATGTAAAAAATA ATTTAGGTAGCGGGCGAAATATTTTTGAAAGGAAGCAGCTAAGGGGATGC TGATGCTTATTTCATTTGACGACTTTCGAAGAGTTAGGAATGTAAATGAA GCCATTCTATTGGTTACATTCAAGTGTTACGTCACTTCTACCCAATAGAA TGGCTGCGTTTCTTTTCGGAGCGAAACGGAACCGTCACGTGCGAACATGG TCTATAACATCAGCCATCTGGCACGCAACGCATTATTTGACGTTCATCTA ACGTTTTTGTAAACGCTCTTGGTATTGGATAAACGTTGCTTTGTGTCGAA TGGGCAGGAATGGTCATTTAGGGGGTGTTGTGAAAGATAATGGGCTTCAA CACTAGCTCATTAAATCACTGATAAGTAGAAATGATGGTTTAGCAAATCT AGCAGTTTTATCTTTCTTGACTTATTACGTACACGCTTTATTTATAAGAA TATCCAAAATTTTTGAAGCCTGTTCGAGATGTTTTTAACTTTTTGAGTTT TAAGCCTAAAAATGTTCTTAATATGTTCTTATTTTGAGTATTTTTGTCCA TTTTTCTATGAAAATATTCTTAACTAATTCTTGAACATTTTGGCCATCGA AGCCTTATGTTTTTATATAGTTTGTTCTTATAAGAAAAAAGTGTATTCTC GACCCGGTGTTGTAATTTTTCAAAGTTGAAGCATTCCGACTCAAAAAGTT TTAGAGATTGATCTATTAAAGATGTTGTACAATTGACAATCTTCATAAAA TGATTTATCACCAAGCGCGATAACCTTTTTTTACCGCGCTCGATTTTTAG ATGACAAACTTCTTTTTTATCGATTCTGACATAACAACATCAGCAATACA TTATTTCCCTCTCGTTTTAATCTCTACTCTGCTTTTCAGAGATAAGTTGG TATATAATCTTGAAAAGAATTTCTAATTGCCCCTTACAAGGATCAATTTC TCAGAGTGATTTACATTTTGTTAACGCTTGTAAATTTTTCTGTTGATTTT CATGGATNCTCAGAGTGATTTACATTTTGTTAACGCTTGTAAATTTTTCT GTTGATTTTCTTGGATCGAAAGTTTCGAGTTGTTTTAAGAGTGTTCAACT GGCTTGAAACACTGTGTTTTAACGTCTATCTACCGTCTTTGAATCTAACC TCATATGTTTTAGTCGCAAATCACGTTGTTTCAAATTCTACCTAATTCCT ATAACATCAATAAACGAACGTTAAAACAACGTTGCTTGCTATTTGAATAG GTGCGAGTTGGTGTTAACTATATATTTTCGACGAATTGAGCTTTTTTCGA TATAAGATTCTTCTAAGTCTTTGGTGAAATCTAGGTTTCATTGGCTTGTG ATCATAACTACAATGTACAGGTACAAAAGGATGCTTTTTACGTCTTCAAA TTGAACACAATTCTACAAAATTGGAAAAATCTTGCCTAATTTGTTGTTTA ATATCAATTTCTGTCATAGAGGGAGACAAAAAAAATTGCTTTGACCCACT GTAATTAGCATTGGTGTGTCCACTAAATTCCACAATTCTGTTTCTAAGTA ATGGAATGTGACCGTGCTTTTGTAATAAATTCACAAAATATCACAAAAAA GTGGCGTAATACTTTTCACTGTTAGCTTGCTGATAAATTCGCAAGAAAAA ATTATGGATATTTTTTTCATATTATGGTTTATAAGGATTGCCACTGAGGT TAGTTTCCTGTTATTTGGCTCAGGTTTTTACTTTTTTTTCTCAACTGATT TGCGATTTGGATTTTTGCTTTTTTGCTTAAGATTTCTAGCATATTTGATA TTTAATTTTGAAACTTTATTTCAACTTCATTTTTATAAGGTTGGGATTTA CACTAAATGCATCTCTCTATTACGGGTTTCGAAAAGAATCTGACGTGCTG GAGTTTCAAAAATATTTGAATCGTAGCAAGTGTATTTTTTATGAGAGATG ATTACATCTATAGACTAAACTTTAGTTCCATTTTCGAAGTTTTGAGAATT TTAAGTAATAAAAGTTTGAATCGCCGATAGTTAACCTGATAACAGNCGAA TTAAAGAATTTTAATTAATAAAAGTTTGAATCGCCGATAGTCAACTGTGA CCCGTGAAATGATTTGTCTTCCAAAGATATTTTTAATTATTGAATGTGTC TTAATGGTTATGGTAAAATGTTTGTAATTTTAGGAACGACATCGCTTTAG TTCGAGTAATGGCCCCTACGTGGAAGAGGTTATTTTGTCAGTTTTTTTGT CAAAATTTCTTCCGACGGTTTGATGGATTTTGTTAGTACACATCTTACAG GCAATCCCTGCATGATTTGTTTAAAGACCACGTTTACATGCTACAGTTTT GGTTCGCTGCGAAACGAAATGAAGCCATTCTATTGGTTACATTCAAGTTT TACGTCACTTCTAACCAATAGAATTGCTTCATTTTGTTTCGGAGCGAAAC GGAACCGTTACGTGCGAACATGGTCTAAAAAAGAATGAATTTTAAGTTTT GAGGGCATTGTTTTAGAAATTCAGGACAAGCTACTGTGCGATATTTGATG ATAACTATCATGCCTCAATGAGTATACTATCAAACCAAGTTGTATCACAT AACTTTCCTCGACTTTAATTTTCTCTTGTCAATGAAGCTATCAATCGGTA GCAGGACAGTCTAGATGTGGTCAAAGAAATGCATTTTAAATAGGCTTAAT ACCCTCTTAAACACTGCAGAGTCATTCAAATCCATTGCCGTGTGTTAGTT TTATCTAAGAACCTTTAAACACTCAAAAATCGAGATGTGAGAAGTCAATT TTTTCGCATAAGTGTGTTGTGCATGTACAAAGACTTTTGCTAGATATTTA GTCATTGACATTTAAGGTACTTGAAAGTTATTGATAATTAGTTACGAGCC ATGCCATATAAATTGAAATTCTGACTTTTCTTTTAAAGTTCCGACCGAAA ACATATTCTTATAACAAATCAATACTTTGATGTTAAATGAACTGAGTCAA TTAATTGATTGCGATGGATTTGTAAAATTAGGGATACTGCTAATTAAAGG CCTTTTTGATTGCATTTATGTATGATAATTTTGTAGTATTTGAGGAAAAT CGAATTTGAAAAAGTTTTGGAATCTTTTCGCAATGCAAACGTTGTTACGC CGTGTTCAATGTAGACTAGCAAACTAGTCTGTTAATTAATCATGTCAGAC GGTGGGAACATAAAGGCGGGTGGGCGTTTGTTAGAATAGGAGCTGCGTTG GAGAACGAGCAAAAGTTGATGAGAGGCTGCTGATTAAGGACATGTTTTTT TTTTACTGTACCAAAATCAGGTTTTCAAAAATCGTGAAAATCACTTTATT TTAATTATTTCGTCATTCGCAATAAAATTTTCCCAAAATTGAAATTTGGG AAGGGCTTTAAAATGAGCTATTTGAAATTTCAAAATTCGGAGTATTTCAG GATTAATTAATCATAGAGTGTTTTGAATCATATCTCACTCCATGACTCAT TCTTCGGTCCTGAGGAGGTTTCTATGCATTCCTGAGGTAGCCTAAAATCA TAAAATAGCCTGAGGAGTAATTTTTTTAAAGGCCGGAGTGAGTTATGATC AAGACTTTTTTAATCATTTTTCACTCATTTTAACAATTCCCGTTTTCTTT AGTTCGTTCCTTTCTTATCAACTAAACAAAAATCTCAAATCACCTCCCCG ATAGATGGGGATGGATAGACTTGTCAGGAAAATATATACTAAAAATATAA TTCTACAATTAGCACCTAAATTCAATCCTTCAGCTACACCTTGATATAAG TTTCGTATATAAACTGGACACGACAAAGGCCAAATATAGAGCCGACTTTA TAAATCCGAAATAGACTATGATTTTTTTCATCCTGAAATACTCCGGATTC AACAAGTTCCATAAAAGCTATTAAGATCGGACAAAAAGTATCGGACAGAG CTACTAATCTATTTTCTTATTTTTGAATAACGATAAGAAAGGGTTTAGCT GTATCTGTTAGTGTCGATTTGAACCGGGTTGGTTGAAAATCGGCATTTTG GTACAGTAAAAAAAAACATGTCCTTAACAGCCCTTGCCGCCAACAAAACT TCAGCCTACGCTTACCTAACTCCTACGCTCACTTTTCCCGCGTGATACCG TTCTAGCCCGACTGGCGTGCCAGTTTATGTTTAATGTGGATGTGCATGAA ATATGCGTTTTGTTGATATCTTAGCTTGAAAAGGGAGCTTTAGAGGTCGT TTAATTAACCTTCTCAACGTCCGATGAACATTGTCTTGACGTTTGACATC AGCTCTTGACTATTTGCCATTTTTCTTTACTTGATGAATTGCTTGAAAGA GATTTTTTCATTTTTTAAAGGAAAATTTGATAGTTTTCACCAGATCTCCT TATTACATATAGGTAAAACTCAGAAATTCTGTTTCCACTTTGATGTTTTT ATTGAATTTAAATGTGCTAAAAATGGGGAATATTTAAGTTTATTTTTCAT CTGCTTGAGAAACATAAGTTTTGAATTTTTCAAACTCACGAAAACTTACG TTGAATAATGGGTAAGTAGATGTTTCCTGAGATGATGAACATAGGCGATT TTAGACCCTGTCGAACTTATCAGATAAAGAGATTTGTAATTGTAATTTCA TTGTTTTTTAACGAGCGTTGCACTCCTTCGCATGTTTCCGACGTACTTGG TCTATTGTCTTAAATCCGCCGGTGATAAAGGGCTGTAGGATAAAATGGTA AATCGATAAGATATTTTTAGAAACATTTTCTTAAATGTACCTACTGCTGA TCTGATATATTCCCATTTGTCCACTATTTCTCTCAGTTTGAACCACAAAT GATTTTGTAGTTAAGAGATGCTGGCTAAATCGATCTGTCTAGTTAAGGTG CAGTCCGCAGTGCTGATGAGTCCCAATAAGGACAAAATGCATATACTGCT CTGCTACTCAATCTCCTGAATTAATATATTTGGACAGAAATTCTTATTTC TTCACGCATGCATGAGAGGACGGCTGGTTGTAGGTGCAGATATGTGATTC AATGCTGATTGAACCTCAAATTTGAACATTTGAAAAGACTGTCTTATGGG TGGGGATCGCAGAGTGGTGGATCTCAGGGGGTTCAAAACATAAGACGAGG AGTCTTTCATTTCCTTACAAGGAAGATGGATAAAGAAACACTCTGTATAT CTTTCAGTGGGTGTAGAAACCATTTCCCTAGGATAGGCTTAATAGCTTGT TGGTTGCTACATATATGTCAATTTTATACAATCATATTTTTCTGTTTACA CGTTTATTTTTTTATAAGAACATCCAATATTTTTTAAGCTTTTGAATTTT CTTAACTTTTGACTTTTAAGCGTAAAAATTTTCTTAACATGTTCTTTGTG TTCGCCATTTTTTGAGTATTTTTGTCCATTTTTTTTTCGGGAGTCTGCAA AGCCTCAAAATGTTCTTAACTTTCTTAATATTTTGGTCATCAAAGCCTTA TGTTCTTATGTAGTTTGTTTTTATATATAAAAAACGTGTATTCATGAAGA GTTTGGAACTTTCCTCAAAACCTTTTACTTCTTGTCGTTATAGAAAAAGA CGGTTCAAACAAAGTCCGTGATATCACCACAAATACGACACAACCCAAGT GGGCCATTCACACTGCAGATGATAAAGAGTGGAAAAGTGATTTTAGTGCA AATAACAACTTGGTTTTAAGTCCAACAGAAAATGGTGACGGTACCCAATC TTCTGGATTTCCAAAAGCTTCTTTATTAAAATACGAAATCAGGCATTTAA CCAATTTAAAACAAATTGAAGGTCCTGAACAATTTTTATCTAAGAATACG AAAAATCCATCGGTCCCGATTACCGAGCAACGAGAAAACGAAAAAGCCGA CGGTAAAAGCGACTCGGAAGACGAGAATATGACCGAACGTTTACGATCAA CTCGGTATTCGAGTAGTAGAAACTCGGATGATTTACTCGGCCGTTCTTCT TACCGTTCAACCCGAACTTCTTACTCAGATGACATTGGTGGATTAACACG TGGTACTAGCGCAGGCAGTAGCCGATACCGTAGAAGCGTACTAGACGACC CGCTCGATACGTACAGAAGTAGCCGTAGCTCGAGACGCTTAGATGATTAT