Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000234 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000234
Unique NameTCONS_00000234
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2357

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000234 ID=TCONS_00000234|Name=TCONS_00000234|organism=Clytia hemisphaerica|type=transcript|length=2357bp
TACAGGTATTCAAACACGGCTCTTACAATGTATTCGTGAAGACGATCAAA
GTGTGGTCAGTTCCTCATCATGCGAAGGTTTAGAGGGACCTGTAACGCAA
CAATCATGTAATGCTAATGTTTGCCCCGCATTATGGTACGTCACCGAATG
GACCAAATGTTCGAAACTTTGTGGAAGTGGTACAAAGACAAGGAAACTTT
ATTGTTCACGTATCGACGGAACGGGACAACGTATCACAGTTGACGATAGC
GAATGTACGGGTGAAAAACCGGAAGACGTAGAGTTTACGTCAACATGTAA
CGTTATTGCGTGTCCTGCGTATTACGTTTACGGAGAATGGACCCAGTGTT
CTGCTTCATGCAACGGTGGAAAACGCAGTCGATCATCGATCTGTAAACAT
ATCAGTGAAGTTGGAAAACTTGTTACAATCAATGTACAAGCTTGTCTATA
TCTTGGTGATCCTTTGGTCTCTGAAACATGTAATGCTGATATTCCATGTC
CTGAATGGAAGATTGTATACTCCGAATGCTCCAAAACTTGCGATGGAGgt
ATTCAAACAGCATCTGTTGTTTGTACTGACCCCGATTCAGGAACTCAAGT
GGATGCTTCAACGTGTGATGCTTCGAAAAAACCTACGGTAACCGATGCGG
ATAGTAAAGCTTGCAACGAAGAATTATGTGATCCTTATGTCTGGAGAGAA
CAAGATGGTGTTTGTAGCGTGACCTGCGGAAAAGGTCTTTTGCCAATTAC
ACAAGTCTGTTTCGGACgtgttgaaaagaaaaatgtcgAAGAATCAAAAT
GTCCGTCGCCTAAACCTAAAGATCCGACACCGAAAGAATGTGATGCAGGC
GCATGTCCAGAAACATATTCATGGAAAACCAAATTCAGTGAATGTAGTGT
TACTTGTGGCACAGGTACCAAAACTCTAGAACCTTATTGCGTCAAAGATT
CCGATCAAAGTACATCGAACGAGGTGTTGTGCGATCCAGCAAAGAAACCT
GGCACTAGTACCGAACAATGTGCGCTTGGTGATTGTCCAATCAAATATTC
TTGGAACACGGAGATGAGTGAATGCAGTGTAACGTGTGGTGAAGGTGTGA
AAACGGCGTCGTACAAATGCGTCCGCAGTACAGATAACGCTCAAGTGGAT
GACAGTAAATGCGAAGGAATCGCAAAACCAAATATTGCTAATGAGAAATG
TGTTGAAGCTGCCTGTCCACCTACTTACTCTTGGAGAAAACATAATTCGT
CCTGCAGCGTCTCTTGTGGATCAGGAATCATTACTCAATCTGGTCATTGC
CACCGAGACGAAGATGGCGAGAGAATGGAAGAATCCTTCTGTAATGTTTC
ACAAAAACCAACAACACAGACTTTCTCATGTCATAAAGAAGCATGTAAAG
CACCGTTCTATTGGAAAGGCAACTTTGGGCGTTGTATGGCTACTTGTGGA
AGCGGGCACAAATTGAAAGTCTTGTCATGCGTAGAAAGAGCAACAGGTCA
CGTGACAGAAAACGAAAAATGTAAAGATGCAGCAATTCCCGATGACGAGC
AATGTACAATGGAGCCATGTAAACCAGTATTTGAGACGGACAAGATGCCA
CCAACGTATGCAGTGGGTTGCTATGGTGACCAACCAACACCAAGACGTGT
ACCAATTTATTTGGAAAACATGAAAGATATCTACGATCCAGCTAACCCAC
TTCCAATGATTCAGAAATGTGCTGAGAAGGCTCACTCCATGGGTTATGTA
TATTTCGCAACACAATACTTCGGAGAATGTTGGGCTGGTGACTTGAATAC
TGCAGAACAATATTATTTGAATGGATACACTGATAGATGTGAAAATGGTA
TTGGTAAAGTTGCTGCTAATTTTGTATACAAGATTGGAACGCCAGAATCA
TATCCACCAGTACCAGCTCTGGTCAACCTTGGATGTTACAATGATGACCC
AGAAGATCGATCATTCCAAACACATCTTGATAACTTCCGACCAATCCTCG
ACTGGGACAAGAAAAACTTTGATGATCTGGTTACTAAATGTGCTCAATCA
GTGAGCCGACGAAAATGGAATGTTTTTGGTATTCAATATTACGGTGAATG
TTGGAGCGGTGAAAATGCTGTCAATACGTACGCGCATACGGGCAAAGCAG
ATCGCTGCTCGAACGGAATCGGAGAAGTCAACGCAAACGCTGTTTACGTT
TTTGTTGAATAATTTTCATCGATTCATTTATCGATTAGATGACATCATAA
TCTTTTTTTGGGAGGAATCTGggtataattttttataattatttctTTAC
GCatatttatttaatattttattttgggAAATTGTAAATGGATATTTATT
TTTCGAA
Run BLAST on NCBI

protein sequence of TCONS_00000234-protein

>TCONS_00000234-protein ID=TCONS_00000234-protein|Name=TCONS_00000234-protein|organism=Clytia hemisphaerica|type=polypeptide|length=736bp
TGIQTRLLQCIREDDQSVVSSSSCEGLEGPVTQQSCNANVCPALWYVTEW
TKCSKLCGSGTKTRKLYCSRIDGTGQRITVDDSECTGEKPEDVEFTSTCN
VIACPAYYVYGEWTQCSASCNGGKRSRSSICKHISEVGKLVTINVQACLY
LGDPLVSETCNADIPCPEWKIVYSECSKTCDGGIQTASVVCTDPDSGTQV
DASTCDASKKPTVTDADSKACNEELCDPYVWREQDGVCSVTCGKGLLPIT
QVCFGRVEKKNVEESKCPSPKPKDPTPKECDAGACPETYSWKTKFSECSV
TCGTGTKTLEPYCVKDSDQSTSNEVLCDPAKKPGTSTEQCALGDCPIKYS
WNTEMSECSVTCGEGVKTASYKCVRSTDNAQVDDSKCEGIAKPNIANEKC
VEAACPPTYSWRKHNSSCSVSCGSGIITQSGHCHRDEDGERMEESFCNVS
QKPTTQTFSCHKEACKAPFYWKGNFGRCMATCGSGHKLKVLSCVERATGH
VTENEKCKDAAIPDDEQCTMEPCKPVFETDKMPPTYAVGCYGDQPTPRRV
PIYLENMKDIYDPANPLPMIQKCAEKAHSMGYVYFATQYFGECWAGDLNT
AEQYYLNGYTDRCENGIGKVAANFVYKIGTPESYPPVPALVNLGCYNDDP
EDRSFQTHLDNFRPILDWDKKNFDDLVTKCAQSVSRRKWNVFGIQYYGEC
WSGENAVNTYAHTGKADRCSNGIGEVNANAVYVFVE
Run BLAST on NCBI

transcript from alignment at sc0000001:2036582..2050641-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000234 ID=TCONS_00000234|Name=TCONS_00000234|organism=Clytia hemisphaerica|type=transcript|length=14060bp|location=Sequence derived from alignment at sc0000001:2036582..2050641- (Clytia hemisphaerica)
TACAGGTATTCAAACACGGCTCTTACAATGTATTCGTGAAGACGATCAAA GTGTGGTCAGTTCCTCATCATGCGAAGGTTTAGAGGGACCTGTAACGCAA CAATCATGTAATGCTAATGTTTGCCCCGCATTGTAAGTTCAGTAACGCAA CAATCATGTAATGCTAATGTTTGCCCCGCATTGTAAGTTCATTATAAATA AAACATTGAGTTTGAAGCCCCGAATGAGGTCGAGAGGAATCTTTAACCTT TCACAAGCAAGAAAAAGTGAAAGCCTTAAGATTGGTGCCGTATTTATAAT GACGGATTGAATCTATTCATTTCTTTGTTTTTAAGCGGAATATTTTCCAA AATCTGGCGATAGGTTTTACTTTCAATCTGGCATTTATCTATTTTTTTTA TTTACAGTAATATATTTCCCAGGTCTATCAACCTCTATGAAATAATCATG CTTAACATTTTACAATTTATGGAGATCTTTTTCCCATTCTGTGAGCACTT TTTCTTTGAAGTTGGCGACAGATGTTGCAGCTACAACATCAACTCCAAGA CCATTCCATATGTCAATACTTCTGTAGAACAACGAATTTGTTTGATACCC TNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNATACCCTCTGACACCATCATTTGCAAAGTTTCTTTGTAGTTCGT AATCGTGCTGACGTTTCGGGCGTTCGCGAAGGACAAACTTTTGACAGGCC GATGATGATTTTTGATGATATTTATGTGAAAACTTTTAGTTTTAAAACAC GTTCAATTCGGTAGAAGGTGATAGAGAGTGAGAAATTCTCAATAAAGCTT GGAAACTTAGTCCGACTGTGAAGTTATTCCGTTCCTCCTTGTTATACGTT TTTCTTTCTTTATTAGATGGTACGTCACCGAATGGACCAAATGTTCGAAA CTTTGTGGAAGTGGTACAAAGACAAGGAAACTTTATTGTTCACGTATCGA CGGAACGGGACAACGTATCACAGTTGACGATAGCGAATGTACGGGTGAAA AACCGGAAGACGTAGAGTTTACGTCAACATGTAACGTTATTGCGTGTCCT GCGTATTACGTTTACGGAGAATGGACCCAGGTACGGATAGCTTCTCATCT AACAGTTCTGTTAAGTTTCGAAACAAAAATGAAACCACTCTATTGGCTAG AATTGATGTAATCCTTCACCCAGATGTGGGTCAATAATATAAGAATTATT TCGATTTTTTCCTTTATCGCTTAGGAAGTTTCAAACAATAATTCCGACCA TCCTATCTCTCTTTGTTCCTATCTCTGAAAAGGAATGACGAAATTGAACA GGGTGTCCATTATAAGACCACCTCCGCCCACAAGTATCTTGACTGCAAGT TGACAACAGTAGTTGACCTTACGGGAAATTTGTTCAATCAGAGCTAAACA ACTGACATGTCAAGAAATGAGGAGGCAAGAGAGTTGTCCTGTTTGATTAA ATTACCGGTATCCAAACTGTGGTCTACTTTTAGAAGATTTAGAATTATTT TGCTTCAGCCAAGGATAGAGTAACTCCATCTAGTGTTCTATATAAGAAAT ATGTGTGTCTCAGCTACGGTATGTTTTATTTCAATATTTTTTCTGGCACT AGTGTTCTGCTTCATGCAACGGTGGAAAACGCAGTCGATCATCGATCTGT AAACATATCAGTGAAGTTGGAAAACTTGTTACAATCAATGTACAAGCTTG TCTATATCTTGGTGATCCTTTGGTCTCTGAAACATGTAATGCTGATATTC