ACACCAACGACTGATTATTCAACGACGTCATCTTCCAGATACGACCGTCC ATACCGTAGTACCACGTCTGCAGACGAAACTCGCTCTTATCGGACAACGT CTCGCCGTACACTTGATGATCCGGTTATAGAATCACCGAGACGTTCTCGA CGATCAAAAGTGAACGGTATTGACACAGCGATAACGACGACATCTGTTAC AGCCACGGTAGATGGAGACTGTAATAAGTGTAAAGAAAAACAAGAAAGAA TAATCCAATTAGAAAATGATAAAAATAAAGAGTTTGAAAAATGTAAAGAA AAGGATTTAAGAATTGAGGAACTAGAAAAACAATGCTCTAGGGACTCTGA AAAACGGAAGGAAAAGGATGAACGAATTCGAGATTTAATTAAAGAATTAA AAAATGTTTCCGAAGACGTTAAATCGAAACAAGAACTGGTTAAAGANAAG ATTTAATTAAAGAGTTAAAAAATCTTTCCGAAGACGTTAAATCGAAACAA GAACTGGTTAAAGACCTCGAAAGCGAGTTAAAAACGCAACGTACCAATTA CGATCAGAAATTAAACGATTTACAAAGTTTGGAAAGCGAGTTTGTCGAAC AGGAAGAAATTCAAATCCGAATGGAAAAAGATTTAAATGATCGTGAGGAA CGAATAGAACAGTTAGAACATGAAATTCAAGTCGAAAGAGACACGATAAA ATCGAAAGAAGATTTAATCGAAGAATTAACGATTCAACTCGAAGAGCTTA AGGAAACTTTGGAAATGAAAGAGGAGAAGATATTGGAATTGGAAAAAGAT TTTGAGAACGCAAGTGTTGCTCTTATGAACGGTATCAAACAAATGGAACA ACAACCTCGATCTGGTGAAGATATACACGAACTGGAGGCTCAATTACAAG ATAGTTTAGATGAGCGCGATGGTTTTATGAAAGAGATTAAGAAACTCGAA CGAGAGCTAAAGAAAATCAATAATAGCCTGGAGGAAGAGAAAAATCAGAC ACGCAGGCTAGGAATTAAACTTGAGGACGCAAATTACGAGATCGGGAGAT TAAGACAGGAACTTATCAACTCGCAACTGGAGAACGAAAAAATAGTGGAA GAAAACGAAGATTTAGCTGTGGATAACGAGGATTTGATCAAAGAGCGAGA TGAGATTATACAAATTTACGAGGAATTGTATCGAGAGAGTGAACGATTAA AACACGAGGTCAAAATTTGGAAGACTGTGTTCGATAACAATAAAGATAAC ATTGATGAGGATGAAATGCGAGAAGCGATGAGCGAAGGTGACGCACTTGA GGAGAATGGGAAGGAGTCTTCAGATGAAGAGGTAAGGAGAATTTGGTATT TGATCTTCCATCTTACGCTTCTATCCATCCTGGATCCTAGTACCCCTCGT GGTTCTTTCAAAAGGGGGAAGGGGAGCTTACTTGATTTATCGATAAAGAA ATAGAACAGGAGTTTTCCAACTAACCGGGCTTACCTGTTATACTCGGGTA TAATCGGAATCCCAGTTAAAACATTGCAATGGTGCATCTCATGAATTACT GCCGAAAACGGGTTCACTTATATTCATGATATGCACCATTGCAATGTCTT CAACGGATACAACAGCTGATTGGTTGAAAGTGACGTATTGACTGATTTTA CGTCACTTACAGCCAATCAGCTTTTGGGTCCTCAATGTAATGTCAGAAGA CAATGCAATGGTGCATATCATGATTACTACACTTGAAGCTCTCTAATTCG ACGTACTAAGTCGCCATTGACTTAGCTACCGTAGTACAGTGGTAGAGCAT CTGGCTACGGTTCGCAAGGTTGCGGGTTCAACCCCCAGCCGGGTCATACC AAAGATTCCCAAAATGGTACTTGATGCCTCTCTGCTTGATGCTCAGCAAC TANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN TAGCTATCGAAAGAGGAGCCTTCGGGTCGCCTCCGACTGCGGTCGCAGAC TTACTTACTTAAGTCGCCATCAACAAGTAGGTTACTCTCCCAGCAGCAAC TGTAGTACTACTTTACTACTAACCAGCGTATTCTTTTTATTTTCAGGAGC TGATAGAACTCGAAGAAGGTAAGTGATTCTGTATTTTTTTCCTATCAAAA AAGAATATTGACCCTTAAAGAGAAAAAAGGATTTCTTAGGTGTAAAAACT GTACTCTTACCGCTCATAGATACCCAGCAGCAATCTTTCCTATATATCTA AATTCTTGATATGCGAACGTATCTTTTCTAACGTAAACACCCGAAAAAAG CAGGGATTTGACCCCTGTTTGTTACTAAAAATAGAAACAAAGTGGAAAAA ATTCGGCCTTTTTGGGGGCTTTCCTTAGAAAATATGAAGATTAACTCTTT AATCTAACAGGGACATATTTGTTTACTTCTAGACCAATCATTGCTTGTTC CTCCACGTGATGATATTCGAATCAAAGTCACAGATGTCTCAAAAGCTTTC GAACAAAGTGAAGAAATTTCAAGGTCTGTTTAATCTTGCAAATTGATGTC ATTTTTTAATATTTTCAATTAGTTTTAGCCAATGAACGGAGAACCGTAAT TATCATCAAAATTTTTATCAACGCTTCTTGGCATGTTCTGAGCATAGACA TAGTTCGTTTCGTGTTTTTCAATTTTTGAATTAGCACATAAATTTATTGA TATTTGCTTTAGATAGATAGAGATGATATTTTACGTGGATAGCCCAGTAA TCTAGGACTTTTAGACAATCTTTCGATTGTTTTCACGGGGTCCACGGCCA GCCGGCTCGGCTATCTATGAACTGAACGTTGGAAGGAGCGGGGATTTGAA CCACGAATCCCTGGTTTGAAACGCTGACGCCTTTGACCACTTGGCCATCG CTAATTTTACTCACTGATTGTGAGTTGCAATATATTGACAACAAAAAGGA TCTTCTTGAAAGAAATTACATAGGTTAGGACGATAGTACATTTTCTCCAT CCCGGACATGGGAATTTCGATTCCTCCCGAGAAGTTTTAGAAATATTTTC TACAAGCTGTCAGTTACATTTATTTCATTTTAAATCTTTCAGAGGTAAAT TTGGTAAAGTATACAAGATGGTAGCCCGAGCTACGGGTGACACCTACGCA GCAAAATACATCAAAGTCACACCCAAACTTCGCGAAGACGTTCTGAACAC GATTGACATTATGAAGAAAATACATCATGTTCGGTTGATGAATTTGTTTG ATGTTTACGATCTGGGATCACAGATTGTCATGATTCTAGAATAGTAAGTT TTCCTATTTCAAAAATTAACTTTTTTGGCCATTGTCGTGTTTTAGGCCAA TAAAAAGAGGCGATTTATAAGACGCGGGATTTTCACGACCAACTAAAGTC TCTAGGCCAAACAACAAACTTTTTCTATCTTTAAAGATTTCTAAATATCG TACACGAAAATCCTTTGCCTATGAACTTACATCCGAAAATGGTCATGTTT TCGTGTATATTAGAGCCCCCTCTTTTCCCAGCTGCCACACAGAATGTCAT AACACGTCGTTAGATGACATTAAAATAAGGTTTAATACAAAAAAAGGATC CTATTTATTGAAAGTCTTCTTCTCCAAACATGTTCGTGACCAATCAACAA TTTACGTAAGACCTGCATTGTGGTGGGCAACAGCATCCTAGGGTATATCA GGGAAGCAATAGAGATTTCTAACATTATGTAAGCAAACCTTCGAATCTTT AGAGGCAATCCCTTACGCAACTCGAACGTTTGCTACCGGTTTTTGTCAGT AAGGGCAAATTTTTAACAGTTTTTCTCTGGCTTAAATTTTCCACGGCTGG GGTTTTACCGTAGAAAATATTACGTCATAAATTTTTTCACTGTTTTTCTA TTCAGTGTTGGCGGAGGTATGTTATTTGAACGTATCGTGGAAAAGAATTC ACTTACAGAAGCGGAATGTGCTTTATACATCAAACAAGTCTTGCAGGGAT TACATCATCTTCATCTACAAAATATCGCACATCTTGAGTTGAAGGTATGA CCAATTTTTATTACTTCAAAAATTCTTCATTGTTCGCAATCTTAGGTTTA TCTTCCACAAAAATGGTATATCTAGTATTGCAACTTTTCAAACCCGTCTA GTCTGGGTGTAGCCTGTCCTGTCAGTAAAAAAAACTAGCACATCTGGTAT TGAAGACAAGGTTGAAGGTATCACCGATTTTGTATTTCCTTTGAAAAAAT TTCATTTCTTAATTCAATCTCTCACAATTGATGACATATGCACGATGTCT CAACTTTTGAAATCAGTCTAGTTAAGATAAAAATGAACTCCGTCTTGTTA GTAAGAGGGGTTTTGTTCAAATGACCCAACCACAAAATACTGAAATGCCG GTAGTTTTTTCTTGAAAAGGTTCCTCAAATACACCGATCAAAAATGTTAT GATGAGTTTCGGAATACCAGAAAATCGGCCTTTTGATACCGAAATACCGG TCATTTTTTCGTCAAACAACGAAATATACCGGCCAATACTGGATTTTTTT CAATGGAAGATATCTAAAAATTTTTTCCATTTTAACCGTATAGCCTGAGA ATATTATTTGCGTGAACCGTAGCAACATGGACATCAAAATCATTGACTTT GGATTGGCTAAACAATTGTCACATGACAAACCAATCAAGATTACCGCTGG GTCGCCGGAATTTGTGGGTAAGTTATGTGAAAATGAAATCCATTTTTTTC CTTCGTCTTTCTTTTCTTCAGCGTTTGGGTAATCAAATAACAGATAATCC ATTCTGGGCATACCACGCTCCGTTCTAAAGAAATATGATGAATGTAACGA TCCTACCTTGTTGATCAGCCAAAACAATCAAAACCGCGTAGCCTTTTGCT TGAAAGCGAAAGCGAAAGTGACCGCGTAGCCTTTTGCATGAAAGCGAATG CGAAAGCGAATGGGTGTTAATGTTTATACGAACGAAGTTTGTTTTGGTGT GATTGTTTTGCTTTAGCACCGCTTCTAAAAGCTCATTAATATTCATCCAA AATCTGGATTAAAAAGATCAAAGTGCTAGCCTGGGCAGAATCTCTTACAG TACTATGACTTTTAGAGTGAATACGTGCCAGCGTGGAGTAATCAGATTCT GATCGGAGATAAGCGTTTGGGATGGGTGTGCATGCACAATGGGAATAACC GAAATAGAAACATTGTCATCATTCATAAAAAATTTTTTCTTTACAATTAT AGCAACTAAACAGAAAAAACAAAACCGTCCTTTAATAATTTTCATTCGAA AAGATTAACTCTACTGGATTAGATAGATCAAGACTACCCCCGGGCAAAAA CCTCCATAACCCCGGTAGCCGAAAATGGGTNTTCACTTATTTTCTAATCG TTGAACCGAAAATAACTTTATTTATTTACTGCACCTTCAGATAAACACAC GGAAAGACAGAAAAATTTGAGAAATTTTGATATTTTTTGAGACAGGTTTT GACCACTTTTATTTAGCTTAGTAATTCATCGTTTCAAGTGTGTAGACTAA AAGCATGCGAGAAGCCTAAATGGAAACTACGTTTAAAGTAAGCAAAATTA AAAGCCACCGAAAAAAAAAATGCCTTCTATAAACCTAAGTTCCTCGAAGT ATATAATAAATTCTCTAAATCTTCCGATATGTATCTGTTTTTGACCCCGA CTGATTTCCATCTGCCGTGTTTCATTATCAACCGANNNNNNNNNNTGCCT TCTATAAACCTAAGTTCCTCGAAGTATATAATAAATTCTCTAAATCTTCC GATATGTATCTGTTTTTGACCCCGACTGATTTCCATCTGCCGTGTTTCAA TATCAACCGATCCGGAACACCAAGATTTGCAGCTGCAAACGCTCCGCCCG AGGGCAAACTATGAACACCATATTGCTTTTGGTCCAAACCTATGTCTTTT ATCACCTTCTTGATATCGTCACGTACCGAACTGTAAGAAATTGGCTGATC TTTATTCCATAGACGATTGTTTCGTTTGGATTTAGTTACTCCTCTAAAAA TAAAATTCTCAGAATAATTTTTTATGTTTGCCAATTCGAGGTACCTTTCC AAACCTTTTACCGGACACAGGTTTGAATTAAGTCTCGCAATGTAAACCCA