CATGTCCTGAATGGAAGATTGTATACTCCGAATGCTCCAAAACTTGCGAT GGAGGTACCTAAGTTATTTTCAACTTACTTTTACCATAGTTTTTCTACTT GGAAAGTTTATAATATTTCGTCTGGCTCTGATGGGACCGAGACTCCCAAA ACCATCACAGCAGAATCACCTAAATATTTCATCACTTATATGGTTTTGCT CACACGGGAACCAATCCTGACTAGATTTGAAATCGGACCTTCACTTCTAC TTAAACTCAACATGAGCAGAGGATATGTTCTCTCCGTCTCCGGAGAGAAC ATCCGTCTTTGAATAGTCTCATCTCCGTCTTTGAATAGTTATGTGATTGA GATATCAGGCCCGGAGGAACAACCGTAAAAGTGGGCTCAAATGAAATAAA ATTCGCTAGGAATTCGAGGAAAAAAATCTCATTTGCTCAAAAGGGTAGAG GCTGAATTTTCCCCAGTCTGCCCGCTTCCGCTGGGCCTGGACATGCGCGA TGAAATTCTTATAGTCTGTCGCCACAGGTTAAATTTCAGTAAAAGCTAAA CTGTGGTGCTCATGGTAATAATCGTTAAAATTCTTCTTAGAAGCAATATA CTGTCAAACTTTCAAAATTTGTGCGAAACGTCCAAACACCGTCCATATAG AGTCATATAACCTTTATATACCCGGGACACAGTTCCTTGCTTTTGGTCAA AAGAAATCTTCGAAAGTGGTACCCTTTTCTTTTTGGTACCATTACAAAAA CAGTCATTCGATTTCAAACAATGCTATGTTACTACACGTTTTTTTATAAC AACATCCAAAATTTTTGAAGCCTTTGGATGTTCTTAACTTTTTGAGTTTT AAGCCTAAAATATTCTTAACATGTTCATATTTGACCATTTTGTGAGTATT TTTGACCATTTTTCTAAAAAATAGAGTGTTTTTGAGTCTACAAAGCCTTA AAATGTTCTTTAACTTGTTCTTAACATTTCGGCCATCGAAGCCTTGTGTT CTTATATAGTTTGTTCTTATAAAAAAAACGTGTACCTGTAAAGTATCCAT TGAAAGTGGCCCTCGTCATTTTTCATGATTTCATTTTTTTCAGGTATTCA AACAGCATCTGTTGTTTGTACTGACCCCGATTCAGGAACTCAAGTGGATG CTTCAACGTGTGATGCTTCGAAAAAACCTACGGTAACCGATGCGGATAGT AAAGCTTGCAACGAAGAATTATGTGATCCTTATGTCTGGAGAGAACAAGA TGGTGTTTGTAGCGTGACCTGCGGAAAAGGTAATCTCGTTCCCAAACATC TCGATGTATGATTTTATTCGTGATATCTGTGACGTAATGTTTTATACGGA AATAACTAAAATATCCTAGGCAATTACCACTATTTTTGTTTTTTAAATAC AAGATTATGGTCAAATACCCGGGACAGTGCAATTTCTTTTCCAAAAAGGA TGGGAAGCTACGGTTTTTAAAAGATGTAACCATTTGGAGATTGAGTGGCC CATTCGTCAAAATAAGGTTTTCAATGAGATTTTTTATTTAATATTTCAAT TCATTTATAGGTCTTTTGCCAATTACACAAGTCTGTTTCGGACGTGTTGA AAAGAAAAATGTCGAAGAATCAAAATGTCCGTCGCCTAAACCTAAAGATC CGACACCGAAAGAATGTGATGCAGGCGCATGTCCAGAAACATATTCATGG AAAACCAAATTCAGTGAATGTAGTGTTACTTGTGGCACAGGTTTGCATAT TGTTACTTCTTAGTGTTGATTTCAACTCTTATTGTTTCAATTTAGTTAAC AAAAGGAAGAACAACGAGGCCGCGCGAGCATAGATTTGAAATAATAGACC TTTTGATAAATTACGTCACGAACCTCACTTGCCTCGTTTTGAAATTATTG CCAAGGTGATTAACTCCCAGCAGATTTTATTAAAACTACTTTCTATTTAT AAAAAAATTATTTTTGGTAATTGTTTGAATACGAGGCAAGCGATGCTAGT AACTTAATTTATCAAAAGGTCTATTCTTTCATCAGTTATCCTTTAGTCCT ACGACAGACCATCCATATTGAACCAGCACTGCTCTAAGGGTGCAGATATT ATTATTATGATCTGTCGAACTTGTTTAGCTTATGCGATCAACACTGCGAC AACTTTCGCCTGAAAACAAAGTTGAAAACAACGGGGTCATGTTATTGATC GCCGTATATTGTTTTGAAAATTACGTCGTGTCCAGCTGGATAATATACTG CCTCCATCTAAACTAAATTGTTAAAAAAGGAAACAATAAAACTTTATTTT AATTCTTTTCAGGTACCAAAACTCTAGAACCTTATTGCGTCAAAGATTCC GATCAAAGTACATCGAACGAGGTGTTGTGCGATCCAGCAAAGAAACCTGG CACTAGTACCGAACAATGTGCGCTTGGTGATTGTCCAATCAAATATTCTT GGAACACGGAGATGAGTGAATGCAGTGTAACGTGTGGTGAAGGTATTTTC AGACTTTTCTTTCTTTAAACACAGTAAATAACTTCGAAGTTTCTTGCCTC TTCAGCACTACACACTTTTTTATAAGCAACCAGGCTGCTAAGGCTTGATC CCTCAAATTCTGTTTCACTATCTCGTAAAGTAAAAGCGTTTTAGATAATC TAACCATGGTAGGTGATAGCCATTGACCCAATATGTATAAATATGGTTGT ACAGTCAAAGCAAATTTTTCAGAAAGTGAGCTTTAATGCTAAAAGCAAGC CCAGCCCTGACCCGCAAAAATTGAAGTTGCTTATACAAAAAAAATGTGCT ATACTTTACAAAAGGAAAAAAAGTACCTTTTAGGGACGTCTCGCACTTTC GTCCTACGAAAATCGACCTATTTTCAATTTTTGGGATTACAGTAGTTTTT ATCATAATCTTTCGGAATTGAAAATAGATCAGCTATCCGTCCAACATTTT CATCGTTAATGTTTCTTTAGGCTGAGCGTATCCCCGAAATTGATTTTGAT ATAGGGGATGTGTATTATGAATAAAATTCCCGCCCGACAGTTACCCCCGT CTTTGTGTTTTTGGGTGGTATATTTTATCGAACAGGCTAAGTGAGCTTTA CGCTTTCTGTGTGTCTTTACTCGAAAAACGAAGGAGAGTCATATCAGCCG AAAGGTTGGCGTGCTTTTAGCTTTTCCAAGCAGAAAAAAATATGATTGCT GTTGTTTTCGAAAACCCACGGAGCTTATGAAATTATATTGTGATGTCACG TGGCCTAGATAGGATTTCCTACCTAACCACGGCGCACTCTATCTGCTACC CCTTTACAGAAATCTGTGATCACATCTGATCTGTATTATTTTTTTAGGTG TGAAAACGGCGTCGTACAAATGCGTCCGCAGTACAGATAACGCTCAAGTG GATGACAGTAAATGCGAAGGAATCGCAAAACCAAATATTGCTAATGAGAA ATGTGTTGAAGCTGCCTGTCCACCTACTTACTCTTGGAGAAAACATAATT CGTCCTGCAGCGTCTCTTGTGGATCAGGTATAAAATGCTTTAGTCTAATA CACGGGATGTAAAATTATACCAGTGCAGTCAAAACATGTGATTACTAAAA AAAGTTCACATGATTTTATTCCCATGTTACTTATGCTTTACAACTTACAG CTGATAACTTTATTAGTGTCAATAAATTCGAACCAATCAGAAATAAATGT CATGTAACAAACACATAGAAATTTCGAGTAAAAGCGTGATTTGTCTTCAG ACTTTAATTTTGCAAGCTGTGTATTGAATTTTCACGAGTTTTTATCACGC TTTTCGCAAAATCTCTTTCAAGCATTTTCTAAACGTATTATATTATGAAT ATCATACAGGAGTTGAAATACAGTCTTTGCTTATAGAAAATTGAAAAAAG TCAAAATCTTGACTTTTTGTTAAAGTTGAAATTAGGCATCACATTAACTT AAGACGGTCAACTTTCTGTGATCGCCCAAAGTAAGGCGAAGTGAGGTTAC ATTTTGCAAGTCACCAAAGTCGCAAACCTTGAAATTATAATTTCGCCTTT TGTAGATTTTATCGCTGATAATATTTATATTGACTCGTAAACTTTTTATC CAATAAACTTTTCGATTTTGATGACTCGCAAAATATAACTTCAATCGTTT TCCTTCGGACGATCTTCTCACAGAAAGTTCATCGTCTAAAGTCAATCTGA TGTCTAATTTTGACTTCAAAATATTGGCTTTTTCAATTTTCTTTAAGCAA AGACTGTATTAAGCAAGTTCTTTAATGCTTATCTTATGTCACGTGACCTA ATTTGAAGAGACTGGGATTCGAGTCGGGGCCCTTAGTTATAGTTGCGTTG ATACCTTAGACCATTCGTCTATACGCTTCTCAGTGTTAAAAGTTCTTATG TCTCAGACGGATTTCCGTCTCAGCAAAGTATGTAAAGAGGTTCCCGTCTC GAAACTCTGCATAATGTACCAAAATCTCAAGAATATATGTGCTATTAGAC CTTTTCATAAATTACGTTACGAAAATCACTTGCCTCGTTTCGAAATTATT GCCATGGTGATTAACTCCCAGCAGATTTTATTAAAACTACTTTCTATTCA TAAAAAAATCATTTAATGTCTCGAGGGGACATAATCATTATGGTAATTGT TTGAATACGAGGCAAGTGAGGTTCTTGACGTAATTTATGAAAAAGGTCTA TTTGCTATGTAAAATCCATTTCCCGTTTCAAACTAAAAAACTTGCTTTGA CCACTGATTCCTATAATAAGAATTTCTTTTGATTTCATTATCTCACATCA GGAATCATTACTCAATCTGGTCATTGCCACCGAGACGAAGATGGCGAGAG AATGGAAGAATCCTTCTGTAATGTTTCACAAAAACCAACAACACAGACTT TCTCATGTCATAAAGAAGCATGTAAAGCACCGTTCTATTGGAAAGGCAAC TTTGGGCGTTGTATGGCTACTTGTGGAAGCGGTAAGTGGCCCCATGATTT TCGTGTATTGTATTTCAACATAAAATTCGTGCATTTGTTACATGATATGT GCAGATTTCCCTGTGAGAAAGATGTTGAAAAAATCTTTTGACGGAAGGTG CTTTTTAGCCATATGCCTTATAAGGAAATGAAGGTTCTCCGTCGTAAATT TTGAACCCCCTGTGATCCGCAACTGTTTGAGAGATTTTTTTATCCCCCTT CTTTTTATGATTTCCACACACAACCTATTCCTTTTCTTACCGTCAGGGCA CAAATTGAAAGTCTTGTCATGCGTAGAAAGAGCAACAGGTCACGTGACAG AAAACGAAAAATGTAAAGATGCAGCAATTCCCGATGACGAGCAATGTACA ATGGAGCCATGTAAACCAGGTACAACTTGATTCTCCCTGATCGTTTCCCG ATTTCCCCCAATAGTTGGCCGATTATACCTTGATCAATAATTGGAGCTGT TATTTATTTTCCACATTTTGATTTCATCCATTTTAAATGAAGATATTGCA TAGAACGTCTTTTTTGACGGAAAAATGAGGAAAAAAATGGATTAGATCTT TAATTTTTAATGTTATTTTTAATTAGTCCAATTCTAATGACAATATGCTT CGTGAGTGGAAGGAAAGACTAGTTTTGAATAACTGAGAGCTCCCCTATCG TCTGGCTAAATATGTTACCCCTTAGCCAAANGGGATAACACACACAAACT TTTCTACTCAATCGCATGTTCAAACTCGATACTTTAATTAGGGACACCCT GTATTATGAATATCATACAGGAGTTGAAATACAGTCTTTGCTTATAGAAA TCTTGACTTTTTGTTAAAGTTGAAATTAGGCATCACATTAACTTAAGACG GTCAACTTTCTGTGATCGCCCAAAGTAAGGCGAAGTGAGGTTACATTTTG CAAGTCACCAAAGTCGCAAAATTTGAAATTATAATTTCGCCTTTTGTAGA TTTTATCGCTGATAATATTTATATTGACTCGTAAACTTTTCATCCAATAA ACTTTTCGATTTTGATGGCTCGCAAAATATAACTTCACTTCGTCTTCCTT AGGACGATCTTCTCACAGAAAGTCCATCGTCTAAAGTCAATCTGATGTCT AATTTTGACTTCAAAATATTGGCTTTTTCAATTTTGTCTAAGCAAAGACT GTATTAAGCAAGTTCTTTAATGCTTATCTTATGTCACGTGACCTAATTTA TAGAGACTGGGATTCGAGTCGGGGCCCTTATTTATAGTTGCGTTGATACC TTAGACCATTCGTCTATACGCTTCTCAGTGTTAAAAGTTCTTTCGTCTCA GACGGATTTCCGTCTCAGCAAAGTATATAAAGAGGTTCCCGTCTCGAAAC TCTGCATAATGTACCAAAATCTCAAGAATATATGTGCTATTAGACCTTTT CATAAATTACGTTACGAAAATCACTTGCCTCGTTTCGAAATTATTGCCAT GGTGATTAACTCCCAGCAGATTTTATTAAAACTACTTTCTATTCATAAAA AAATCATTTAATGTCTCGAGGGGACATAATCATTATGGTAATTGTTTGAA TACGAGGCAAGTGANGATGTCTCGAGGGGACATAATCACCATGGTAATTG TTTGAATACGAGGCAAGTGAGGTTCTTGACGTAATTTATGAAAAAGGTCT ATTTGCTATGTAAAATCCATTCCCCACCTTGCTTTGACCACTGACTCCTA TAATAAGAATTTCTTTTGATTTCATTATCTCACATCAGGAATCATTACTC AATCTGGTCATTGCCACCGAGACGAAGATGGCGAGAGAATGGAAGAATCC TTCTGTAATGTTTCACAAAAACCAACAACACAGACTTTCTCATGTCATAA AGAAGCATGTAAAGCACCTTTCTATTGGAAAGGCAACTTTGGGCGTTGTA TGGCTACTTGTGGAAGCGGTAAGTGGCCCCATGATTTTCGTGTATTGTAT TTCAACATAAAATTCGTGCATTTGTTACATGATATGTGCAGATTTCCCTG TGAGAAAGATGTTGAAAAAATCTTTTGACGGAAGGTGTTTTTTAGCCATA CTCCTTATAAGGAAATGAAGACTCTCCATTTTAAATTTTGAACCCCCTGT GATCCGCAACTGTTTGAGAGATTTTTTTATCCCCCTTCTTTTTATGATTT CCACACACAACCTATTCCTTTTCTTACTGTCAGGGCACAAATTGAAAGTC TTGTCATGCGTAGAAAGAGCAACAGGTCACGTGACAGAAAACGAAAAATG TAAAGATGCAGCAATTCCCGATGACGAGCAATGTACAATGGAGCCATGTA AACCAGGTACAACTTGATTCTCCCTGATCGTTTCCCGATTTCCCCCAATA GTTGGCCGATTATACCTTGATCAATAATTGGAGCTGTTATTTATTTTCCA CATTTTGATTTCATCCATTTTAAATGAAGATATTGCATAGAACGTCTTTT TTGACGGAAAAATGAGGAAAAAAATGGATTAGATCTTTAATTTTTAATGT TATTTTTAATTAGTCCAATTCTAATGACAATATGCTTCGTGAGTGGAAGG AAAGACTAGTTTTGAATAACTGAGAGCTCCCCTATCGTCTGGCTAAATAT GTTACCCCTTAGCCAAAATTGATTATGGTTTTTCCTCTCTAATATCGTCC GCCAACTAGCCGAGAATCCGCCAACTGACCAAAGGAAGTGCCGTCTTTTT AATACAATCATATGAACAAGTTTACTTTCCATTAAATCGAATCTAATATA TAAGAAAATCAAAACTAGCCACAAAATTGTATAAATAAGCTTCATCTAAA GTTCTATAGGAACTTGCCTGGACACCAAACCGTCCGCCAACAGGACCAAT GACTCTAGCGGAAATTCTGTTTAGAGATAGGTGACTTTAATTTCTTTTTC GTNCAACTTGATTCTCCCTGATCGTTTCCCGATTTCCCCCAATAGTTGGC CGATTATACCTTGATCAATAATTGGAGCTGTTATTTATTTTCCACATTTT GATTTCATCCATTTTAAATGAAGATATTGCATAGAACGTCTTTTTTGACG GAAAAATGAGGAAAAAAATGGATTAGATCTTTAATTTTTAATGTTATTTT TAATTAGTCCAATTCTAATGACAATATGCTTCGTGAGTGGAAGGAAAGAC TAGTTTTGAATAACTGAGAGCTCCCCTATCGTCTGGCTAAATATGTTACC CCTTAGCCAAAATTGATTATGGTTTTTCCTCTCTAATATCGTCCGCCAAC TAGCCGAGAATCCGCCAACTGACCAAAGGAAGTGCCGTCTTTTTAATACA ATCATATGAACAAGTTTACTTTCCATTAAATCGAATCTAATATATAAGAA AATCAAAACTAGCCACAAAATTGTATAATAAGCTTCATCTAAAGTTCTAT AGAAACTTGCCTGGACACCAAACCGTCCGCCAACAGGACCAATGACTCTA GCGGAAATTCTGTTTAGAGATAGGTGACTTTAATTTCTTTTTCGTCTGTA CAGTATTTGAGACGGACAAGATGCCACCAACGTATGCAGTGGGTTGCTAT GGTGACCAACCAACACCAAGACGTGTACCAATTTATTTGGAAAACATGAA AGATATCTACGATCCGTAAGTAGGAGATTATACTTTAAGGAAACTTATTT TGGCGGGAACTAATTGTGACGAGCGGCAAAAATCCTGAAAATTTTTAATT TTGGCAGGAACTAATTTTGGCGAGTGAGCAAAATATTTGATTTTGGCGGG AATTAATTTTGGCGAATTTTGTCTAAATTCGCCGAATTCGCCAAAATTAG TTCCCGCTAAAATAAGTTCACCTTTGACCAAGCTAGGTAATTCCGACCCA TCCCCCTATTTTTTGGTTTCACTACATTTCAAAAAATTTCTTGTAATTTT TAAGTCGGTGTCTAGATGCAACTCTATCTTAAGACCTAATTTCCGCGTAG AGCTTTGTACTCTTTCGCATTTTCGGCCAAACAAAACCTTTCATTGGATT TAATAACCTAGATGATTATTGTCCATGGCCAACTCGGTTTTCTATGACCT GAATTCAAGATGGAAGAAGCGAGGACTCGAACCGAGAGCCCCGGGTTTAT TCTTTTTACGGTTTACACACTATTACGCTCTTGTCTTGTACTGTGTTTTA AAGTTCTGATTTTACACTTAGAAATTTGTTTTTTGAGTACTCTATTGACC GTTTTGAGGAGCAAACTCTGCTACTCTCGACACTTGGTGTTTTGAGCATT CTTGGGGCAACAGCAATATCTATGCTCGCTTACCCGAGCTGCACTGACGA GTCCTGGGAAGGACGAAGCACTTGTCTGTAGATATAATTCGAATTACACC TTTTTTTATAAGAGCAAACTATATAAGAACATAAGGCTTCGATGACCAAA ATGTTAGGAACAAGTTAAGAACATTTTAAGGCTTCATGGGCTCTAAAAAA TCCAACTTCTTAGGCAGTTGCACAAAAATAATCGCAAAATGGTGAAATTA AGAATATTCTAAGAACATTTTTAGGCTTAAAACTCAAAAAGTTAAGAACA TTCGAAGGCTTCAAAAATTTTGGATGTTCTTATAAAAAACGTGTACTGCT TTATTTTTAGAGCTAACCCACTTCCAATGATTCAGAAATGTGCTGAGAAG GCTCACTCCATGGGTTATGTATATTTCGCAACACAATACTTCGGAGAATG TTGGGCTGGTGACTTGAATACTGCAGAACAATATTATTTGAATGGATACA CTGATAGATGTGAAAATGGTATTGGTAAAGTTGCTGCTAATTTTGTATAC AAGATTGGAACGCCAGAATGTAAGCTTTTGTATTCTCTGATCATTCGTAA GGATGCCCCCAACTCTGATCACGATATCACGCAATTTTTTGTCTTCAACC ACGGTCACGCAAATCAGCAAAGAAAATGGACAACACGCATTCCTTTGAAA AAGTCCAAATCACGCATCACGGCTCAAAAATCTTTCAAATCATGATCACG TTTTGACCTCTCATCACGCAATCACGAAGAATAAATTACCAAATCAAGTA ATCACGCTGCAAAAAAAGTCCCTTTCACGAAAACCGCTTGGGGGCCTCAT GCATGATTGTTTTGTTAGAATATCTATTAAAGTCCATTTGCTTTAAGTGT GCACTCTTTCTTGCCACCATGTAGAAACCATGCCAGTGAAATTATGGTAA TAGATCTTATCGGAGTAATTCCTCGAGGGAATTCTATTTTAATACCTCTG AAACAATCCCACAATGCATCGCTGTTTTAGAAAAATCAAAAACTCCGATA AGGTCTATTCTTTTGAAAACGGTTTCCACATAATAGCACAATAGAGTGCA CACTGGAATTGCATGGTCTTTACATTGAAAATTGCCCGAACCCTACGTGC TACGAAGACAAATTTAGATAAGTTTGAATCTGAAAAAATAAGCTCCTTCA ATTTTAGTTGATTCTTAAGAATACATCGCACTTCCAGACAATGAACTAAA AATAGTGAATCATATAGAAGAATTAGTTCCAGGCTTTTGTAACAATATTT GGGGTGCCTTATAACGAGGGAAAATTTTCTTTGAAAATATTAATTTTTTA TGAATCCCCGGGTGGTTCGTCCCAAAAGTTTTCGTAAGAGGAGTCTTCGG GGTGCCTCCGAATGTGGTTGCAGACTTACTTACTTTCTTATCATATTTCT TCAGCATATCCACCAGTACCAGCTCTGGTCAACCTTGGATGTTACAATGA TGACCCAGAAGATCGATCATTCCAAACACATCTTGATAACTTCCGACCAA TCCTCGACTGGTATGTATTCTTTAATCAATCTCCTCAAAACTTTAAAACT GCAAGTGATTTTTAAGTGCTTTGAAGTACAGTTCGGAAGTAAAGTTTTAA CTCTGAGTTTTAACATTACATTAGACTTAATACTTAAGACCTTATAATCT GAGGATCTAAAAGCTCAAAAATGTTTCAATAAGGCTGAGAATATAGCCTG AAAGCCACTTAACCCCTCCCAAATCGAAAAATCCTATGAAGCAAAGTGGA AGTACTGAAACTGCAATTCTCGCCCGACCTTTAAATTCTGAAAAACGTTA AAATATCCAAAATTGCCAATATATTTCGGCGCTGATTGTACCATTCACCA TTTTGAACTCGTTGTGTTTTTCAACTTTCACTAAACACAATTACAATAAA CTCCCTCTAATTCGTTCGAACCTCTGTTATTCGAATCATTGAACCCCAGA AGCTAAAAGCTTTAGTCCATTCATATATTCCATCAATCTTTAGGAAATCT CCTTGTTCCTATATCTTGTGAAAAAAGTCGTATGCATTGGACCATTCCAT TTTATATCCATACAGGGGGTTGGACGAACATTTCCAGAGGGTAATCTGAG AAATATTTCCAGGGGGTGTTTTTCCATTTTTCCAAGGGGGTAAAAAGTTA TTTTAAAATTTCCAGGGGTTAAAAGACAGATTTTAGTTTGTCCACCCTCA CTTTAAGGTATGAAAAGAACTTTTCAAAGGGCAATTTATCCACACATTTT CTATAATTTTCTTTTGACTTGAAAAGGTTCGTCCATCCCCTGTATGTTTT TTTTATGGAACAACCCATTTTCGAGAAGCGAATCACTTCCAATTTTTTTG AATTTTTTATGACTTTTCTTCAAGTAATTTACCCCTATTGCTTTTCTCTT TTTCTAGGGACAAGAAAAACTTTGATGATCTGGTTACTAAATGTGCTCAA TCAGTGAGCCGACGAAAATGGAATGTTTTTGGTATTCAATATTACGGTGA ATGTTGGAGCGGTGAAAATGCTGTCAATACGTACGCGCATACGGGCAAAG CAGATCGCTGCTCGAACGGAATCGGAGAAGTCAACGCAAACGCTGTTTAC GTTTTTGTTGAATAATTTTCATCGATTCATTTATCGATTAGATGACATCA TAATCTTTTTTTGGGAGGAATCTGGGTATAATTTTTTATAATTATTTCTT TACGCATATTTATTTAATATTTTATTTTGGGAAATTGTAAATGGATATTT ATTTTTCGAA