GTGGCCCTGTCTGTATATGTCAGTTTTACTGCTTTGGATAAAAATTGTAG CATGATCATGAAGGAATTTTATATCTGATCTTCTAAGCTTTTGGCATTCA TCGAACCGTAGAAAAGCTGAAAAGGATAGCAAGCATATCGCTAAAGTCCT TGAATTTTTGAGGCTAGAACCAACGTCTAATTTTTCAAAAATTTCTCTCA AATCTTCGACTACAAAATTTGTCTTCTTCTTTGGTGTATACGCCAATAAC CGTTTAAAGGCTTCCAATAGGTGCTTTACAATTGTAGAATTCCCGATCAA ATACCCCGAAATAGCATGAAAATGTTTTATGGCGCAATAAGACGCTTCCA AGACTTTCCCGATTGAAATTGGGACATCAGAAATAAGATTAAATGTTGCT CTTGAGTAGGTAAAGGGTTCACTTCCTGGAAACTACGACTCCATTCTTCC CATTTTTGGAAATAAAACTGATACTTAGCCACGGTGTTATTGCTTCTGGA ATTCAAAAGAATTCCTGGTAATTGCTCAGAGAGACTCTTTAGTGCTGGAT CCTGGACATCAAAATAGTTTCCTAATACGGTTTCTGAATCTGAGCTAAAA AGTAAAATTTTTTGTTAATTTTCTGCATTGAGAAGAAAAAAACATTTATT TTTACCGAACACACGTTGATTGTCACACTTGTAATTTTAAAGCTAGAATT GGGATTTCTAATTTTTCATTTCCCATCAGAGAACCTTGGAATCATCCTTT TGTGATTAATGCGACTTGATTTGCAAAATATCTACAATCCTTGACAAAAG GCTTAAAAGAGCTATTATCCCTGATCAGAAAGGTCCAAAAGGCTGCCGAT GGCCAGAACGGTATTATTAAAGTCCCTGTTGTTCCAGGTTTGGCTNTGCC GATGGCCAGAAGGGTATTATTAAAGTCCCTGTTGTTCCAGGTTTGGCTGC TAGGAGATGTTTAATACACTTTGTTATTAAATAAATAGGTGGCACCATTA GAGCATTTTCCCCAGACCAATCAAAACTGAATGCGTCTACTTTGAATGAA AATGGACAAAAGTATTTTGAGCAAAAACGTGCCCATTTAGTGTTAGAATT ATCAGCAAAAAGATCTACAGAAAAAGGTCCCCAGAGTCTATTTAAAAAGG AAAAGAATTCTTTTGAAATTTCCCAGTCATCATAGTCAATACTCTTACTT ACTGTGTCCGCATCTCCATTTAATTTTCTAGCGATCCACGTAATTTTTAG AAAAATTCCTTTTGCCTTACACAAGTTATAAATTGTATTTGCTAAAAATT GTAGTTTTTCCTTATTACTTCCAACTTTAACAATTCTTGCAGCGGCAATG TTGTCTGTGTGCCAGAGAACATTGTTCCCTTGTAGTTTTGAATTGAAAGC ATGCAGCGTAAAAGCTATTGCTAATAATTCCCTGAATGTTGAACTCTCGC CTTGTTCATGAGGCCATAAATTTCTGAAACTTATATCATTATCCGAGATT GCTCCTATTCCTTTGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNGTCTTGGTGTTTCAGTTGTGATCGTTG ATGCACTAGATTGCTTGAGCTTTTTCTCTCCAAATAATAAGCTTGAAAAT GTTTCCATTTTTCCCACATACAATATACAAGAGAGTTAGAACGACGTGTG ATTAGTTTTAAAATGTCTACCATTTTTATTGCACGCGAGAACAAGAATTT CAAATTGTTAATTTACAGAACGATAGCAAAGGCTATTATCTTTCGGATGC CGTAAATAAATTCACATATGTTAAGCTTTATTATGTTCTTTTCTTTTAGC ACCGGAAATTTTGTCATTCGATCCTGTTTCCCTGAATAGCGATTTATGGT AAATATTTCTCGTACCCCGAATTTCGAAGAGCAGAAACATTTAAGACCTT CTTGATTGATTGATAAATTTATGCTGGTTCGACCCTTTCTAAACCTGATA AACCTGCTTATTGTCTGAAACTTCATCTAAATTTCACACATTCACGTAAA CTTTTCTTTCAAATTTTACGCATCTATCTAGGTAAATAAGAAATCCCATT CGGGCAAATCTCAGATACCCCTTAGCAACGCCGAATTAACAAATATCCAA ATATTTTATCTTTTTAGGAGTGTTGGTGTTATTACGTACATTCTGTAAGT ATTTTAATAAGCTTTCGTGTTTTAGTTAAAATTATTCAGCGAAATCTAAA ATCTTTTAACTGTTTAAGGAGAAGAGCTAAAACTTACCAAAAGACTGCAA TCTTTTACGACGCAAGATGTCACGATGAAAATATTTTTCCTGTTTTTTTA AGAAATTGAACAGTCGACTTATGACAGGCTAGCTCTAAAGCTCTAAAACA GTATCTAATAACATAAAAAGTTGTATTATTTTCGGCTCTATTCACATACT GAATTTCAAAGATATGTGACGTTTTTTGCAAACTTTTGCGAGACTTTAGC TTAAGTGCTTGCGTGCAACATTGGGTACAAAGTCCAAATATGCGTTTCCC GTAAATTTTATATGAAAAGTTATGGCTATTCTGTATGGAGGCTAAACTAT AAATGTTCTAAATTATCAACTCTCCTTTCCTCCTACAACTCCGCATTGTC GAGTGCCTGATTCAATGACAACCACCTTCCCAGCAGACACACAACGTTGT TTCAACGCTAATCTAACGTTCATAAAACGTTAGGTTAACTTTAGGAATAG CTTTATGTGCCATCTGGATTAGCTATCTTTACAACTCAATCGCTTGCTTT ATCCCCTAGACGTTCGAGTTATGGACACTTGACTGTAATCATTTTTAACC AAATTATTTTTTTTCAGATTGTCGGATATTCACCGACATAGATAGTGAGT TTATGTTTTTGAGACTGGACTGTAATCATTTTTAAACAGAACATTTTTTC CTTTACTCTCTATTCAGATTGTCGGGTATTTCACCATTCATTGGAGATGA TGACAACGATACATTGATGAATGTTTCCTGTGGTGAATACGAATATGATG ACCAAGCGTTCGGTCAAATCACCAATGATGCGAAATCCTTCATCGATAAA CTGCTTGTCTCGAATCCTAAGTAAGTGCAGTCTCTTTCTTATTCGATGCT CTAGGGACCAAGAATTTTATTCGAATTAGAGAAAGTTTCAAATTACACAC ATTTTATACTATTTCCCACATATTTTTGTTCGAATTATAGAAAATTGACA GCAATACAATGCCACTAAGGTTTTTTTATATCCTACAGATTTCTATATTT GTAGAGAAAAGCTCGAAAATCATCCATCAAATTTCGCTTTCCTTTAAGTA TTCAAGTCAATTTGAATGGCTTTAGTCTGTTGATATTCTCTAAAGAGTTT ATAATTCTTCGTGCTAATAACTGTGGTTTACAATAGGCTAACTAACGTTA AAAATTTGGTTATGCTTCTATTTTCAGGAAAAGGGGAAATGTTGGTCGCT GCTTGCAACATCCTTGGATAAATGTGAGTTTTCTGGCTAGTTATTACCGA ACCAGACTTTAGTTTTTATAAAGAGGATCTAAGGCTCCCTATCCCTCTAT CTATGATATGCACCTGTTGTGATGTCTTCCAAGGACCCGACAGCTGATTG GTTGCAAGTGACTGATTTTACAAATCAGCTATTGGATCCATGATGTAATG TCAGAAGACACTGCAATGGTACATTTCATGAATATATTCCTATCATCCTT CAAAACGTGGGGAGATTCGGCTTCGAGTTTACCAGGAAGGATTTACGTCA AAATGCCTGAAGTCTTTGCATTGGTCCAAATAATTTTGACGTCATTTCCT TGTATTCATTACCAATTCCCTCAAAACCCAACCTGGTTGTTCATGTTCGG TAGCACAGATATTCGAGGCATGGACTTTTCAGCCTGTTAGAATCTTGCTG AGATTCACTTTTTTCAAAAATCTTTTATTTTTTCAGTCCAACTGGCAATC CAAACAAAGTAAAATCAACCTTGGCAACTTGAAGACGTTCTTGAAGAAAC ACAAAGAAAAGGTACCTTTTTTAAACCTTTTGGCTAAACTTATCTGATTC CATTTATTGTGCCTAATTTGATCTCAGACTCCTGACCAAGCATTGTAACA CTTTCAGTGTTGTCGCCCTTATATAAATGTTTCATTCGCCTCTAAATAAC ATTTGAATTTCGTTTTCTCTAGGTTAACGTCAGTGCTAGAGGTGCCATCC GTCGGTTCAGTTCATTTGGAGTGGGCGGTCACGCCCATGGTTTATTGGGT GGACGAGGTGGCTCTCCCGTCAGTGTCGGTAGCAGCCGATCGCCTTCAAA ACATTTATTGGTACCGAACGCCCTTCAATCATGCGTGATAAATGAAGATG AAGAAGAAGAGGAAGAAGCAGATGAGAATCAAAACATCCGGAATATCAAT GATTCTTTACGGAGTGGCCCGATTTTTACTGTAACAAAGGAAGCGGAAAG GCCCCCTTCCGGTGATTATGGTGAAGCATTACCGGATTTCAATACGGATA CACCAGACGGGTTGAGAAATTATTTACAGCAAATGATTAATACTGGGTTA TTACCGGGCCGTTCTGGACCACCGGACATGTCTGAACAGTTTAGTGATGA AGATCATTGAAGGAATAAGAGGTCGGATGATAAAGTAGATTTCCAGACAG CGCGAAACGTTCAAACAAGGTATATCAAACGTTCCTAACGTCTTTTAACG TTA

Coding sequence (CDS) from alignment at sc0000001:2079465..2112567-

>TCONS_00000239 ID=TCONS_00000239|Name=TCONS_00000239|organism=Clytia hemisphaerica|type=CDS|length=24912bp|location=Sequence derived from alignment at sc0000001:2079465..2112567- (Clytia hemisphaerica)
GTTAACGTCAGTGCTAGAGGTGCCATCCGTCGGTTCAGTTCATTTGGAGT
GGGCGGTCACGCCCATGGTTTATTGGGTGGACGAGGTGGCTCTCCCGTCA
GTGTCGGTAGCAGCCGATCGCCTTCAAAACATTTATTGGTACCGAACGCC
CTTCAATCATGCGTGATAAATGAAGATGAAGAAGAAGAGGAAGAAGCAGA
TGAGAATCAAAACATCCGGAATATCAATGATTCTTTACGGAGTGGCCCGA
TTTTTACTGTAACAAAGGAAGCGGAAAGGCCCCCTTCCGGTGATTATGGT
GAAGCATTACCGGATTTCAATACGGATACACCAGACGGGTTGAGAAATTA
TTTACAGCAAATGATTAATACTGGGTTATTACCGGGCCGTTCTGGACCAC
CGGACATGTCTGAACAGTTTAGTGATGAAGATCATTGATCCAACTGGCAA
TCCAAACAAAGTAAAATCAACCTTGGCAACTTGAAGACGTTCTTGAAGAA
ACACAAAGAAAAGGAAAAGGGGAAATGTTGGTCGCTGCTTGCAACATCCT
TGGATAAATATTGTCGGGTATTTCACCATTCATTGGAGATGATGACAACG
ATACATTGATGAATGTTTCCTGTGGTGAATACGAATATGATGACCAAGCG
TTCGGTCAAATCACCAATGATGCGAAATCCTTCATCGATAAACTGCTTGT
CTCGAATCCTAAGAGTGTTGGTGTTATTACGTACATTCTCACCGGAAATT
TTGTCATTCGATCCTGTTTCCCTGAATAGCGATTTATGCCTGAGAATATT
ATTTGCGTGAACCGTAGCAACATGGACATCAAAATCATTGACTTTGGATT
GGCTAAACAATTGTCACATGACAAACCAATCAAGATTACCGCTGGGTCGC
CGGAATTTGTGGTGTTGGCGGAGGTATGTTATTTGAACGTATCGTGGAAA
AGAATTCACTTACAGAAGCGGAATGTGCTTTATACATCAAACAAGTCTTG
CAGGGATTACATCATCTTCATCTACAAAATATCGCACATCTTGAGTTGAA
GAGGTAAATTTGGTAAAGTATACAAGATGGTAGCCCGAGCTACGGGTGAC
ACCTACGCAGCAAAATACATCAAAGTCACACCCAAACTTCGCGAAGACGT