Coding sequence (CDS) from alignment at sc0000001:2036582..2050641-

>TCONS_00000234 ID=TCONS_00000234|Name=TCONS_00000234|organism=Clytia hemisphaerica|type=CDS|length=30954bp|location=Sequence derived from alignment at sc0000001:2036582..2050641- (Clytia hemisphaerica)
GGACAAGAAAAACTTTGATGATCTGGTTACTAAATGTGCTCAATCAGTGA
GCCGACGAAAATGGAATGTTTTTGGTATTCAATATTACGGTGAATGTTGG
AGCGGTGAAAATGCTGTCAATACGTACGCGCATACGGGCAAAGCAGATCG
CTGCTCGAACGGAATCGGAGAAGTCAACGCAAACGCTGTTTACGTTTTTG
TTGAATAACATATCCACCAGTACCAGCTCTGGTCAACCTTGGATGTTACA
ATGATGACCCAGAAGATCGATCATTCCAAACACATCTTGATAACTTCCGA
CCAATCCTCGACTGAGCTAACCCACTTCCAATGATTCAGAAATGTGCTGA
GAAGGCTCACTCCATGGGTTATGTATATTTCGCAACACAATACTTCGGAG
AATGTTGGGCTGGTGACTTGAATACTGCAGAACAATATTATTTGAATGGA
TACACTGATAGATGTGAAAATGGTATTGGTAAAGTTGCTGCTAATTTTGT
ATACAAGATTGGAACGCCAGAATTATTTGAGACGGACAAGATGCCACCAA
CGTATGCAGTGGGTTGCTATGGTGACCAACCAACACCAAGACGTGTACCA
ATTTATTTGGAAAACATGAAAGATATCTACGATCCGTCACGTGACAGAAA
ACGAAAAATGTAAAGATGCAGCAATTCCCGATGACGAGCAATGTACAATG
GAGCCATGTAAACCAGGGCACAAATTGAAAGTCTTGTCATGCGTAGAAAG
AGCAACAGGAATCATTACTCAATCTGGTCATTGCCACCGAGACGAAGATG
GCGAGAGAATGGAAGAATCCTTCTGTAATGTTTCACAAAAACCAACAACA
CAGACTTTCTCATGTCATAAAGAAGCATGTAAAGCACCGTTCTATTGGAA
AGGCAACTTTGGGCGTTGTATGGCTACTTGTGGAAGCGGTGTGAAAACGG
CGTCGTACAAATGCGTCCGCAGTACAGATAACGCTCAAGTGGATGACAGT
AAATGCGAAGGAATCGCAAAACCAAATATTGCTAATGAGAAATGTGTTGA
AGCTGCCTGTCCACCTACTTACTCTTGGAGAAAACATAATTCGTCCTGCA
GCGTCTCTTGTGGATCAGGTACCAAAACTCTAGAACCTTATTGCGTCAAA
GATTCCGATCAAAGTACATCGAACGAGGTGTTGTGCGATCCAGCAAAGAA
ACCTGGCACTAGTACCGAACAATGTGCGCTTGGTGATTGTCCAATCAAAT
ATTCTTGGAACACGGAGATGAGTGAATGCAGTGTAACGTGTGGTGAAGGT
CTTTTGCCAATTACACAAGTCTGTTTCGGACGTGTTGAAAAGAAAAATGT
CGAAGAATCAAAATGTCCGTCGCCTAAACCTAAAGATCCGACACCGAAAG
AATGTGATGCAGGCGCATGTCCAGAAACATATTCATGGAAAACCAAATTC
AGTGAATGTAGTGTTACTTGTGGCACAGGTATTCAAACAGCATCTGTTGT
TTGTACTGACCCCGATTCAGGAACTCAAGTGGATGCTTCAACGTGTGATG
CTTCGAAAAAACCTACGGTAACCGATGCGGATAGTAAAGCTTGCAACGAA
GAATTATGTGATCCTTATGTCTGGAGAGAACAAGATGGTGTTTGTAGCGT
GACCTGCGGAAAAGTGTTCTGCTTCATGCAACGGTGGAAAACGCAGTCGA
TCATCGATCTGTAAACATATCAGTGAAGTTGGAAAACTTGTTACAATCAA
TGTACAAGCTTGTCTATATCTTGGTGATCCTTTGGTCTCTGAAACATGTA
ATGCTGATATTCCATGTCCTGAATGGAAGATTGTATACTCCGAATGCTCC
AAAACTTGCGATGGAGATGGTACGTCACCGAATGGACCAAATGTTCGAAA
CTTTGTGGAAGTGGTACAAAGACAAGGAAACTTTATTGTTCACGTATCGA
CGGAACGGGACAACGTATCACAGTTGACGATAGCGAATGTACGGGTGAAA
AACCGGAAGACGTAGAGTTTACGTCAACATGTAACGTTATTGCGTGTCCT
GCGTATTACGTTTACGGAGAATGGACCCAGACAGGTATTCAAACACGGCT
CTTACAATGTATTCGTGAAGACGATCAAAGTGTGGTCAGTTCCTCATCAT
GCGAAGGTTTAGAGGGACCTGTAACGCAACAATCATGTAATGCTAATGTT
TGCCCCGCATTGGACAAGAAAAACTTTGATGATCTGGTTACTAAATGTGC
TCAATCAGTGAGCCGACGAAAATGGAATGTTTTTGGTATTCAATATTACG
GTGAATGTTGGAGCGGTGAAAATGCTGTCAATACGTACGCGCATACGGGC
AAAGCAGATCGCTGCTCGAACGGAATCGGAGAAGTCAACGCAAACGCTGT
TTACGTTTTTGTTGAATAACATATCCACCAGTACCAGCTCTGGTCAACCT
TGGATGTTACAATGATGACCCAGAAGATCGATCATTCCAAACACATCTTG
ATAACTTCCGACCAATCCTCGACTGAGCTAACCCACTTCCAATGATTCAG
AAATGTGCTGAGAAGGCTCACTCCATGGGTTATGTATATTTCGCAACACA
ATACTTCGGAGAATGTTGGGCTGGTGACTTGAATACTGCAGAACAATATT
ATTTGAATGGATACACTGATAGATGTGAAAATGGTATTGGTAAAGTTGCT
GCTAATTTTGTATACAAGATTGGAACGCCAGAATTATTTGAGACGGACAA
GATGCCACCAACGTATGCAGTGGGTTGCTATGGTGACCAACCAACACCAA
GACGTGTACCAATTTATTTGGAAAACATGAAAGATATCTACGATCCGTCA
CGTGACAGAAAACGAAAAATGTAAAGATGCAGCAATTCCCGATGACGAGC
AATGTACAATGGAGCCATGTAAACCAGGGCACAAATTGAAAGTCTTGTCA
TGCGTAGAAAGAGCAACAGGAATCATTACTCAATCTGGTCATTGCCACCG
AGACGAAGATGGCGAGAGAATGGAAGAATCCTTCTGTAATGTTTCACAAA
AACCAACAACACAGACTTTCTCATGTCATAAAGAAGCATGTAAAGCACCG
TTCTATTGGAAAGGCAACTTTGGGCGTTGTATGGCTACTTGTGGAAGCGG
TGTGAAAACGGCGTCGTACAAATGCGTCCGCAGTACAGATAACGCTCAAG
TGGATGACAGTAAATGCGAAGGAATCGCAAAACCAAATATTGCTAATGAG
AAATGTGTTGAAGCTGCCTGTCCACCTACTTACTCTTGGAGAAAACATAA
TTCGTCCTGCAGCGTCTCTTGTGGATCAGGTACCAAAACTCTAGAACCTT
ATTGCGTCAAAGATTCCGATCAAAGTACATCGAACGAGGTGTTGTGCGAT
CCAGCAAAGAAACCTGGCACTAGTACCGAACAATGTGCGCTTGGTGATTG
TCCAATCAAATATTCTTGGAACACGGAGATGAGTGAATGCAGTGTAACGT
GTGGTGAAGGTCTTTTGCCAATTACACAAGTCTGTTTCGGACGTGTTGAA
AAGAAAAATGTCGAAGAATCAAAATGTCCGTCGCCTAAACCTAAAGATCC
GACACCGAAAGAATGTGATGCAGGCGCATGTCCAGAAACATATTCATGGA
AAACCAAATTCAGTGAATGTAGTGTTACTTGTGGCACAGGTATTCAAACA
GCATCTGTTGTTTGTACTGACCCCGATTCAGGAACTCAAGTGGATGCTTC
AACGTGTGATGCTTCGAAAAAACCTACGGTAACCGATGCGGATAGTAAAG
CTTGCAACGAAGAATTATGTGATCCTTATGTCTGGAGAGAACAAGATGGT
GTTTGTAGCGTGACCTGCGGAAAAGTGTTCTGCTTCATGCAACGGTGGAA
AACGCAGTCGATCATCGATCTGTAAACATATCAGTGAAGTTGGAAAACTT
GTTACAATCAATGTACAAGCTTGTCTATATCTTGGTGATCCTTTGGTCTC
TGAAACATGTAATGCTGATATTCCATGTCCTGAATGGAAGATTGTATACT
CCGAATGCTCCAAAACTTGCGATGGAGATGGTACGTCACCGAATGGACCA
AATGTTCGAAACTTTGTGGAAGTGGTACAAAGACAAGGAAACTTTATTGT
TCACGTATCGACGGAACGGGACAACGTATCACAGTTGACGATAGCGAATG
TACGGGTGAAAAACCGGAAGACGTAGAGTTTACGTCAACATGTAACGTTA
TTGCGTGTCCTGCGTATTACGTTTACGGAGAATGGACCCAGACAGGTATT
CAAACACGGCTCTTACAATGTATTCGTGAAGACGATCAAAGTGTGGTCAG
TTCCTCATCATGCGAAGGTTTAGAGGGACCTGTAACGCAACAATCATGTA
ATGCTAATGTTTGCCCCGCATTGGACAAGAAAAACTTTGATGATCTGGTT
ACTAAATGTGCTCAATCAGTGAGCCGACGAAAATGGAATGTTTTTGGTAT
TCAATATTACGGTGAATGTTGGAGCGGTGAAAATGCTGTCAATACGTACG
CGCATACGGGCAAAGCAGATCGCTGCTCGAACGGAATCGGAGAAGTCAAC
GCAAACGCTGTTTACGTTTTTGTTGAATAACATATCCACCAGTACCAGCT
CTGGTCAACCTTGGATGTTACAATGATGACCCAGAAGATCGATCATTCCA
AACACATCTTGATAACTTCCGACCAATCCTCGACTGAGCTAACCCACTTC
CAATGATTCAGAAATGTGCTGAGAAGGCTCACTCCATGGGTTATGTATAT
TTCGCAACACAATACTTCGGAGAATGTTGGGCTGGTGACTTGAATACTGC
AGAACAATATTATTTGAATGGATACACTGATAGATGTGAAAATGGTATTG
GTAAAGTTGCTGCTAATTTTGTATACAAGATTGGAACGCCAGAATTATTT
GAGACGGACAAGATGCCACCAACGTATGCAGTGGGTTGCTATGGTGACCA
ACCAACACCAAGACGTGTACCAATTTATTTGGAAAACATGAAAGATATCT
ACGATCCGTCACGTGACAGAAAACGAAAAATGTAAAGATGCAGCAATTCC
CGATGACGAGCAATGTACAATGGAGCCATGTAAACCAGGGCACAAATTGA
AAGTCTTGTCATGCGTAGAAAGAGCAACAGGAATCATTACTCAATCTGGT
CATTGCCACCGAGACGAAGATGGCGAGAGAATGGAAGAATCCTTCTGTAA
TGTTTCACAAAAACCAACAACACAGACTTTCTCATGTCATAAAGAAGCAT
GTAAAGCACCGTTCTATTGGAAAGGCAACTTTGGGCGTTGTATGGCTACT
TGTGGAAGCGGTGTGAAAACGGCGTCGTACAAATGCGTCCGCAGTACAGA
TAACGCTCAAGTGGATGACAGTAAATGCGAAGGAATCGCAAAACCAAATA
TTGCTAATGAGAAATGTGTTGAAGCTGCCTGTCCACCTACTTACTCTTGG
AGAAAACATAATTCGTCCTGCAGCGTCTCTTGTGGATCAGGTACCAAAAC
TCTAGAACCTTATTGCGTCAAAGATTCCGATCAAAGTACATCGAACGAGG
TGTTGTGCGATCCAGCAAAGAAACCTGGCACTAGTACCGAACAATGTGCG
CTTGGTGATTGTCCAATCAAATATTCTTGGAACACGGAGATGAGTGAATG
CAGTGTAACGTGTGGTGAAGGTCTTTTGCCAATTACACAAGTCTGTTTCG
GACGTGTTGAAAAGAAAAATGTCGAAGAATCAAAATGTCCGTCGCCTAAA
CCTAAAGATCCGACACCGAAAGAATGTGATGCAGGCGCATGTCCAGAAAC
ATATTCATGGAAAACCAAATTCAGTGAATGTAGTGTTACTTGTGGCACAG
GTATTCAAACAGCATCTGTTGTTTGTACTGACCCCGATTCAGGAACTCAA
GTGGATGCTTCAACGTGTGATGCTTCGAAAAAACCTACGGTAACCGATGC
GGATAGTAAAGCTTGCAACGAAGAATTATGTGATCCTTATGTCTGGAGAG
AACAAGATGGTGTTTGTAGCGTGACCTGCGGAAAAGTGTTCTGCTTCATG
CAACGGTGGAAAACGCAGTCGATCATCGATCTGTAAACATATCAGTGAAG
TTGGAAAACTTGTTACAATCAATGTACAAGCTTGTCTATATCTTGGTGAT
CCTTTGGTCTCTGAAACATGTAATGCTGATATTCCATGTCCTGAATGGAA
GATTGTATACTCCGAATGCTCCAAAACTTGCGATGGAGATGGTACGTCAC
CGAATGGACCAAATGTTCGAAACTTTGTGGAAGTGGTACAAAGACAAGGA
AACTTTATTGTTCACGTATCGACGGAACGGGACAACGTATCACAGTTGAC
GATAGCGAATGTACGGGTGAAAAACCGGAAGACGTAGAGTTTACGTCAAC
ATGTAACGTTATTGCGTGTCCTGCGTATTACGTTTACGGAGAATGGACCC
AGACAGGTATTCAAACACGGCTCTTACAATGTATTCGTGAAGACGATCAA
AGTGTGGTCAGTTCCTCATCATGCGAAGGTTTAGAGGGACCTGTAACGCA
ACAATCATGTAATGCTAATGTTTGCCCCGCATTGGACAAGAAAAACTTTG
ATGATCTGGTTACTAAATGTGCTCAATCAGTGAGCCGACGAAAATGGAAT
GTTTTTGGTATTCAATATTACGGTGAATGTTGGAGCGGTGAAAATGCTGT
CAATACGTACGCGCATACGGGCAAAGCAGATCGCTGCTCGAACGGAATCG
GAGAAGTCAACGCAAACGCTGTTTACGTTTTTGTTGAATAACATATCCAC
CAGTACCAGCTCTGGTCAACCTTGGATGTTACAATGATGACCCAGAAGAT
CGATCATTCCAAACACATCTTGATAACTTCCGACCAATCCTCGACTGAGC
TAACCCACTTCCAATGATTCAGAAATGTGCTGAGAAGGCTCACTCCATGG
GTTATGTATATTTCGCAACACAATACTTCGGAGAATGTTGGGCTGGTGAC
TTGAATACTGCAGAACAATATTATTTGAATGGATACACTGATAGATGTGA
AAATGGTATTGGTAAAGTTGCTGCTAATTTTGTATACAAGATTGGAACGC
CAGAATTATTTGAGACGGACAAGATGCCACCAACGTATGCAGTGGGTTGC
TATGGTGACCAACCAACACCAAGACGTGTACCAATTTATTTGGAAAACAT
GAAAGATATCTACGATCCGTCACGTGACAGAAAACGAAAAATGTAAAGAT
GCAGCAATTCCCGATGACGAGCAATGTACAATGGAGCCATGTAAACCAGG
GCACAAATTGAAAGTCTTGTCATGCGTAGAAAGAGCAACAGGAATCATTA
CTCAATCTGGTCATTGCCACCGAGACGAAGATGGCGAGAGAATGGAAGAA
TCCTTCTGTAATGTTTCACAAAAACCAACAACACAGACTTTCTCATGTCA
TAAAGAAGCATGTAAAGCACCGTTCTATTGGAAAGGCAACTTTGGGCGTT
GTATGGCTACTTGTGGAAGCGGTGTGAAAACGGCGTCGTACAAATGCGTC
CGCAGTACAGATAACGCTCAAGTGGATGACAGTAAATGCGAAGGAATCGC
AAAACCAAATATTGCTAATGAGAAATGTGTTGAAGCTGCCTGTCCACCTA
CTTACTCTTGGAGAAAACATAATTCGTCCTGCAGCGTCTCTTGTGGATCA
GGTACCAAAACTCTAGAACCTTATTGCGTCAAAGATTCCGATCAAAGTAC
ATCGAACGAGGTGTTGTGCGATCCAGCAAAGAAACCTGGCACTAGTACCG
AACAATGTGCGCTTGGTGATTGTCCAATCAAATATTCTTGGAACACGGAG
ATGAGTGAATGCAGTGTAACGTGTGGTGAAGGTCTTTTGCCAATTACACA
AGTCTGTTTCGGACGTGTTGAAAAGAAAAATGTCGAAGAATCAAAATGTC
CGTCGCCTAAACCTAAAGATCCGACACCGAAAGAATGTGATGCAGGCGCA
TGTCCAGAAACATATTCATGGAAAACCAAATTCAGTGAATGTAGTGTTAC
TTGTGGCACAGGTATTCAAACAGCATCTGTTGTTTGTACTGACCCCGATT
CAGGAACTCAAGTGGATGCTTCAACGTGTGATGCTTCGAAAAAACCTACG
GTAACCGATGCGGATAGTAAAGCTTGCAACGAAGAATTATGTGATCCTTA
TGTCTGGAGAGAACAAGATGGTGTTTGTAGCGTGACCTGCGGAAAAGTGT
TCTGCTTCATGCAACGGTGGAAAACGCAGTCGATCATCGATCTGTAAACA
TATCAGTGAAGTTGGAAAACTTGTTACAATCAATGTACAAGCTTGTCTAT
ATCTTGGTGATCCTTTGGTCTCTGAAACATGTAATGCTGATATTCCATGT
CCTGAATGGAAGATTGTATACTCCGAATGCTCCAAAACTTGCGATGGAGA
TGGTACGTCACCGAATGGACCAAATGTTCGAAACTTTGTGGAAGTGGTAC
AAAGACAAGGAAACTTTATTGTTCACGTATCGACGGAACGGGACAACGTA
TCACAGTTGACGATAGCGAATGTACGGGTGAAAAACCGGAAGACGTAGAG
TTTACGTCAACATGTAACGTTATTGCGTGTCCTGCGTATTACGTTTACGG
AGAATGGACCCAGACAGGTATTCAAACACGGCTCTTACAATGTATTCGTG
AAGACGATCAAAGTGTGGTCAGTTCCTCATCATGCGAAGGTTTAGAGGGA
CCTGTAACGCAACAATCATGTAATGCTAATGTTTGCCCCGCATTGGACAA
GAAAAACTTTGATGATCTGGTTACTAAATGTGCTCAATCAGTGAGCCGAC
GAAAATGGAATGTTTTTGGTATTCAATATTACGGTGAATGTTGGAGCGGT
GAAAATGCTGTCAATACGTACGCGCATACGGGCAAAGCAGATCGCTGCTC
GAACGGAATCGGAGAAGTCAACGCAAACGCTGTTTACGTTTTTGTTGAAT
AACATATCCACCAGTACCAGCTCTGGTCAACCTTGGATGTTACAATGATG
ACCCAGAAGATCGATCATTCCAAACACATCTTGATAACTTCCGACCAATC
CTCGACTGAGCTAACCCACTTCCAATGATTCAGAAATGTGCTGAGAAGGC
TCACTCCATGGGTTATGTATATTTCGCAACACAATACTTCGGAGAATGTT
GGGCTGGTGACTTGAATACTGCAGAACAATATTATTTGAATGGATACACT
GATAGATGTGAAAATGGTATTGGTAAAGTTGCTGCTAATTTTGTATACAA
GATTGGAACGCCAGAATTATTTGAGACGGACAAGATGCCACCAACGTATG
CAGTGGGTTGCTATGGTGACCAACCAACACCAAGACGTGTACCAATTTAT
TTGGAAAACATGAAAGATATCTACGATCCGTCACGTGACAGAAAACGAAA
AATGTAAAGATGCAGCAATTCCCGATGACGAGCAATGTACAATGGAGCCA
TGTAAACCAGGGCACAAATTGAAAGTCTTGTCATGCGTAGAAAGAGCAAC
AGGAATCATTACTCAATCTGGTCATTGCCACCGAGACGAAGATGGCGAGA
GAATGGAAGAATCCTTCTGTAATGTTTCACAAAAACCAACAACACAGACT
TTCTCATGTCATAAAGAAGCATGTAAAGCACCGTTCTATTGGAAAGGCAA
CTTTGGGCGTTGTATGGCTACTTGTGGAAGCGGTGTGAAAACGGCGTCGT
ACAAATGCGTCCGCAGTACAGATAACGCTCAAGTGGATGACAGTAAATGC
GAAGGAATCGCAAAACCAAATATTGCTAATGAGAAATGTGTTGAAGCTGC
CTGTCCACCTACTTACTCTTGGAGAAAACATAATTCGTCCTGCAGCGTCT
CTTGTGGATCAGGTACCAAAACTCTAGAACCTTATTGCGTCAAAGATTCC
GATCAAAGTACATCGAACGAGGTGTTGTGCGATCCAGCAAAGAAACCTGG
CACTAGTACCGAACAATGTGCGCTTGGTGATTGTCCAATCAAATATTCTT
GGAACACGGAGATGAGTGAATGCAGTGTAACGTGTGGTGAAGGTCTTTTG
CCAATTACACAAGTCTGTTTCGGACGTGTTGAAAAGAAAAATGTCGAAGA
ATCAAAATGTCCGTCGCCTAAACCTAAAGATCCGACACCGAAAGAATGTG
ATGCAGGCGCATGTCCAGAAACATATTCATGGAAAACCAAATTCAGTGAA
TGTAGTGTTACTTGTGGCACAGGTATTCAAACAGCATCTGTTGTTTGTAC
TGACCCCGATTCAGGAACTCAAGTGGATGCTTCAACGTGTGATGCTTCGA
AAAAACCTACGGTAACCGATGCGGATAGTAAAGCTTGCAACGAAGAATTA
TGTGATCCTTATGTCTGGAGAGAACAAGATGGTGTTTGTAGCGTGACCTG
CGGAAAAGTGTTCTGCTTCATGCAACGGTGGAAAACGCAGTCGATCATCG
ATCTGTAAACATATCAGTGAAGTTGGAAAACTTGTTACAATCAATGTACA
AGCTTGTCTATATCTTGGTGATCCTTTGGTCTCTGAAACATGTAATGCTG
ATATTCCATGTCCTGAATGGAAGATTGTATACTCCGAATGCTCCAAAACT
TGCGATGGAGATGGTACGTCACCGAATGGACCAAATGTTCGAAACTTTGT
GGAAGTGGTACAAAGACAAGGAAACTTTATTGTTCACGTATCGACGGAAC
GGGACAACGTATCACAGTTGACGATAGCGAATGTACGGGTGAAAAACCGG