TCTGAACACGATTGACATTATGAAGAAAATACATCATGTTCGGTTGATGA
ATTTGTTTGATGTTTACGATCTGGGATCACAGATTGTCATGATTCTAGAA
TAACCAATCATTGCTTGTTCCTCCACGTGATGATATTCGAATCAAAGTCA
CAGATGTCTCAAAAGCTTTCGAACAAAGTGAAGAAATTTCAAGGAGCTGA
TAGAACTCGAAGAAGATGGAAAAAGATTTAAATGATCGTGAGGAACGAAT
AGAACAGTTAGAACATGAAATTCAAGTCGAAAGAGACACGATAAAATCGA
AAGAAGATTTAATCGAAGAATTAACGATTCAACTCGAAGAGCTTAAGGAA
ACTTTGGAAATGAAAGAGGAGAAGATATTGGAATTGGAAAAAGATTTTGA
GAACGCAAGTGTTGCTCTTATGAACGGTATCAAACAAATGGAACAACAAC
CTCGATCTGGTGAAGATATACACGAACTGGAGGCTCAATTACAAGATAGT
TTAGATGAGCGCGATGGTTTTATGAAAGAGATTAAGAAACTCGAACGAGA
GCTAAAGAAAATCAATAATAGCCTGGAGGAAGAGAAAAATCAGACACGCA
GGCTAGGAATTAAACTTGAGGACGCAAATTACGAGATCGGGAGATTAAGA
CAGGAACTTATCAACTCGCAACTGGAGAACGAAAAAATAGTGGAAGAAAA
CGAAGATTTAGCTGTGGATAACGAGGATTTGATCAAAGAGCGAGATGAGA
TTATACAAATTTACGAGGAATTGTATCGAGAGAGTGAACGATTAAAACAC
GAGGTCAAAATTTGGAAGACTGTGTTCGATAACAATAAAGATAACATTGA
TGAGGATGAAATGCGAGAAGCGATGAGCGAAGGTGACGCACTTGAGGAGA
ATGGGAAGGAGTCTTCAGATGAAGAGGTTAACGTCAGTGCTAGAGGTGCC
ATCCGTCGGTTCAGTTCATTTGGAGTGGGCGGTCACGCCCATGGTTTATT
GGGTGGACGAGGTGGCTCTCCCGTCAGTGTCGGTAGCAGCCGATCGCCTT
CAAAACATTTATTGGTACCGAACGCCCTTCAATCATGCGTGATAAATGAA
GATGAAGAAGAAGAGGAAGAAGCAGATGAGAATCAAAACATCCGGAATAT
CAATGATTCTTTACGGAGTGGCCCGATTTTTACTGTAACAAAGGAAGCGG
AAAGGCCCCCTTCCGGTGATTATGGTGAAGCATTACCGGATTTCAATACG
GATACACCAGACGGGTTGAGAAATTATTTACAGCAAATGATTAATACTGG
GTTATTACCGGGCCGTTCTGGACCACCGGACATGTCTGAACAGTTTAGTG
ATGAAGATCATTGATCCAACTGGCAATCCAAACAAAGTAAAATCAACCTT
GGCAACTTGAAGACGTTCTTGAAGAAACACAAAGAAAAGGAAAAGGGGAA
ATGTTGGTCGCTGCTTGCAACATCCTTGGATAAATATTGTCGGGTATTTC
ACCATTCATTGGAGATGATGACAACGATACATTGATGAATGTTTCCTGTG
GTGAATACGAATATGATGACCAAGCGTTCGGTCAAATCACCAATGATGCG
AAATCCTTCATCGATAAACTGCTTGTCTCGAATCCTAAGAGTGTTGGTGT
TATTACGTACATTCTCACCGGAAATTTTGTCATTCGATCCTGTTTCCCTG
AATAGCGATTTATGCCTGAGAATATTATTTGCGTGAACCGTAGCAACATG
GACATCAAAATCATTGACTTTGGATTGGCTAAACAATTGTCACATGACAA
ACCAATCAAGATTACCGCTGGGTCGCCGGAATTTGTGGTGTTGGCGGAGG
TATGTTATTTGAACGTATCGTGGAAAAGAATTCACTTACAGAAGCGGAAT
GTGCTTTATACATCAAACAAGTCTTGCAGGGATTACATCATCTTCATCTA
CAAAATATCGCACATCTTGAGTTGAAGAGGTAAATTTGGTAAAGTATACA
AGATGGTAGCCCGAGCTACGGGTGACACCTACGCAGCAAAATACATCAAA
GTCACACCCAAACTTCGCGAAGACGTTCTGAACACGATTGACATTATGAA
GAAAATACATCATGTTCGGTTGATGAATTTGTTTGATGTTTACGATCTGG
GATCACAGATTGTCATGATTCTAGAATAACCAATCATTGCTTGTTCCTCC
ACGTGATGATATTCGAATCAAAGTCACAGATGTCTCAAAAGCTTTCGAAC
AAAGTGAAGAAATTTCAAGGAGCTGATAGAACTCGAAGAAGATGGAAAAA
GATTTAAATGATCGTGAGGAACGAATAGAACAGTTAGAACATGAAATTCA
AGTCGAAAGAGACACGATAAAATCGAAAGAAGATTTAATCGAAGAATTAA
CGATTCAACTCGAAGAGCTTAAGGAAACTTTGGAAATGAAAGAGGAGAAG
ATATTGGAATTGGAAAAAGATTTTGAGAACGCAAGTGTTGCTCTTATGAA
CGGTATCAAACAAATGGAACAACAACCTCGATCTGGTGAAGATATACACG
AACTGGAGGCTCAATTACAAGATAGTTTAGATGAGCGCGATGGTTTTATG
AAAGAGATTAAGAAACTCGAACGAGAGCTAAAGAAAATCAATAATAGCCT
GGAGGAAGAGAAAAATCAGACACGCAGGCTAGGAATTAAACTTGAGGACG
CAAATTACGAGATCGGGAGATTAAGACAGGAACTTATCAACTCGCAACTG
GAGAACGAAAAAATAGTGGAAGAAAACGAAGATTTAGCTGTGGATAACGA
GGATTTGATCAAAGAGCGAGATGAGATTATACAAATTTACGAGGAATTGT
ATCGAGAGAGTGAACGATTAAAACACGAGGTCAAAATTTGGAAGACTGTG
TTCGATAACAATAAAGATAACATTGATGAGGATGAAATGCGAGAAGCGAT
GAGCGAAGGTGACGCACTTGAGGAGAATGGGAAGGAGTCTTCAGATGAAG
AGGTTAACGTCAGTGCTAGAGGTGCCATCCGTCGGTTCAGTTCATTTGGA
GTGGGCGGTCACGCCCATGGTTTATTGGGTGGACGAGGTGGCTCTCCCGT
CAGTGTCGGTAGCAGCCGATCGCCTTCAAAACATTTATTGGTACCGAACG
CCCTTCAATCATGCGTGATAAATGAAGATGAAGAAGAAGAGGAAGAAGCA
GATGAGAATCAAAACATCCGGAATATCAATGATTCTTTACGGAGTGGCCC
GATTTTTACTGTAACAAAGGAAGCGGAAAGGCCCCCTTCCGGTGATTATG
GTGAAGCATTACCGGATTTCAATACGGATACACCAGACGGGTTGAGAAAT
TATTTACAGCAAATGATTAATACTGGGTTATTACCGGGCCGTTCTGGACC
ACCGGACATGTCTGAACAGTTTAGTGATGAAGATCATTGATCCAACTGGC
AATCCAAACAAAGTAAAATCAACCTTGGCAACTTGAAGACGTTCTTGAAG
AAACACAAAGAAAAGGAAAAGGGGAAATGTTGGTCGCTGCTTGCAACATC
CTTGGATAAATATTGTCGGGTATTTCACCATTCATTGGAGATGATGACAA
CGATACATTGATGAATGTTTCCTGTGGTGAATACGAATATGATGACCAAG
CGTTCGGTCAAATCACCAATGATGCGAAATCCTTCATCGATAAACTGCTT
GTCTCGAATCCTAAGAGTGTTGGTGTTATTACGTACATTCTCACCGGAAA
TTTTGTCATTCGATCCTGTTTCCCTGAATAGCGATTTATGCCTGAGAATA
TTATTTGCGTGAACCGTAGCAACATGGACATCAAAATCATTGACTTTGGA
TTGGCTAAACAATTGTCACATGACAAACCAATCAAGATTACCGCTGGGTC
GCCGGAATTTGTGGTGTTGGCGGAGGTATGTTATTTGAACGTATCGTGGA
AAAGAATTCACTTACAGAAGCGGAATGTGCTTTATACATCAAACAAGTCT
TGCAGGGATTACATCATCTTCATCTACAAAATATCGCACATCTTGAGTTG
AAGAGGTAAATTTGGTAAAGTATACAAGATGGTAGCCCGAGCTACGGGTG
ACACCTACGCAGCAAAATACATCAAAGTCACACCCAAACTTCGCGAAGAC
GTTCTGAACACGATTGACATTATGAAGAAAATACATCATGTTCGGTTGAT
GAATTTGTTTGATGTTTACGATCTGGGATCACAGATTGTCATGATTCTAG
AATAACCAATCATTGCTTGTTCCTCCACGTGATGATATTCGAATCAAAGT
CACAGATGTCTCAAAAGCTTTCGAACAAAGTGAAGAAATTTCAAGGAGCT
GATAGAACTCGAAGAAGATGGAAAAAGATTTAAATGATCGTGAGGAACGA
ATAGAACAGTTAGAACATGAAATTCAAGTCGAAAGAGACACGATAAAATC
GAAAGAAGATTTAATCGAAGAATTAACGATTCAACTCGAAGAGCTTAAGG
AAACTTTGGAAATGAAAGAGGAGAAGATATTGGAATTGGAAAAAGATTTT
GAGAACGCAAGTGTTGCTCTTATGAACGGTATCAAACAAATGGAACAACA
ACCTCGATCTGGTGAAGATATACACGAACTGGAGGCTCAATTACAAGATA
GTTTAGATGAGCGCGATGGTTTTATGAAAGAGATTAAGAAACTCGAACGA
GAGCTAAAGAAAATCAATAATAGCCTGGAGGAAGAGAAAAATCAGACACG
CAGGCTAGGAATTAAACTTGAGGACGCAAATTACGAGATCGGGAGATTAA
GACAGGAACTTATCAACTCGCAACTGGAGAACGAAAAAATAGTGGAAGAA
AACGAAGATTTAGCTGTGGATAACGAGGATTTGATCAAAGAGCGAGATGA
GATTATACAAATTTACGAGGAATTGTATCGAGAGAGTGAACGATTAAAAC
ACGAGGTCAAAATTTGGAAGACTGTGTTCGATAACAATAAAGATAACATT
GATGAGGATGAAATGCGAGAAGCGATGAGCGAAGGTGACGCACTTGAGGA
GAATGGGAAGGAGTCTTCAGATGAAGAGGTTAACGTCAGTGCTAGAGGTG
CCATCCGTCGGTTCAGTTCATTTGGAGTGGGCGGTCACGCCCATGGTTTA
TTGGGTGGACGAGGTGGCTCTCCCGTCAGTGTCGGTAGCAGCCGATCGCC
TTCAAAACATTTATTGGTACCGAACGCCCTTCAATCATGCGTGATAAATG
AAGATGAAGAAGAAGAGGAAGAAGCAGATGAGAATCAAAACATCCGGAAT
ATCAATGATTCTTTACGGAGTGGCCCGATTTTTACTGTAACAAAGGAAGC
GGAAAGGCCCCCTTCCGGTGATTATGGTGAAGCATTACCGGATTTCAATA
CGGATACACCAGACGGGTTGAGAAATTATTTACAGCAAATGATTAATACT
GGGTTATTACCGGGCCGTTCTGGACCACCGGACATGTCTGAACAGTTTAG
TGATGAAGATCATTGATCCAACTGGCAATCCAAACAAAGTAAAATCAACC
TTGGCAACTTGAAGACGTTCTTGAAGAAACACAAAGAAAAGGAAAAGGGG
AAATGTTGGTCGCTGCTTGCAACATCCTTGGATAAATATTGTCGGGTATT
TCACCATTCATTGGAGATGATGACAACGATACATTGATGAATGTTTCCTG
TGGTGAATACGAATATGATGACCAAGCGTTCGGTCAAATCACCAATGATG
CGAAATCCTTCATCGATAAACTGCTTGTCTCGAATCCTAAGAGTGTTGGT
GTTATTACGTACATTCTCACCGGAAATTTTGTCATTCGATCCTGTTTCCC
TGAATAGCGATTTATGCCTGAGAATATTATTTGCGTGAACCGTAGCAACA
TGGACATCAAAATCATTGACTTTGGATTGGCTAAACAATTGTCACATGAC
AAACCAATCAAGATTACCGCTGGGTCGCCGGAATTTGTGGTGTTGGCGGA
GGTATGTTATTTGAACGTATCGTGGAAAAGAATTCACTTACAGAAGCGGA
ATGTGCTTTATACATCAAACAAGTCTTGCAGGGATTACATCATCTTCATC
TACAAAATATCGCACATCTTGAGTTGAAGAGGTAAATTTGGTAAAGTATA