AAGACGTAGAGTTTACGTCAACATGTAACGTTATTGCGTGTCCTGCGTAT
TACGTTTACGGAGAATGGACCCAGACAGGTATTCAAACACGGCTCTTACA
ATGTATTCGTGAAGACGATCAAAGTGTGGTCAGTTCCTCATCATGCGAAG
GTTTAGAGGGACCTGTAACGCAACAATCATGTAATGCTAATGTTTGCCCC
GCATTGGACAAGAAAAACTTTGATGATCTGGTTACTAAATGTGCTCAATC
AGTGAGCCGACGAAAATGGAATGTTTTTGGTATTCAATATTACGGTGAAT
GTTGGAGCGGTGAAAATGCTGTCAATACGTACGCGCATACGGGCAAAGCA
GATCGCTGCTCGAACGGAATCGGAGAAGTCAACGCAAACGCTGTTTACGT
TTTTGTTGAATAACATATCCACCAGTACCAGCTCTGGTCAACCTTGGATG
TTACAATGATGACCCAGAAGATCGATCATTCCAAACACATCTTGATAACT
TCCGACCAATCCTCGACTGAGCTAACCCACTTCCAATGATTCAGAAATGT
GCTGAGAAGGCTCACTCCATGGGTTATGTATATTTCGCAACACAATACTT
CGGAGAATGTTGGGCTGGTGACTTGAATACTGCAGAACAATATTATTTGA
ATGGATACACTGATAGATGTGAAAATGGTATTGGTAAAGTTGCTGCTAAT
TTTGTATACAAGATTGGAACGCCAGAATTATTTGAGACGGACAAGATGCC
ACCAACGTATGCAGTGGGTTGCTATGGTGACCAACCAACACCAAGACGTG
TACCAATTTATTTGGAAAACATGAAAGATATCTACGATCCGTCACGTGAC
AGAAAACGAAAAATGTAAAGATGCAGCAATTCCCGATGACGAGCAATGTA
CAATGGAGCCATGTAAACCAGGGCACAAATTGAAAGTCTTGTCATGCGTA
GAAAGAGCAACAGGAATCATTACTCAATCTGGTCATTGCCACCGAGACGA
AGATGGCGAGAGAATGGAAGAATCCTTCTGTAATGTTTCACAAAAACCAA
CAACACAGACTTTCTCATGTCATAAAGAAGCATGTAAAGCACCGTTCTAT
TGGAAAGGCAACTTTGGGCGTTGTATGGCTACTTGTGGAAGCGGTGTGAA
AACGGCGTCGTACAAATGCGTCCGCAGTACAGATAACGCTCAAGTGGATG
ACAGTAAATGCGAAGGAATCGCAAAACCAAATATTGCTAATGAGAAATGT
GTTGAAGCTGCCTGTCCACCTACTTACTCTTGGAGAAAACATAATTCGTC
CTGCAGCGTCTCTTGTGGATCAGGTACCAAAACTCTAGAACCTTATTGCG
TCAAAGATTCCGATCAAAGTACATCGAACGAGGTGTTGTGCGATCCAGCA
AAGAAACCTGGCACTAGTACCGAACAATGTGCGCTTGGTGATTGTCCAAT
CAAATATTCTTGGAACACGGAGATGAGTGAATGCAGTGTAACGTGTGGTG
AAGGTCTTTTGCCAATTACACAAGTCTGTTTCGGACGTGTTGAAAAGAAA
AATGTCGAAGAATCAAAATGTCCGTCGCCTAAACCTAAAGATCCGACACC
GAAAGAATGTGATGCAGGCGCATGTCCAGAAACATATTCATGGAAAACCA
AATTCAGTGAATGTAGTGTTACTTGTGGCACAGGTATTCAAACAGCATCT
GTTGTTTGTACTGACCCCGATTCAGGAACTCAAGTGGATGCTTCAACGTG
TGATGCTTCGAAAAAACCTACGGTAACCGATGCGGATAGTAAAGCTTGCA
ACGAAGAATTATGTGATCCTTATGTCTGGAGAGAACAAGATGGTGTTTGT
AGCGTGACCTGCGGAAAAGTGTTCTGCTTCATGCAACGGTGGAAAACGCA
GTCGATCATCGATCTGTAAACATATCAGTGAAGTTGGAAAACTTGTTACA
ATCAATGTACAAGCTTGTCTATATCTTGGTGATCCTTTGGTCTCTGAAAC
ATGTAATGCTGATATTCCATGTCCTGAATGGAAGATTGTATACTCCGAAT
GCTCCAAAACTTGCGATGGAGATGGTACGTCACCGAATGGACCAAATGTT
CGAAACTTTGTGGAAGTGGTACAAAGACAAGGAAACTTTATTGTTCACGT
ATCGACGGAACGGGACAACGTATCACAGTTGACGATAGCGAATGTACGGG
TGAAAAACCGGAAGACGTAGAGTTTACGTCAACATGTAACGTTATTGCGT
GTCCTGCGTATTACGTTTACGGAGAATGGACCCAGACAGGTATTCAAACA
CGGCTCTTACAATGTATTCGTGAAGACGATCAAAGTGTGGTCAGTTCCTC
ATCATGCGAAGGTTTAGAGGGACCTGTAACGCAACAATCATGTAATGCTA
ATGTTTGCCCCGCATTGGACAAGAAAAACTTTGATGATCTGGTTACTAAA
TGTGCTCAATCAGTGAGCCGACGAAAATGGAATGTTTTTGGTATTCAATA
TTACGGTGAATGTTGGAGCGGTGAAAATGCTGTCAATACGTACGCGCATA
CGGGCAAAGCAGATCGCTGCTCGAACGGAATCGGAGAAGTCAACGCAAAC
GCTGTTTACGTTTTTGTTGAATAACATATCCACCAGTACCAGCTCTGGTC
AACCTTGGATGTTACAATGATGACCCAGAAGATCGATCATTCCAAACACA
TCTTGATAACTTCCGACCAATCCTCGACTGAGCTAACCCACTTCCAATGA
TTCAGAAATGTGCTGAGAAGGCTCACTCCATGGGTTATGTATATTTCGCA
ACACAATACTTCGGAGAATGTTGGGCTGGTGACTTGAATACTGCAGAACA
ATATTATTTGAATGGATACACTGATAGATGTGAAAATGGTATTGGTAAAG
TTGCTGCTAATTTTGTATACAAGATTGGAACGCCAGAATTATTTGAGACG
GACAAGATGCCACCAACGTATGCAGTGGGTTGCTATGGTGACCAACCAAC
ACCAAGACGTGTACCAATTTATTTGGAAAACATGAAAGATATCTACGATC
CGTCACGTGACAGAAAACGAAAAATGTAAAGATGCAGCAATTCCCGATGA
CGAGCAATGTACAATGGAGCCATGTAAACCAGGGCACAAATTGAAAGTCT
TGTCATGCGTAGAAAGAGCAACAGGAATCATTACTCAATCTGGTCATTGC
CACCGAGACGAAGATGGCGAGAGAATGGAAGAATCCTTCTGTAATGTTTC
ACAAAAACCAACAACACAGACTTTCTCATGTCATAAAGAAGCATGTAAAG
CACCGTTCTATTGGAAAGGCAACTTTGGGCGTTGTATGGCTACTTGTGGA
AGCGGTGTGAAAACGGCGTCGTACAAATGCGTCCGCAGTACAGATAACGC
TCAAGTGGATGACAGTAAATGCGAAGGAATCGCAAAACCAAATATTGCTA
ATGAGAAATGTGTTGAAGCTGCCTGTCCACCTACTTACTCTTGGAGAAAA
CATAATTCGTCCTGCAGCGTCTCTTGTGGATCAGGTACCAAAACTCTAGA
ACCTTATTGCGTCAAAGATTCCGATCAAAGTACATCGAACGAGGTGTTGT
GCGATCCAGCAAAGAAACCTGGCACTAGTACCGAACAATGTGCGCTTGGT
GATTGTCCAATCAAATATTCTTGGAACACGGAGATGAGTGAATGCAGTGT
AACGTGTGGTGAAGGTCTTTTGCCAATTACACAAGTCTGTTTCGGACGTG
TTGAAAAGAAAAATGTCGAAGAATCAAAATGTCCGTCGCCTAAACCTAAA
GATCCGACACCGAAAGAATGTGATGCAGGCGCATGTCCAGAAACATATTC
ATGGAAAACCAAATTCAGTGAATGTAGTGTTACTTGTGGCACAGGTATTC
AAACAGCATCTGTTGTTTGTACTGACCCCGATTCAGGAACTCAAGTGGAT
GCTTCAACGTGTGATGCTTCGAAAAAACCTACGGTAACCGATGCGGATAG
TAAAGCTTGCAACGAAGAATTATGTGATCCTTATGTCTGGAGAGAACAAG
ATGGTGTTTGTAGCGTGACCTGCGGAAAAGTGTTCTGCTTCATGCAACGG
TGGAAAACGCAGTCGATCATCGATCTGTAAACATATCAGTGAAGTTGGAA
AACTTGTTACAATCAATGTACAAGCTTGTCTATATCTTGGTGATCCTTTG
GTCTCTGAAACATGTAATGCTGATATTCCATGTCCTGAATGGAAGATTGT
ATACTCCGAATGCTCCAAAACTTGCGATGGAGATGGTACGTCACCGAATG
GACCAAATGTTCGAAACTTTGTGGAAGTGGTACAAAGACAAGGAAACTTT
ATTGTTCACGTATCGACGGAACGGGACAACGTATCACAGTTGACGATAGC
GAATGTACGGGTGAAAAACCGGAAGACGTAGAGTTTACGTCAACATGTAA
CGTTATTGCGTGTCCTGCGTATTACGTTTACGGAGAATGGACCCAGACAG
GTATTCAAACACGGCTCTTACAATGTATTCGTGAAGACGATCAAAGTGTG
GTCAGTTCCTCATCATGCGAAGGTTTAGAGGGACCTGTAACGCAACAATC
ATGTAATGCTAATGTTTGCCCCGCATTGGACAAGAAAAACTTTGATGATC
TGGTTACTAAATGTGCTCAATCAGTGAGCCGACGAAAATGGAATGTTTTT
GGTATTCAATATTACGGTGAATGTTGGAGCGGTGAAAATGCTGTCAATAC
GTACGCGCATACGGGCAAAGCAGATCGCTGCTCGAACGGAATCGGAGAAG
TCAACGCAAACGCTGTTTACGTTTTTGTTGAATAACATATCCACCAGTAC
CAGCTCTGGTCAACCTTGGATGTTACAATGATGACCCAGAAGATCGATCA
TTCCAAACACATCTTGATAACTTCCGACCAATCCTCGACTGAGCTAACCC
ACTTCCAATGATTCAGAAATGTGCTGAGAAGGCTCACTCCATGGGTTATG
TATATTTCGCAACACAATACTTCGGAGAATGTTGGGCTGGTGACTTGAAT
ACTGCAGAACAATATTATTTGAATGGATACACTGATAGATGTGAAAATGG
TATTGGTAAAGTTGCTGCTAATTTTGTATACAAGATTGGAACGCCAGAAT
TATTTGAGACGGACAAGATGCCACCAACGTATGCAGTGGGTTGCTATGGT
GACCAACCAACACCAAGACGTGTACCAATTTATTTGGAAAACATGAAAGA
TATCTACGATCCGTCACGTGACAGAAAACGAAAAATGTAAAGATGCAGCA
ATTCCCGATGACGAGCAATGTACAATGGAGCCATGTAAACCAGGGCACAA
ATTGAAAGTCTTGTCATGCGTAGAAAGAGCAACAGGAATCATTACTCAAT
CTGGTCATTGCCACCGAGACGAAGATGGCGAGAGAATGGAAGAATCCTTC
TGTAATGTTTCACAAAAACCAACAACACAGACTTTCTCATGTCATAAAGA
AGCATGTAAAGCACCGTTCTATTGGAAAGGCAACTTTGGGCGTTGTATGG
CTACTTGTGGAAGCGGTGTGAAAACGGCGTCGTACAAATGCGTCCGCAGT
ACAGATAACGCTCAAGTGGATGACAGTAAATGCGAAGGAATCGCAAAACC
AAATATTGCTAATGAGAAATGTGTTGAAGCTGCCTGTCCACCTACTTACT
CTTGGAGAAAACATAATTCGTCCTGCAGCGTCTCTTGTGGATCAGGTACC
AAAACTCTAGAACCTTATTGCGTCAAAGATTCCGATCAAAGTACATCGAA
CGAGGTGTTGTGCGATCCAGCAAAGAAACCTGGCACTAGTACCGAACAAT
GTGCGCTTGGTGATTGTCCAATCAAATATTCTTGGAACACGGAGATGAGT
GAATGCAGTGTAACGTGTGGTGAAGGTCTTTTGCCAATTACACAAGTCTG
TTTCGGACGTGTTGAAAAGAAAAATGTCGAAGAATCAAAATGTCCGTCGC
CTAAACCTAAAGATCCGACACCGAAAGAATGTGATGCAGGCGCATGTCCA
GAAACATATTCATGGAAAACCAAATTCAGTGAATGTAGTGTTACTTGTGG
CACAGGTATTCAAACAGCATCTGTTGTTTGTACTGACCCCGATTCAGGAA
CTCAAGTGGATGCTTCAACGTGTGATGCTTCGAAAAAACCTACGGTAACC
GATGCGGATAGTAAAGCTTGCAACGAAGAATTATGTGATCCTTATGTCTG
GAGAGAACAAGATGGTGTTTGTAGCGTGACCTGCGGAAAAGTGTTCTGCT
TCATGCAACGGTGGAAAACGCAGTCGATCATCGATCTGTAAACATATCAG
TGAAGTTGGAAAACTTGTTACAATCAATGTACAAGCTTGTCTATATCTTG
GTGATCCTTTGGTCTCTGAAACATGTAATGCTGATATTCCATGTCCTGAA
TGGAAGATTGTATACTCCGAATGCTCCAAAACTTGCGATGGAGATGGTAC
GTCACCGAATGGACCAAATGTTCGAAACTTTGTGGAAGTGGTACAAAGAC
AAGGAAACTTTATTGTTCACGTATCGACGGAACGGGACAACGTATCACAG
TTGACGATAGCGAATGTACGGGTGAAAAACCGGAAGACGTAGAGTTTACG
TCAACATGTAACGTTATTGCGTGTCCTGCGTATTACGTTTACGGAGAATG
GACCCAGACAGGTATTCAAACACGGCTCTTACAATGTATTCGTGAAGACG
ATCAAAGTGTGGTCAGTTCCTCATCATGCGAAGGTTTAGAGGGACCTGTA
ACGCAACAATCATGTAATGCTAATGTTTGCCCCGCATTGGACAAGAAAAA
CTTTGATGATCTGGTTACTAAATGTGCTCAATCAGTGAGCCGACGAAAAT
GGAATGTTTTTGGTATTCAATATTACGGTGAATGTTGGAGCGGTGAAAAT
GCTGTCAATACGTACGCGCATACGGGCAAAGCAGATCGCTGCTCGAACGG
AATCGGAGAAGTCAACGCAAACGCTGTTTACGTTTTTGTTGAATAACATA
TCCACCAGTACCAGCTCTGGTCAACCTTGGATGTTACAATGATGACCCAG
AAGATCGATCATTCCAAACACATCTTGATAACTTCCGACCAATCCTCGAC
TGAGCTAACCCACTTCCAATGATTCAGAAATGTGCTGAGAAGGCTCACTC
CATGGGTTATGTATATTTCGCAACACAATACTTCGGAGAATGTTGGGCTG
GTGACTTGAATACTGCAGAACAATATTATTTGAATGGATACACTGATAGA
TGTGAAAATGGTATTGGTAAAGTTGCTGCTAATTTTGTATACAAGATTGG
AACGCCAGAATTATTTGAGACGGACAAGATGCCACCAACGTATGCAGTGG
GTTGCTATGGTGACCAACCAACACCAAGACGTGTACCAATTTATTTGGAA
AACATGAAAGATATCTACGATCCGTCACGTGACAGAAAACGAAAAATGTA
AAGATGCAGCAATTCCCGATGACGAGCAATGTACAATGGAGCCATGTAAA
CCAGGGCACAAATTGAAAGTCTTGTCATGCGTAGAAAGAGCAACAGGAAT
CATTACTCAATCTGGTCATTGCCACCGAGACGAAGATGGCGAGAGAATGG
AAGAATCCTTCTGTAATGTTTCACAAAAACCAACAACACAGACTTTCTCA
TGTCATAAAGAAGCATGTAAAGCACCGTTCTATTGGAAAGGCAACTTTGG
GCGTTGTATGGCTACTTGTGGAAGCGGTGTGAAAACGGCGTCGTACAAAT
GCGTCCGCAGTACAGATAACGCTCAAGTGGATGACAGTAAATGCGAAGGA
ATCGCAAAACCAAATATTGCTAATGAGAAATGTGTTGAAGCTGCCTGTCC
ACCTACTTACTCTTGGAGAAAACATAATTCGTCCTGCAGCGTCTCTTGTG
GATCAGGTACCAAAACTCTAGAACCTTATTGCGTCAAAGATTCCGATCAA
AGTACATCGAACGAGGTGTTGTGCGATCCAGCAAAGAAACCTGGCACTAG
TACCGAACAATGTGCGCTTGGTGATTGTCCAATCAAATATTCTTGGAACA
CGGAGATGAGTGAATGCAGTGTAACGTGTGGTGAAGGTCTTTTGCCAATT
ACACAAGTCTGTTTCGGACGTGTTGAAAAGAAAAATGTCGAAGAATCAAA
ATGTCCGTCGCCTAAACCTAAAGATCCGACACCGAAAGAATGTGATGCAG
GCGCATGTCCAGAAACATATTCATGGAAAACCAAATTCAGTGAATGTAGT
GTTACTTGTGGCACAGGTATTCAAACAGCATCTGTTGTTTGTACTGACCC
CGATTCAGGAACTCAAGTGGATGCTTCAACGTGTGATGCTTCGAAAAAAC
CTACGGTAACCGATGCGGATAGTAAAGCTTGCAACGAAGAATTATGTGAT
CCTTATGTCTGGAGAGAACAAGATGGTGTTTGTAGCGTGACCTGCGGAAA
AGTGTTCTGCTTCATGCAACGGTGGAAAACGCAGTCGATCATCGATCTGT
AAACATATCAGTGAAGTTGGAAAACTTGTTACAATCAATGTACAAGCTTG
TCTATATCTTGGTGATCCTTTGGTCTCTGAAACATGTAATGCTGATATTC
CATGTCCTGAATGGAAGATTGTATACTCCGAATGCTCCAAAACTTGCGAT
GGAGATGGTACGTCACCGAATGGACCAAATGTTCGAAACTTTGTGGAAGT
GGTACAAAGACAAGGAAACTTTATTGTTCACGTATCGACGGAACGGGACA
ACGTATCACAGTTGACGATAGCGAATGTACGGGTGAAAAACCGGAAGACG
TAGAGTTTACGTCAACATGTAACGTTATTGCGTGTCCTGCGTATTACGTT
TACGGAGAATGGACCCAGACAGGTATTCAAACACGGCTCTTACAATGTAT
TCGTGAAGACGATCAAAGTGTGGTCAGTTCCTCATCATGCGAAGGTTTAG
AGGGACCTGTAACGCAACAATCATGTAATGCTAATGTTTGCCCCGCATTG
GACAAGAAAAACTTTGATGATCTGGTTACTAAATGTGCTCAATCAGTGAG
CCGACGAAAATGGAATGTTTTTGGTATTCAATATTACGGTGAATGTTGGA
GCGGTGAAAATGCTGTCAATACGTACGCGCATACGGGCAAAGCAGATCGC
TGCTCGAACGGAATCGGAGAAGTCAACGCAAACGCTGTTTACGTTTTTGT
TGAATAACATATCCACCAGTACCAGCTCTGGTCAACCTTGGATGTTACAA
TGATGACCCAGAAGATCGATCATTCCAAACACATCTTGATAACTTCCGAC
CAATCCTCGACTGAGCTAACCCACTTCCAATGATTCAGAAATGTGCTGAG
AAGGCTCACTCCATGGGTTATGTATATTTCGCAACACAATACTTCGGAGA
ATGTTGGGCTGGTGACTTGAATACTGCAGAACAATATTATTTGAATGGAT
ACACTGATAGATGTGAAAATGGTATTGGTAAAGTTGCTGCTAATTTTGTA
TACAAGATTGGAACGCCAGAATTATTTGAGACGGACAAGATGCCACCAAC
GTATGCAGTGGGTTGCTATGGTGACCAACCAACACCAAGACGTGTACCAA
TTTATTTGGAAAACATGAAAGATATCTACGATCCGTCACGTGACAGAAAA
CGAAAAATGTAAAGATGCAGCAATTCCCGATGACGAGCAATGTACAATGG
AGCCATGTAAACCAGGGCACAAATTGAAAGTCTTGTCATGCGTAGAAAGA
GCAACAGGAATCATTACTCAATCTGGTCATTGCCACCGAGACGAAGATGG
CGAGAGAATGGAAGAATCCTTCTGTAATGTTTCACAAAAACCAACAACAC
AGACTTTCTCATGTCATAAAGAAGCATGTAAAGCACCGTTCTATTGGAAA
GGCAACTTTGGGCGTTGTATGGCTACTTGTGGAAGCGGTGTGAAAACGGC
GTCGTACAAATGCGTCCGCAGTACAGATAACGCTCAAGTGGATGACAGTA
AATGCGAAGGAATCGCAAAACCAAATATTGCTAATGAGAAATGTGTTGAA
GCTGCCTGTCCACCTACTTACTCTTGGAGAAAACATAATTCGTCCTGCAG
CGTCTCTTGTGGATCAGGTACCAAAACTCTAGAACCTTATTGCGTCAAAG
ATTCCGATCAAAGTACATCGAACGAGGTGTTGTGCGATCCAGCAAAGAAA
CCTGGCACTAGTACCGAACAATGTGCGCTTGGTGATTGTCCAATCAAATA
TTCTTGGAACACGGAGATGAGTGAATGCAGTGTAACGTGTGGTGAAGGTC
TTTTGCCAATTACACAAGTCTGTTTCGGACGTGTTGAAAAGAAAAATGTC
GAAGAATCAAAATGTCCGTCGCCTAAACCTAAAGATCCGACACCGAAAGA
ATGTGATGCAGGCGCATGTCCAGAAACATATTCATGGAAAACCAAATTCA
GTGAATGTAGTGTTACTTGTGGCACAGGTATTCAAACAGCATCTGTTGTT
TGTACTGACCCCGATTCAGGAACTCAAGTGGATGCTTCAACGTGTGATGC
TTCGAAAAAACCTACGGTAACCGATGCGGATAGTAAAGCTTGCAACGAAG
AATTATGTGATCCTTATGTCTGGAGAGAACAAGATGGTGTTTGTAGCGTG
ACCTGCGGAAAAGTGTTCTGCTTCATGCAACGGTGGAAAACGCAGTCGAT
CATCGATCTGTAAACATATCAGTGAAGTTGGAAAACTTGTTACAATCAAT
GTACAAGCTTGTCTATATCTTGGTGATCCTTTGGTCTCTGAAACATGTAA
TGCTGATATTCCATGTCCTGAATGGAAGATTGTATACTCCGAATGCTCCA
AAACTTGCGATGGAGATGGTACGTCACCGAATGGACCAAATGTTCGAAAC
TTTGTGGAAGTGGTACAAAGACAAGGAAACTTTATTGTTCACGTATCGAC
GGAACGGGACAACGTATCACAGTTGACGATAGCGAATGTACGGGTGAAAA
ACCGGAAGACGTAGAGTTTACGTCAACATGTAACGTTATTGCGTGTCCTG
CGTATTACGTTTACGGAGAATGGACCCAGACAGGTATTCAAACACGGCTC
TTACAATGTATTCGTGAAGACGATCAAAGTGTGGTCAGTTCCTCATCATG
CGAAGGTTTAGAGGGACCTGTAACGCAACAATCATGTAATGCTAATGTTT
GCCCCGCATTGGACAAGAAAAACTTTGATGATCTGGTTACTAAATGTGCT
CAATCAGTGAGCCGACGAAAATGGAATGTTTTTGGTATTCAATATTACGG
TGAATGTTGGAGCGGTGAAAATGCTGTCAATACGTACGCGCATACGGGCA
AAGCAGATCGCTGCTCGAACGGAATCGGAGAAGTCAACGCAAACGCTGTT
TACGTTTTTGTTGAATAACATATCCACCAGTACCAGCTCTGGTCAACCTT
GGATGTTACAATGATGACCCAGAAGATCGATCATTCCAAACACATCTTGA