CAAGATGGTAGCCCGAGCTACGGGTGACACCTACGCAGCAAAATACATCA
AAGTCACACCCAAACTTCGCGAAGACGTTCTGAACACGATTGACATTATG
AAGAAAATACATCATGTTCGGTTGATGAATTTGTTTGATGTTTACGATCT
GGGATCACAGATTGTCATGATTCTAGAATAACCAATCATTGCTTGTTCCT
CCACGTGATGATATTCGAATCAAAGTCACAGATGTCTCAAAAGCTTTCGA
ACAAAGTGAAGAAATTTCAAGGAGCTGATAGAACTCGAAGAAGATGGAAA
AAGATTTAAATGATCGTGAGGAACGAATAGAACAGTTAGAACATGAAATT
CAAGTCGAAAGAGACACGATAAAATCGAAAGAAGATTTAATCGAAGAATT
AACGATTCAACTCGAAGAGCTTAAGGAAACTTTGGAAATGAAAGAGGAGA
AGATATTGGAATTGGAAAAAGATTTTGAGAACGCAAGTGTTGCTCTTATG
AACGGTATCAAACAAATGGAACAACAACCTCGATCTGGTGAAGATATACA
CGAACTGGAGGCTCAATTACAAGATAGTTTAGATGAGCGCGATGGTTTTA
TGAAAGAGATTAAGAAACTCGAACGAGAGCTAAAGAAAATCAATAATAGC
CTGGAGGAAGAGAAAAATCAGACACGCAGGCTAGGAATTAAACTTGAGGA
CGCAAATTACGAGATCGGGAGATTAAGACAGGAACTTATCAACTCGCAAC
TGGAGAACGAAAAAATAGTGGAAGAAAACGAAGATTTAGCTGTGGATAAC
GAGGATTTGATCAAAGAGCGAGATGAGATTATACAAATTTACGAGGAATT
GTATCGAGAGAGTGAACGATTAAAACACGAGGTCAAAATTTGGAAGACTG
TGTTCGATAACAATAAAGATAACATTGATGAGGATGAAATGCGAGAAGCG
ATGAGCGAAGGTGACGCACTTGAGGAGAATGGGAAGGAGTCTTCAGATGA
AGAGGTTAACGTCAGTGCTAGAGGTGCCATCCGTCGGTTCAGTTCATTTG
GAGTGGGCGGTCACGCCCATGGTTTATTGGGTGGACGAGGTGGCTCTCCC
GTCAGTGTCGGTAGCAGCCGATCGCCTTCAAAACATTTATTGGTACCGAA
CGCCCTTCAATCATGCGTGATAAATGAAGATGAAGAAGAAGAGGAAGAAG
CAGATGAGAATCAAAACATCCGGAATATCAATGATTCTTTACGGAGTGGC
CCGATTTTTACTGTAACAAAGGAAGCGGAAAGGCCCCCTTCCGGTGATTA
TGGTGAAGCATTACCGGATTTCAATACGGATACACCAGACGGGTTGAGAA
ATTATTTACAGCAAATGATTAATACTGGGTTATTACCGGGCCGTTCTGGA
CCACCGGACATGTCTGAACAGTTTAGTGATGAAGATCATTGATCCAACTG
GCAATCCAAACAAAGTAAAATCAACCTTGGCAACTTGAAGACGTTCTTGA
AGAAACACAAAGAAAAGGAAAAGGGGAAATGTTGGTCGCTGCTTGCAACA
TCCTTGGATAAATATTGTCGGGTATTTCACCATTCATTGGAGATGATGAC
AACGATACATTGATGAATGTTTCCTGTGGTGAATACGAATATGATGACCA
AGCGTTCGGTCAAATCACCAATGATGCGAAATCCTTCATCGATAAACTGC
TTGTCTCGAATCCTAAGAGTGTTGGTGTTATTACGTACATTCTCACCGGA
AATTTTGTCATTCGATCCTGTTTCCCTGAATAGCGATTTATGCCTGAGAA
TATTATTTGCGTGAACCGTAGCAACATGGACATCAAAATCATTGACTTTG
GATTGGCTAAACAATTGTCACATGACAAACCAATCAAGATTACCGCTGGG
TCGCCGGAATTTGTGGTGTTGGCGGAGGTATGTTATTTGAACGTATCGTG
GAAAAGAATTCACTTACAGAAGCGGAATGTGCTTTATACATCAAACAAGT
CTTGCAGGGATTACATCATCTTCATCTACAAAATATCGCACATCTTGAGT
TGAAGAGGTAAATTTGGTAAAGTATACAAGATGGTAGCCCGAGCTACGGG
TGACACCTACGCAGCAAAATACATCAAAGTCACACCCAAACTTCGCGAAG
ACGTTCTGAACACGATTGACATTATGAAGAAAATACATCATGTTCGGTTG
ATGAATTTGTTTGATGTTTACGATCTGGGATCACAGATTGTCATGATTCT
AGAATAACCAATCATTGCTTGTTCCTCCACGTGATGATATTCGAATCAAA
GTCACAGATGTCTCAAAAGCTTTCGAACAAAGTGAAGAAATTTCAAGGAG
CTGATAGAACTCGAAGAAGATGGAAAAAGATTTAAATGATCGTGAGGAAC
GAATAGAACAGTTAGAACATGAAATTCAAGTCGAAAGAGACACGATAAAA
TCGAAAGAAGATTTAATCGAAGAATTAACGATTCAACTCGAAGAGCTTAA
GGAAACTTTGGAAATGAAAGAGGAGAAGATATTGGAATTGGAAAAAGATT
TTGAGAACGCAAGTGTTGCTCTTATGAACGGTATCAAACAAATGGAACAA
CAACCTCGATCTGGTGAAGATATACACGAACTGGAGGCTCAATTACAAGA
TAGTTTAGATGAGCGCGATGGTTTTATGAAAGAGATTAAGAAACTCGAAC
GAGAGCTAAAGAAAATCAATAATAGCCTGGAGGAAGAGAAAAATCAGACA
CGCAGGCTAGGAATTAAACTTGAGGACGCAAATTACGAGATCGGGAGATT
AAGACAGGAACTTATCAACTCGCAACTGGAGAACGAAAAAATAGTGGAAG
AAAACGAAGATTTAGCTGTGGATAACGAGGATTTGATCAAAGAGCGAGAT
GAGATTATACAAATTTACGAGGAATTGTATCGAGAGAGTGAACGATTAAA
ACACGAGGTCAAAATTTGGAAGACTGTGTTCGATAACAATAAAGATAACA
TTGATGAGGATGAAATGCGAGAAGCGATGAGCGAAGGTGACGCACTTGAG
GAGAATGGGAAGGAGTCTTCAGATGAAGAGGTTAACGTCAGTGCTAGAGG
TGCCATCCGTCGGTTCAGTTCATTTGGAGTGGGCGGTCACGCCCATGGTT
TATTGGGTGGACGAGGTGGCTCTCCCGTCAGTGTCGGTAGCAGCCGATCG
CCTTCAAAACATTTATTGGTACCGAACGCCCTTCAATCATGCGTGATAAA
TGAAGATGAAGAAGAAGAGGAAGAAGCAGATGAGAATCAAAACATCCGGA
ATATCAATGATTCTTTACGGAGTGGCCCGATTTTTACTGTAACAAAGGAA
GCGGAAAGGCCCCCTTCCGGTGATTATGGTGAAGCATTACCGGATTTCAA
TACGGATACACCAGACGGGTTGAGAAATTATTTACAGCAAATGATTAATA
CTGGGTTATTACCGGGCCGTTCTGGACCACCGGACATGTCTGAACAGTTT
AGTGATGAAGATCATTGATCCAACTGGCAATCCAAACAAAGTAAAATCAA
CCTTGGCAACTTGAAGACGTTCTTGAAGAAACACAAAGAAAAGGAAAAGG
GGAAATGTTGGTCGCTGCTTGCAACATCCTTGGATAAATATTGTCGGGTA
TTTCACCATTCATTGGAGATGATGACAACGATACATTGATGAATGTTTCC
TGTGGTGAATACGAATATGATGACCAAGCGTTCGGTCAAATCACCAATGA
TGCGAAATCCTTCATCGATAAACTGCTTGTCTCGAATCCTAAGAGTGTTG
GTGTTATTACGTACATTCTCACCGGAAATTTTGTCATTCGATCCTGTTTC
CCTGAATAGCGATTTATGCCTGAGAATATTATTTGCGTGAACCGTAGCAA
CATGGACATCAAAATCATTGACTTTGGATTGGCTAAACAATTGTCACATG
ACAAACCAATCAAGATTACCGCTGGGTCGCCGGAATTTGTGGTGTTGGCG
GAGGTATGTTATTTGAACGTATCGTGGAAAAGAATTCACTTACAGAAGCG
GAATGTGCTTTATACATCAAACAAGTCTTGCAGGGATTACATCATCTTCA
TCTACAAAATATCGCACATCTTGAGTTGAAGAGGTAAATTTGGTAAAGTA
TACAAGATGGTAGCCCGAGCTACGGGTGACACCTACGCAGCAAAATACAT
CAAAGTCACACCCAAACTTCGCGAAGACGTTCTGAACACGATTGACATTA
TGAAGAAAATACATCATGTTCGGTTGATGAATTTGTTTGATGTTTACGAT
CTGGGATCACAGATTGTCATGATTCTAGAATAACCAATCATTGCTTGTTC
CTCCACGTGATGATATTCGAATCAAAGTCACAGATGTCTCAAAAGCTTTC
GAACAAAGTGAAGAAATTTCAAGGAGCTGATAGAACTCGAAGAAGATGGA
AAAAGATTTAAATGATCGTGAGGAACGAATAGAACAGTTAGAACATGAAA
TTCAAGTCGAAAGAGACACGATAAAATCGAAAGAAGATTTAATCGAAGAA
TTAACGATTCAACTCGAAGAGCTTAAGGAAACTTTGGAAATGAAAGAGGA
GAAGATATTGGAATTGGAAAAAGATTTTGAGAACGCAAGTGTTGCTCTTA
TGAACGGTATCAAACAAATGGAACAACAACCTCGATCTGGTGAAGATATA
CACGAACTGGAGGCTCAATTACAAGATAGTTTAGATGAGCGCGATGGTTT
TATGAAAGAGATTAAGAAACTCGAACGAGAGCTAAAGAAAATCAATAATA
GCCTGGAGGAAGAGAAAAATCAGACACGCAGGCTAGGAATTAAACTTGAG
GACGCAAATTACGAGATCGGGAGATTAAGACAGGAACTTATCAACTCGCA
ACTGGAGAACGAAAAAATAGTGGAAGAAAACGAAGATTTAGCTGTGGATA
ACGAGGATTTGATCAAAGAGCGAGATGAGATTATACAAATTTACGAGGAA
TTGTATCGAGAGAGTGAACGATTAAAACACGAGGTCAAAATTTGGAAGAC
TGTGTTCGATAACAATAAAGATAACATTGATGAGGATGAAATGCGAGAAG
CGATGAGCGAAGGTGACGCACTTGAGGAGAATGGGAAGGAGTCTTCAGAT
GAAGAGGTTAACGTCAGTGCTAGAGGTGCCATCCGTCGGTTCAGTTCATT
TGGAGTGGGCGGTCACGCCCATGGTTTATTGGGTGGACGAGGTGGCTCTC
CCGTCAGTGTCGGTAGCAGCCGATCGCCTTCAAAACATTTATTGGTACCG
AACGCCCTTCAATCATGCGTGATAAATGAAGATGAAGAAGAAGAGGAAGA
AGCAGATGAGAATCAAAACATCCGGAATATCAATGATTCTTTACGGAGTG
GCCCGATTTTTACTGTAACAAAGGAAGCGGAAAGGCCCCCTTCCGGTGAT
TATGGTGAAGCATTACCGGATTTCAATACGGATACACCAGACGGGTTGAG
AAATTATTTACAGCAAATGATTAATACTGGGTTATTACCGGGCCGTTCTG
GACCACCGGACATGTCTGAACAGTTTAGTGATGAAGATCATTGATCCAAC
TGGCAATCCAAACAAAGTAAAATCAACCTTGGCAACTTGAAGACGTTCTT
GAAGAAACACAAAGAAAAGGAAAAGGGGAAATGTTGGTCGCTGCTTGCAA
CATCCTTGGATAAATATTGTCGGGTATTTCACCATTCATTGGAGATGATG
ACAACGATACATTGATGAATGTTTCCTGTGGTGAATACGAATATGATGAC
CAAGCGTTCGGTCAAATCACCAATGATGCGAAATCCTTCATCGATAAACT
GCTTGTCTCGAATCCTAAGAGTGTTGGTGTTATTACGTACATTCTCACCG
GAAATTTTGTCATTCGATCCTGTTTCCCTGAATAGCGATTTATGCCTGAG
AATATTATTTGCGTGAACCGTAGCAACATGGACATCAAAATCATTGACTT
TGGATTGGCTAAACAATTGTCACATGACAAACCAATCAAGATTACCGCTG
GGTCGCCGGAATTTGTGGTGTTGGCGGAGGTATGTTATTTGAACGTATCG
TGGAAAAGAATTCACTTACAGAAGCGGAATGTGCTTTATACATCAAACAA
GTCTTGCAGGGATTACATCATCTTCATCTACAAAATATCGCACATCTTGA
GTTGAAGAGGTAAATTTGGTAAAGTATACAAGATGGTAGCCCGAGCTACG
GGTGACACCTACGCAGCAAAATACATCAAAGTCACACCCAAACTTCGCGA
AGACGTTCTGAACACGATTGACATTATGAAGAAAATACATCATGTTCGGT
TGATGAATTTGTTTGATGTTTACGATCTGGGATCACAGATTGTCATGATT
CTAGAATAACCAATCATTGCTTGTTCCTCCACGTGATGATATTCGAATCA
AAGTCACAGATGTCTCAAAAGCTTTCGAACAAAGTGAAGAAATTTCAAGG
AGCTGATAGAACTCGAAGAAGATGGAAAAAGATTTAAATGATCGTGAGGA
ACGAATAGAACAGTTAGAACATGAAATTCAAGTCGAAAGAGACACGATAA
AATCGAAAGAAGATTTAATCGAAGAATTAACGATTCAACTCGAAGAGCTT
AAGGAAACTTTGGAAATGAAAGAGGAGAAGATATTGGAATTGGAAAAAGA
TTTTGAGAACGCAAGTGTTGCTCTTATGAACGGTATCAAACAAATGGAAC
AACAACCTCGATCTGGTGAAGATATACACGAACTGGAGGCTCAATTACAA
GATAGTTTAGATGAGCGCGATGGTTTTATGAAAGAGATTAAGAAACTCGA
ACGAGAGCTAAAGAAAATCAATAATAGCCTGGAGGAAGAGAAAAATCAGA
CACGCAGGCTAGGAATTAAACTTGAGGACGCAAATTACGAGATCGGGAGA
TTAAGACAGGAACTTATCAACTCGCAACTGGAGAACGAAAAAATAGTGGA
AGAAAACGAAGATTTAGCTGTGGATAACGAGGATTTGATCAAAGAGCGAG
ATGAGATTATACAAATTTACGAGGAATTGTATCGAGAGAGTGAACGATTA
AAACACGAGGTCAAAATTTGGAAGACTGTGTTCGATAACAATAAAGATAA
CATTGATGAGGATGAAATGCGAGAAGCGATGAGCGAAGGTGACGCACTTG
AGGAGAATGGGAAGGAGTCTTCAGATGAAGAGGTTAACGTCAGTGCTAGA
GGTGCCATCCGTCGGTTCAGTTCATTTGGAGTGGGCGGTCACGCCCATGG
TTTATTGGGTGGACGAGGTGGCTCTCCCGTCAGTGTCGGTAGCAGCCGAT
CGCCTTCAAAACATTTATTGGTACCGAACGCCCTTCAATCATGCGTGATA
AATGAAGATGAAGAAGAAGAGGAAGAAGCAGATGAGAATCAAAACATCCG
GAATATCAATGATTCTTTACGGAGTGGCCCGATTTTTACTGTAACAAAGG
AAGCGGAAAGGCCCCCTTCCGGTGATTATGGTGAAGCATTACCGGATTTC
AATACGGATACACCAGACGGGTTGAGAAATTATTTACAGCAAATGATTAA
TACTGGGTTATTACCGGGCCGTTCTGGACCACCGGACATGTCTGAACAGT
TTAGTGATGAAGATCATTGATCCAACTGGCAATCCAAACAAAGTAAAATC
AACCTTGGCAACTTGAAGACGTTCTTGAAGAAACACAAAGAAAAGGAAAA
GGGGAAATGTTGGTCGCTGCTTGCAACATCCTTGGATAAATATTGTCGGG
TATTTCACCATTCATTGGAGATGATGACAACGATACATTGATGAATGTTT
CCTGTGGTGAATACGAATATGATGACCAAGCGTTCGGTCAAATCACCAAT
GATGCGAAATCCTTCATCGATAAACTGCTTGTCTCGAATCCTAAGAGTGT
TGGTGTTATTACGTACATTCTCACCGGAAATTTTGTCATTCGATCCTGTT
TCCCTGAATAGCGATTTATGCCTGAGAATATTATTTGCGTGAACCGTAGC
AACATGGACATCAAAATCATTGACTTTGGATTGGCTAAACAATTGTCACA
TGACAAACCAATCAAGATTACCGCTGGGTCGCCGGAATTTGTGGTGTTGG
CGGAGGTATGTTATTTGAACGTATCGTGGAAAAGAATTCACTTACAGAAG
CGGAATGTGCTTTATACATCAAACAAGTCTTGCAGGGATTACATCATCTT
CATCTACAAAATATCGCACATCTTGAGTTGAAGAGGTAAATTTGGTAAAG
TATACAAGATGGTAGCCCGAGCTACGGGTGACACCTACGCAGCAAAATAC
ATCAAAGTCACACCCAAACTTCGCGAAGACGTTCTGAACACGATTGACAT
TATGAAGAAAATACATCATGTTCGGTTGATGAATTTGTTTGATGTTTACG
ATCTGGGATCACAGATTGTCATGATTCTAGAATAACCAATCATTGCTTGT
TCCTCCACGTGATGATATTCGAATCAAAGTCACAGATGTCTCAAAAGCTT
TCGAACAAAGTGAAGAAATTTCAAGGAGCTGATAGAACTCGAAGAAGATG
GAAAAAGATTTAAATGATCGTGAGGAACGAATAGAACAGTTAGAACATGA
AATTCAAGTCGAAAGAGACACGATAAAATCGAAAGAAGATTTAATCGAAG
AATTAACGATTCAACTCGAAGAGCTTAAGGAAACTTTGGAAATGAAAGAG
GAGAAGATATTGGAATTGGAAAAAGATTTTGAGAACGCAAGTGTTGCTCT
TATGAACGGTATCAAACAAATGGAACAACAACCTCGATCTGGTGAAGATA
TACACGAACTGGAGGCTCAATTACAAGATAGTTTAGATGAGCGCGATGGT
TTTATGAAAGAGATTAAGAAACTCGAACGAGAGCTAAAGAAAATCAATAA
TAGCCTGGAGGAAGAGAAAAATCAGACACGCAGGCTAGGAATTAAACTTG
AGGACGCAAATTACGAGATCGGGAGATTAAGACAGGAACTTATCAACTCG
CAACTGGAGAACGAAAAAATAGTGGAAGAAAACGAAGATTTAGCTGTGGA
TAACGAGGATTTGATCAAAGAGCGAGATGAGATTATACAAATTTACGAGG
AATTGTATCGAGAGAGTGAACGATTAAAACACGAGGTCAAAATTTGGAAG
ACTGTGTTCGATAACAATAAAGATAACATTGATGAGGATGAAATGCGAGA
AGCGATGAGCGAAGGTGACGCACTTGAGGAGAATGGGAAGGAGTCTTCAG
ATGAAGAGGTTAACGTCAGTGCTAGAGGTGCCATCCGTCGGTTCAGTTCA
TTTGGAGTGGGCGGTCACGCCCATGGTTTATTGGGTGGACGAGGTGGCTC
TCCCGTCAGTGTCGGTAGCAGCCGATCGCCTTCAAAACATTTATTGGTAC
CGAACGCCCTTCAATCATGCGTGATAAATGAAGATGAAGAAGAAGAGGAA
GAAGCAGATGAGAATCAAAACATCCGGAATATCAATGATTCTTTACGGAG
TGGCCCGATTTTTACTGTAACAAAGGAAGCGGAAAGGCCCCCTTCCGGTG
ATTATGGTGAAGCATTACCGGATTTCAATACGGATACACCAGACGGGTTG
AGAAATTATTTACAGCAAATGATTAATACTGGGTTATTACCGGGCCGTTC
TGGACCACCGGACATGTCTGAACAGTTTAGTGATGAAGATCATTGATCCA
ACTGGCAATCCAAACAAAGTAAAATCAACCTTGGCAACTTGAAGACGTTC
TTGAAGAAACACAAAGAAAAGGAAAAGGGGAAATGTTGGTCGCTGCTTGC
AACATCCTTGGATAAATATTGTCGGGTATTTCACCATTCATTGGAGATGA
TGACAACGATACATTGATGAATGTTTCCTGTGGTGAATACGAATATGATG
ACCAAGCGTTCGGTCAAATCACCAATGATGCGAAATCCTTCATCGATAAA
CTGCTTGTCTCGAATCCTAAGAGTGTTGGTGTTATTACGTACATTCTCAC
CGGAAATTTTGTCATTCGATCCTGTTTCCCTGAATAGCGATTTATGCCTG
AGAATATTATTTGCGTGAACCGTAGCAACATGGACATCAAAATCATTGAC
TTTGGATTGGCTAAACAATTGTCACATGACAAACCAATCAAGATTACCGC
TGGGTCGCCGGAATTTGTGGTGTTGGCGGAGGTATGTTATTTGAACGTAT
CGTGGAAAAGAATTCACTTACAGAAGCGGAATGTGCTTTATACATCAAAC
AAGTCTTGCAGGGATTACATCATCTTCATCTACAAAATATCGCACATCTT
GAGTTGAAGAGGTAAATTTGGTAAAGTATACAAGATGGTAGCCCGAGCTA
CGGGTGACACCTACGCAGCAAAATACATCAAAGTCACACCCAAACTTCGC
GAAGACGTTCTGAACACGATTGACATTATGAAGAAAATACATCATGTTCG
GTTGATGAATTTGTTTGATGTTTACGATCTGGGATCACAGATTGTCATGA
TTCTAGAATAACCAATCATTGCTTGTTCCTCCACGTGATGATATTCGAAT
CAAAGTCACAGATGTCTCAAAAGCTTTCGAACAAAGTGAAGAAATTTCAA
GGAGCTGATAGAACTCGAAGAAGATGGAAAAAGATTTAAATGATCGTGAG
GAACGAATAGAACAGTTAGAACATGAAATTCAAGTCGAAAGAGACACGAT
AAAATCGAAAGAAGATTTAATCGAAGAATTAACGATTCAACTCGAAGAGC
TTAAGGAAACTTTGGAAATGAAAGAGGAGAAGATATTGGAATTGGAAAAA
GATTTTGAGAACGCAAGTGTTGCTCTTATGAACGGTATCAAACAAATGGA
ACAACAACCTCGATCTGGTGAAGATATACACGAACTGGAGGCTCAATTAC
AAGATAGTTTAGATGAGCGCGATGGTTTTATGAAAGAGATTAAGAAACTC
GAACGAGAGCTAAAGAAAATCAATAATAGCCTGGAGGAAGAGAAAAATCA
GACACGCAGGCTAGGAATTAAACTTGAGGACGCAAATTACGAGATCGGGA
GATTAAGACAGGAACTTATCAACTCGCAACTGGAGAACGAAAAAATAGTG
GAAGAAAACGAAGATTTAGCTGTGGATAACGAGGATTTGATCAAAGAGCG
AGATGAGATTATACAAATTTACGAGGAATTGTATCGAGAGAGTGAACGAT
TAAAACACGAGGTCAAAATTTGGAAGACTGTGTTCGATAACAATAAAGAT
AACATTGATGAGGATGAAATGCGAGAAGCGATGAGCGAAGGTGACGCACT
TGAGGAGAATGGGAAGGAGTCTTCAGATGAAGAGGTTAACGTCAGTGCTA
GAGGTGCCATCCGTCGGTTCAGTTCATTTGGAGTGGGCGGTCACGCCCAT
GGTTTATTGGGTGGACGAGGTGGCTCTCCCGTCAGTGTCGGTAGCAGCCG
ATCGCCTTCAAAACATTTATTGGTACCGAACGCCCTTCAATCATGCGTGA
TAAATGAAGATGAAGAAGAAGAGGAAGAAGCAGATGAGAATCAAAACATC
CGGAATATCAATGATTCTTTACGGAGTGGCCCGATTTTTACTGTAACAAA
GGAAGCGGAAAGGCCCCCTTCCGGTGATTATGGTGAAGCATTACCGGATT
TCAATACGGATACACCAGACGGGTTGAGAAATTATTTACAGCAAATGATT
AATACTGGGTTATTACCGGGCCGTTCTGGACCACCGGACATGTCTGAACA
GTTTAGTGATGAAGATCATTGATCCAACTGGCAATCCAAACAAAGTAAAA
TCAACCTTGGCAACTTGAAGACGTTCTTGAAGAAACACAAAGAAAAGGAA
AAGGGGAAATGTTGGTCGCTGCTTGCAACATCCTTGGATAAATATTGTCG
GGTATTTCACCATTCATTGGAGATGATGACAACGATACATTGATGAATGT
TTCCTGTGGTGAATACGAATATGATGACCAAGCGTTCGGTCAAATCACCA
ATGATGCGAAATCCTTCATCGATAAACTGCTTGTCTCGAATCCTAAGAGT
GTTGGTGTTATTACGTACATTCTCACCGGAAATTTTGTCATTCGATCCTG
TTTCCCTGAATAGCGATTTATGCCTGAGAATATTATTTGCGTGAACCGTA
GCAACATGGACATCAAAATCATTGACTTTGGATTGGCTAAACAATTGTCA
CATGACAAACCAATCAAGATTACCGCTGGGTCGCCGGAATTTGTGGTGTT
GGCGGAGGTATGTTATTTGAACGTATCGTGGAAAAGAATTCACTTACAGA
AGCGGAATGTGCTTTATACATCAAACAAGTCTTGCAGGGATTACATCATC
TTCATCTACAAAATATCGCACATCTTGAGTTGAAGAGGTAAATTTGGTAA
AGTATACAAGATGGTAGCCCGAGCTACGGGTGACACCTACGCAGCAAAAT
ACATCAAAGTCACACCCAAACTTCGCGAAGACGTTCTGAACACGATTGAC
ATTATGAAGAAAATACATCATGTTCGGTTGATGAATTTGTTTGATGTTTA
CGATCTGGGATCACAGATTGTCATGATTCTAGAATAACCAATCATTGCTT
GTTCCTCCACGTGATGATATTCGAATCAAAGTCACAGATGTCTCAAAAGC
TTTCGAACAAAGTGAAGAAATTTCAAGGAGCTGATAGAACTCGAAGAAGA
TGGAAAAAGATTTAAATGATCGTGAGGAACGAATAGAACAGTTAGAACAT
GAAATTCAAGTCGAAAGAGACACGATAAAATCGAAAGAAGATTTAATCGA
AGAATTAACGATTCAACTCGAAGAGCTTAAGGAAACTTTGGAAATGAAAG
AGGAGAAGATATTGGAATTGGAAAAAGATTTTGAGAACGCAAGTGTTGCT
CTTATGAACGGTATCAAACAAATGGAACAACAACCTCGATCTGGTGAAGA
TATACACGAACTGGAGGCTCAATTACAAGATAGTTTAGATGAGCGCGATG
GTTTTATGAAAGAGATTAAGAAACTCGAACGAGAGCTAAAGAAAATCAAT
AATAGCCTGGAGGAAGAGAAAAATCAGACACGCAGGCTAGGAATTAAACT
TGAGGACGCAAATTACGAGATCGGGAGATTAAGACAGGAACTTATCAACT
CGCAACTGGAGAACGAAAAAATAGTGGAAGAAAACGAAGATTTAGCTGTG
GATAACGAGGATTTGATCAAAGAGCGAGATGAGATTATACAAATTTACGA
GGAATTGTATCGAGAGAGTGAACGATTAAAACACGAGGTCAAAATTTGGA
AGACTGTGTTCGATAACAATAAAGATAACATTGATGAGGATGAAATGCGA
GAAGCGATGAGCGAAGGTGACGCACTTGAGGAGAATGGGAAGGAGTCTTC
AGATGAAGAGGTTAACGTCAGTGCTAGAGGTGCCATCCGTCGGTTCAGTT
CATTTGGAGTGGGCGGTCACGCCCATGGTTTATTGGGTGGACGAGGTGGC
TCTCCCGTCAGTGTCGGTAGCAGCCGATCGCCTTCAAAACATTTATTGGT
ACCGAACGCCCTTCAATCATGCGTGATAAATGAAGATGAAGAAGAAGAGG
AAGAAGCAGATGAGAATCAAAACATCCGGAATATCAATGATTCTTTACGG
AGTGGCCCGATTTTTACTGTAACAAAGGAAGCGGAAAGGCCCCCTTCCGG
TGATTATGGTGAAGCATTACCGGATTTCAATACGGATACACCAGACGGGT
TGAGAAATTATTTACAGCAAATGATTAATACTGGGTTATTACCGGGCCGT
TCTGGACCACCGGACATGTCTGAACAGTTTAGTGATGAAGATCATTGATC
CAACTGGCAATCCAAACAAAGTAAAATCAACCTTGGCAACTTGAAGACGT
TCTTGAAGAAACACAAAGAAAAGGAAAAGGGGAAATGTTGGTCGCTGCTT
GCAACATCCTTGGATAAATATTGTCGGGTATTTCACCATTCATTGGAGAT
GATGACAACGATACATTGATGAATGTTTCCTGTGGTGAATACGAATATGA
TGACCAAGCGTTCGGTCAAATCACCAATGATGCGAAATCCTTCATCGATA
AACTGCTTGTCTCGAATCCTAAGAGTGTTGGTGTTATTACGTACATTCTC
ACCGGAAATTTTGTCATTCGATCCTGTTTCCCTGAATAGCGATTTATGCC
TGAGAATATTATTTGCGTGAACCGTAGCAACATGGACATCAAAATCATTG
ACTTTGGATTGGCTAAACAATTGTCACATGACAAACCAATCAAGATTACC
GCTGGGTCGCCGGAATTTGTGGTGTTGGCGGAGGTATGTTATTTGAACGT
ATCGTGGAAAAGAATTCACTTACAGAAGCGGAATGTGCTTTATACATCAA
ACAAGTCTTGCAGGGATTACATCATCTTCATCTACAAAATATCGCACATC
TTGAGTTGAAGAGGTAAATTTGGTAAAGTATACAAGATGGTAGCCCGAGC
TACGGGTGACACCTACGCAGCAAAATACATCAAAGTCACACCCAAACTTC
GCGAAGACGTTCTGAACACGATTGACATTATGAAGAAAATACATCATGTT
CGGTTGATGAATTTGTTTGATGTTTACGATCTGGGATCACAGATTGTCAT
GATTCTAGAATAACCAATCATTGCTTGTTCCTCCACGTGATGATATTCGA
ATCAAAGTCACAGATGTCTCAAAAGCTTTCGAACAAAGTGAAGAAATTTC
AAGGAGCTGATAGAACTCGAAGAAGATGGAAAAAGATTTAAATGATCGTG
AGGAACGAATAGAACAGTTAGAACATGAAATTCAAGTCGAAAGAGACACG
ATAAAATCGAAAGAAGATTTAATCGAAGAATTAACGATTCAACTCGAAGA
GCTTAAGGAAACTTTGGAAATGAAAGAGGAGAAGATATTGGAATTGGAAA
AAGATTTTGAGAACGCAAGTGTTGCTCTTATGAACGGTATCAAACAAATG
GAACAACAACCTCGATCTGGTGAAGATATACACGAACTGGAGGCTCAATT
ACAAGATAGTTTAGATGAGCGCGATGGTTTTATGAAAGAGATTAAGAAAC
TCGAACGAGAGCTAAAGAAAATCAATAATAGCCTGGAGGAAGAGAAAAAT
CAGACACGCAGGCTAGGAATTAAACTTGAGGACGCAAATTACGAGATCGG
GAGATTAAGACAGGAACTTATCAACTCGCAACTGGAGAACGAAAAAATAG
TGGAAGAAAACGAAGATTTAGCTGTGGATAACGAGGATTTGATCAAAGAG
CGAGATGAGATTATACAAATTTACGAGGAATTGTATCGAGAGAGTGAACG
ATTAAAACACGAGGTCAAAATTTGGAAGACTGTGTTCGATAACAATAAAG
ATAACATTGATGAGGATGAAATGCGAGAAGCGATGAGCGAAGGTGACGCA
CTTGAGGAGAATGGGAAGGAGTCTTCAGATGAAGAGGTTAACGTCAGTGC
TAGAGGTGCCATCCGTCGGTTCAGTTCATTTGGAGTGGGCGGTCACGCCC
ATGGTTTATTGGGTGGACGAGGTGGCTCTCCCGTCAGTGTCGGTAGCAGC
CGATCGCCTTCAAAACATTTATTGGTACCGAACGCCCTTCAATCATGCGT
GATAAATGAAGATGAAGAAGAAGAGGAAGAAGCAGATGAGAATCAAAACA
TCCGGAATATCAATGATTCTTTACGGAGTGGCCCGATTTTTACTGTAACA
AAGGAAGCGGAAAGGCCCCCTTCCGGTGATTATGGTGAAGCATTACCGGA
TTTCAATACGGATACACCAGACGGGTTGAGAAATTATTTACAGCAAATGA
TTAATACTGGGTTATTACCGGGCCGTTCTGGACCACCGGACATGTCTGAA
CAGTTTAGTGATGAAGATCATTGATCCAACTGGCAATCCAAACAAAGTAA
AATCAACCTTGGCAACTTGAAGACGTTCTTGAAGAAACACAAAGAAAAGG
AAAAGGGGAAATGTTGGTCGCTGCTTGCAACATCCTTGGATAAATATTGT
CGGGTATTTCACCATTCATTGGAGATGATGACAACGATACATTGATGAAT
GTTTCCTGTGGTGAATACGAATATGATGACCAAGCGTTCGGTCAAATCAC
CAATGATGCGAAATCCTTCATCGATAAACTGCTTGTCTCGAATCCTAAGA
GTGTTGGTGTTATTACGTACATTCTCACCGGAAATTTTGTCATTCGATCC
TGTTTCCCTGAATAGCGATTTATGCCTGAGAATATTATTTGCGTGAACCG
TAGCAACATGGACATCAAAATCATTGACTTTGGATTGGCTAAACAATTGT
CACATGACAAACCAATCAAGATTACCGCTGGGTCGCCGGAATTTGTGGTG
TTGGCGGAGGTATGTTATTTGAACGTATCGTGGAAAAGAATTCACTTACA
GAAGCGGAATGTGCTTTATACATCAAACAAGTCTTGCAGGGATTACATCA
TCTTCATCTACAAAATATCGCACATCTTGAGTTGAAGAGGTAAATTTGGT
AAAGTATACAAGATGGTAGCCCGAGCTACGGGTGACACCTACGCAGCAAA
ATACATCAAAGTCACACCCAAACTTCGCGAAGACGTTCTGAACACGATTG
ACATTATGAAGAAAATACATCATGTTCGGTTGATGAATTTGTTTGATGTT
TACGATCTGGGATCACAGATTGTCATGATTCTAGAATAACCAATCATTGC
TTGTTCCTCCACGTGATGATATTCGAATCAAAGTCACAGATGTCTCAAAA
GCTTTCGAACAAAGTGAAGAAATTTCAAGGAGCTGATAGAACTCGAAGAA
GATGGAAAAAGATTTAAATGATCGTGAGGAACGAATAGAACAGTTAGAAC
ATGAAATTCAAGTCGAAAGAGACACGATAAAATCGAAAGAAGATTTAATC
GAAGAATTAACGATTCAACTCGAAGAGCTTAAGGAAACTTTGGAAATGAA
AGAGGAGAAGATATTGGAATTGGAAAAAGATTTTGAGAACGCAAGTGTTG
CTCTTATGAACGGTATCAAACAAATGGAACAACAACCTCGATCTGGTGAA
GATATACACGAACTGGAGGCTCAATTACAAGATAGTTTAGATGAGCGCGA
TGGTTTTATGAAAGAGATTAAGAAACTCGAACGAGAGCTAAAGAAAATCA
ATAATAGCCTGGAGGAAGAGAAAAATCAGACACGCAGGCTAGGAATTAAA
CTTGAGGACGCAAATTACGAGATCGGGAGATTAAGACAGGAACTTATCAA
CTCGCAACTGGAGAACGAAAAAATAGTGGAAGAAAACGAAGATTTAGCTG
TGGATAACGAGGATTTGATCAAAGAGCGAGATGAGATTATACAAATTTAC
GAGGAATTGTATCGAGAGAGTGAACGATTAAAACACGAGGTCAAAATTTG
GAAGACTGTGTTCGATAACAATAAAGATAACATTGATGAGGATGAAATGC
GAGAAGCGATGAGCGAAGGTGACGCACTTGAGGAGAATGGGAAGGAGTCT
TCAGATGAAGAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000130XLOC_000130Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000239-exon-sc0000001-1575043694:2112492..2112567TCONS_00000239-exon-sc0000001-1575043694:2112492..2112567Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1575043694:2089787..2091674TCONS_00000239-exon-sc0000001-1575043694:2089787..2091674Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1575043694:2088550..2088571TCONS_00000239-exon-sc0000001-1575043694:2088550..2088571Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1575043694:2088145..2088235TCONS_00000239-exon-sc0000001-1575043694:2088145..2088235Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1575043694:2087375..2087575TCONS_00000239-exon-sc0000001-1575043694:2087375..2087575Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1575043694:2086624..2086762TCONS_00000239-exon-sc0000001-1575043694:2086624..2086762Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1575043694:2085951..2086074TCONS_00000239-exon-sc0000001-1575043694:2085951..2086074Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1575043694:2082320..2082368TCONS_00000239-exon-sc0000001-1575043694:2082320..2082368Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1575043694:2082024..2082050TCONS_00000239-exon-sc0000001-1575043694:2082024..2082050Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1575043694:2081098..2081250TCONS_00000239-exon-sc0000001-1575043694:2081098..2081250Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1575043694:2080695..2080740TCONS_00000239-exon-sc0000001-1575043694:2080695..2080740Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1575043694:2080157..2080231TCONS_00000239-exon-sc0000001-1575043694:2080157..2080231Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1575043694:2079465..2079995TCONS_00000239-exon-sc0000001-1575043694:2079465..2079995Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1510915933:2112492..2112567TCONS_00000239-exon-sc0000001-1510915933:2112492..2112567Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1510915933:2089787..2091674TCONS_00000239-exon-sc0000001-1510915933:2089787..2091674Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1510915933:2088550..2088571TCONS_00000239-exon-sc0000001-1510915933:2088550..2088571Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1510915933:2088145..2088235TCONS_00000239-exon-sc0000001-1510915933:2088145..2088235Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1510915933:2087375..2087575TCONS_00000239-exon-sc0000001-1510915933:2087375..2087575Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1510915933:2086624..2086762TCONS_00000239-exon-sc0000001-1510915933:2086624..2086762Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1510915933:2085951..2086074TCONS_00000239-exon-sc0000001-1510915933:2085951..2086074Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1510915933:2082320..2082368TCONS_00000239-exon-sc0000001-1510915933:2082320..2082368Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1510915933:2082024..2082050TCONS_00000239-exon-sc0000001-1510915933:2082024..2082050Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1510915933:2081098..2081250TCONS_00000239-exon-sc0000001-1510915933:2081098..2081250Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1510915933:2080695..2080740TCONS_00000239-exon-sc0000001-1510915933:2080695..2080740Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1510915933:2080157..2080231TCONS_00000239-exon-sc0000001-1510915933:2080157..2080231Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1510915933:2079465..2079995TCONS_00000239-exon-sc0000001-1510915933:2079465..2079995Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1491911889:2112492..2112567TCONS_00000239-exon-sc0000001-1491911889:2112492..2112567Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1491911889:2089787..2091674TCONS_00000239-exon-sc0000001-1491911889:2089787..2091674Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1491911889:2088550..2088571TCONS_00000239-exon-sc0000001-1491911889:2088550..2088571Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1491911889:2088145..2088235TCONS_00000239-exon-sc0000001-1491911889:2088145..2088235Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1491911889:2087375..2087575TCONS_00000239-exon-sc0000001-1491911889:2087375..2087575Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1491911889:2086624..2086762TCONS_00000239-exon-sc0000001-1491911889:2086624..2086762Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1491911889:2085951..2086074TCONS_00000239-exon-sc0000001-1491911889:2085951..2086074Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1491911889:2082320..2082368TCONS_00000239-exon-sc0000001-1491911889:2082320..2082368Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1491911889:2082024..2082050TCONS_00000239-exon-sc0000001-1491911889:2082024..2082050Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1491911889:2081098..2081250TCONS_00000239-exon-sc0000001-1491911889:2081098..2081250Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1491911889:2080695..2080740TCONS_00000239-exon-sc0000001-1491911889:2080695..2080740Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1491911889:2080157..2080231TCONS_00000239-exon-sc0000001-1491911889:2080157..2080231Clytia hemisphaericaexon
TCONS_00000239-exon-sc0000001-1491911889:2079465..2079995TCONS_00000239-exon-sc0000001-1491911889:2079465..2079995Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000239-proteinTCONS_00000239-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2079465..2112567 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 3.25327 5.81361 4.93797 3.17853 1.43013 0.834011 0 0.222224 3.4926 2.36378 0.927469 0.50726 7.80437 8.03284 5.58539 4.24914 4.91212 5.82998 5.27688 5.38975 4.75033 6.29129 4.65682 3.4964 0.781912 2.15009
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
molecular_function GO:0005524 ATP binding
molecular_function GO:0004672 protein kinase activity
Blast
BLAST of TCONS_00000239 vs. Swiss-Prot (Human)
Match: MYLK (Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4)

HSP 1 Score: 268.085 bits (684), Expect = 2.905e-73
Identity = 127/302 (42.05%), Postives = 209/302 (69.21%), Query Frame = 3
Query: 2040 VSKAFEQSEEISRGKFGKVYKMVARATGDTYAAKYIKV-TPKLREDVLNTIDIMKKIHHVRLMNLFDVYDLGSQIVMILEYVGGGMLFERIVEKN-SLTEAECALYIKQVLQGXXXXXXQNIAHLELKPENIICVNRSNMDIKIIDFGLAKQLSHDKPIKITAGSPEFVAPEILSFDPVSLNSDLWSVGVITYILLSGISPFIGDDDNDTLMNVSCGEYEYDDQAFGQITNDAKSFIDKLLVSNPKKRGNVGRCLQHPWINSNWQSKQS-KINLGNLKTFLKKHKEKVNVSARGAIRRFSSF 2936
            VS  ++  E +  GKFG+V+++V + T   +A K+ K  + K +E++   I IM  +HH +L+   D ++  + IVM+LE V GG LFERI++++  LTE EC  Y++Q+ +G+ ++H Q I HL+LKPENI+CVN++   IK+IDFGLA++L +   +K+  G+PEFVAPE+++++P+   +D+WS+GVI YIL+SG+SPF+GD+DN+TL NV+   +++DD+AF +I++DAK FI  LL  + K R +  +CLQHPW+  + ++ ++ K++   +K ++ + K +   +A  AI R SS 
Sbjct: 1460 VSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSM 1761          
The following BLAST results are available for this feature:
BLAST of TCONS_00000239 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MYLK2.905e-7342.05Myosin light chain kinase, smooth muscle OS=Homo s... [more]
back to top