TAACTTCCGACCAATCCTCGACTGAGCTAACCCACTTCCAATGATTCAGA
AATGTGCTGAGAAGGCTCACTCCATGGGTTATGTATATTTCGCAACACAA
TACTTCGGAGAATGTTGGGCTGGTGACTTGAATACTGCAGAACAATATTA
TTTGAATGGATACACTGATAGATGTGAAAATGGTATTGGTAAAGTTGCTG
CTAATTTTGTATACAAGATTGGAACGCCAGAATTATTTGAGACGGACAAG
ATGCCACCAACGTATGCAGTGGGTTGCTATGGTGACCAACCAACACCAAG
ACGTGTACCAATTTATTTGGAAAACATGAAAGATATCTACGATCCGTCAC
GTGACAGAAAACGAAAAATGTAAAGATGCAGCAATTCCCGATGACGAGCA
ATGTACAATGGAGCCATGTAAACCAGGGCACAAATTGAAAGTCTTGTCAT
GCGTAGAAAGAGCAACAGGAATCATTACTCAATCTGGTCATTGCCACCGA
GACGAAGATGGCGAGAGAATGGAAGAATCCTTCTGTAATGTTTCACAAAA
ACCAACAACACAGACTTTCTCATGTCATAAAGAAGCATGTAAAGCACCGT
TCTATTGGAAAGGCAACTTTGGGCGTTGTATGGCTACTTGTGGAAGCGGT
GTGAAAACGGCGTCGTACAAATGCGTCCGCAGTACAGATAACGCTCAAGT
GGATGACAGTAAATGCGAAGGAATCGCAAAACCAAATATTGCTAATGAGA
AATGTGTTGAAGCTGCCTGTCCACCTACTTACTCTTGGAGAAAACATAAT
TCGTCCTGCAGCGTCTCTTGTGGATCAGGTACCAAAACTCTAGAACCTTA
TTGCGTCAAAGATTCCGATCAAAGTACATCGAACGAGGTGTTGTGCGATC
CAGCAAAGAAACCTGGCACTAGTACCGAACAATGTGCGCTTGGTGATTGT
CCAATCAAATATTCTTGGAACACGGAGATGAGTGAATGCAGTGTAACGTG
TGGTGAAGGTCTTTTGCCAATTACACAAGTCTGTTTCGGACGTGTTGAAA
AGAAAAATGTCGAAGAATCAAAATGTCCGTCGCCTAAACCTAAAGATCCG
ACACCGAAAGAATGTGATGCAGGCGCATGTCCAGAAACATATTCATGGAA
AACCAAATTCAGTGAATGTAGTGTTACTTGTGGCACAGGTATTCAAACAG
CATCTGTTGTTTGTACTGACCCCGATTCAGGAACTCAAGTGGATGCTTCA
ACGTGTGATGCTTCGAAAAAACCTACGGTAACCGATGCGGATAGTAAAGC
TTGCAACGAAGAATTATGTGATCCTTATGTCTGGAGAGAACAAGATGGTG
TTTGTAGCGTGACCTGCGGAAAAGTGTTCTGCTTCATGCAACGGTGGAAA
ACGCAGTCGATCATCGATCTGTAAACATATCAGTGAAGTTGGAAAACTTG
TTACAATCAATGTACAAGCTTGTCTATATCTTGGTGATCCTTTGGTCTCT
GAAACATGTAATGCTGATATTCCATGTCCTGAATGGAAGATTGTATACTC
CGAATGCTCCAAAACTTGCGATGGAGATGGTACGTCACCGAATGGACCAA
ATGTTCGAAACTTTGTGGAAGTGGTACAAAGACAAGGAAACTTTATTGTT
CACGTATCGACGGAACGGGACAACGTATCACAGTTGACGATAGCGAATGT
ACGGGTGAAAAACCGGAAGACGTAGAGTTTACGTCAACATGTAACGTTAT
TGCGTGTCCTGCGTATTACGTTTACGGAGAATGGACCCAGACAGGTATTC
AAACACGGCTCTTACAATGTATTCGTGAAGACGATCAAAGTGTGGTCAGT
TCCTCATCATGCGAAGGTTTAGAGGGACCTGTAACGCAACAATCATGTAA
TGCTAATGTTTGCCCCGCATTGGACAAGAAAAACTTTGATGATCTGGTTA
CTAAATGTGCTCAATCAGTGAGCCGACGAAAATGGAATGTTTTTGGTATT
CAATATTACGGTGAATGTTGGAGCGGTGAAAATGCTGTCAATACGTACGC
GCATACGGGCAAAGCAGATCGCTGCTCGAACGGAATCGGAGAAGTCAACG
CAAACGCTGTTTACGTTTTTGTTGAATAACATATCCACCAGTACCAGCTC
TGGTCAACCTTGGATGTTACAATGATGACCCAGAAGATCGATCATTCCAA
ACACATCTTGATAACTTCCGACCAATCCTCGACTGAGCTAACCCACTTCC
AATGATTCAGAAATGTGCTGAGAAGGCTCACTCCATGGGTTATGTATATT
TCGCAACACAATACTTCGGAGAATGTTGGGCTGGTGACTTGAATACTGCA
GAACAATATTATTTGAATGGATACACTGATAGATGTGAAAATGGTATTGG
TAAAGTTGCTGCTAATTTTGTATACAAGATTGGAACGCCAGAATTATTTG
AGACGGACAAGATGCCACCAACGTATGCAGTGGGTTGCTATGGTGACCAA
CCAACACCAAGACGTGTACCAATTTATTTGGAAAACATGAAAGATATCTA
CGATCCGTCACGTGACAGAAAACGAAAAATGTAAAGATGCAGCAATTCCC
GATGACGAGCAATGTACAATGGAGCCATGTAAACCAGGGCACAAATTGAA
AGTCTTGTCATGCGTAGAAAGAGCAACAGGAATCATTACTCAATCTGGTC
ATTGCCACCGAGACGAAGATGGCGAGAGAATGGAAGAATCCTTCTGTAAT
GTTTCACAAAAACCAACAACACAGACTTTCTCATGTCATAAAGAAGCATG
TAAAGCACCGTTCTATTGGAAAGGCAACTTTGGGCGTTGTATGGCTACTT
GTGGAAGCGGTGTGAAAACGGCGTCGTACAAATGCGTCCGCAGTACAGAT
AACGCTCAAGTGGATGACAGTAAATGCGAAGGAATCGCAAAACCAAATAT
TGCTAATGAGAAATGTGTTGAAGCTGCCTGTCCACCTACTTACTCTTGGA
GAAAACATAATTCGTCCTGCAGCGTCTCTTGTGGATCAGGTACCAAAACT
CTAGAACCTTATTGCGTCAAAGATTCCGATCAAAGTACATCGAACGAGGT
GTTGTGCGATCCAGCAAAGAAACCTGGCACTAGTACCGAACAATGTGCGC
TTGGTGATTGTCCAATCAAATATTCTTGGAACACGGAGATGAGTGAATGC
AGTGTAACGTGTGGTGAAGGTCTTTTGCCAATTACACAAGTCTGTTTCGG
ACGTGTTGAAAAGAAAAATGTCGAAGAATCAAAATGTCCGTCGCCTAAAC
CTAAAGATCCGACACCGAAAGAATGTGATGCAGGCGCATGTCCAGAAACA
TATTCATGGAAAACCAAATTCAGTGAATGTAGTGTTACTTGTGGCACAGG
TATTCAAACAGCATCTGTTGTTTGTACTGACCCCGATTCAGGAACTCAAG
TGGATGCTTCAACGTGTGATGCTTCGAAAAAACCTACGGTAACCGATGCG
GATAGTAAAGCTTGCAACGAAGAATTATGTGATCCTTATGTCTGGAGAGA
ACAAGATGGTGTTTGTAGCGTGACCTGCGGAAAAGTGTTCTGCTTCATGC
AACGGTGGAAAACGCAGTCGATCATCGATCTGTAAACATATCAGTGAAGT
TGGAAAACTTGTTACAATCAATGTACAAGCTTGTCTATATCTTGGTGATC
CTTTGGTCTCTGAAACATGTAATGCTGATATTCCATGTCCTGAATGGAAG
ATTGTATACTCCGAATGCTCCAAAACTTGCGATGGAGATGGTACGTCACC
GAATGGACCAAATGTTCGAAACTTTGTGGAAGTGGTACAAAGACAAGGAA
ACTTTATTGTTCACGTATCGACGGAACGGGACAACGTATCACAGTTGACG
ATAGCGAATGTACGGGTGAAAAACCGGAAGACGTAGAGTTTACGTCAACA
TGTAACGTTATTGCGTGTCCTGCGTATTACGTTTACGGAGAATGGACCCA
GACAGGTATTCAAACACGGCTCTTACAATGTATTCGTGAAGACGATCAAA
GTGTGGTCAGTTCCTCATCATGCGAAGGTTTAGAGGGACCTGTAACGCAA
CAATCATGTAATGCTAATGTTTGCCCCGCATTGGACAAGAAAAACTTTGA
TGATCTGGTTACTAAATGTGCTCAATCAGTGAGCCGACGAAAATGGAATG
TTTTTGGTATTCAATATTACGGTGAATGTTGGAGCGGTGAAAATGCTGTC
AATACGTACGCGCATACGGGCAAAGCAGATCGCTGCTCGAACGGAATCGG
AGAAGTCAACGCAAACGCTGTTTACGTTTTTGTTGAATAACATATCCACC
AGTACCAGCTCTGGTCAACCTTGGATGTTACAATGATGACCCAGAAGATC
GATCATTCCAAACACATCTTGATAACTTCCGACCAATCCTCGACTGAGCT
AACCCACTTCCAATGATTCAGAAATGTGCTGAGAAGGCTCACTCCATGGG
TTATGTATATTTCGCAACACAATACTTCGGAGAATGTTGGGCTGGTGACT
TGAATACTGCAGAACAATATTATTTGAATGGATACACTGATAGATGTGAA
AATGGTATTGGTAAAGTTGCTGCTAATTTTGTATACAAGATTGGAACGCC
AGAATTATTTGAGACGGACAAGATGCCACCAACGTATGCAGTGGGTTGCT
ATGGTGACCAACCAACACCAAGACGTGTACCAATTTATTTGGAAAACATG
AAAGATATCTACGATCCGTCACGTGACAGAAAACGAAAAATGTAAAGATG
CAGCAATTCCCGATGACGAGCAATGTACAATGGAGCCATGTAAACCAGGG
CACAAATTGAAAGTCTTGTCATGCGTAGAAAGAGCAACAGGAATCATTAC
TCAATCTGGTCATTGCCACCGAGACGAAGATGGCGAGAGAATGGAAGAAT
CCTTCTGTAATGTTTCACAAAAACCAACAACACAGACTTTCTCATGTCAT
AAAGAAGCATGTAAAGCACCGTTCTATTGGAAAGGCAACTTTGGGCGTTG
TATGGCTACTTGTGGAAGCGGTGTGAAAACGGCGTCGTACAAATGCGTCC
GCAGTACAGATAACGCTCAAGTGGATGACAGTAAATGCGAAGGAATCGCA
AAACCAAATATTGCTAATGAGAAATGTGTTGAAGCTGCCTGTCCACCTAC
TTACTCTTGGAGAAAACATAATTCGTCCTGCAGCGTCTCTTGTGGATCAG
GTACCAAAACTCTAGAACCTTATTGCGTCAAAGATTCCGATCAAAGTACA
TCGAACGAGGTGTTGTGCGATCCAGCAAAGAAACCTGGCACTAGTACCGA
ACAATGTGCGCTTGGTGATTGTCCAATCAAATATTCTTGGAACACGGAGA
TGAGTGAATGCAGTGTAACGTGTGGTGAAGGTCTTTTGCCAATTACACAA
GTCTGTTTCGGACGTGTTGAAAAGAAAAATGTCGAAGAATCAAAATGTCC
GTCGCCTAAACCTAAAGATCCGACACCGAAAGAATGTGATGCAGGCGCAT
GTCCAGAAACATATTCATGGAAAACCAAATTCAGTGAATGTAGTGTTACT
TGTGGCACAGGTATTCAAACAGCATCTGTTGTTTGTACTGACCCCGATTC
AGGAACTCAAGTGGATGCTTCAACGTGTGATGCTTCGAAAAAACCTACGG
TAACCGATGCGGATAGTAAAGCTTGCAACGAAGAATTATGTGATCCTTAT
GTCTGGAGAGAACAAGATGGTGTTTGTAGCGTGACCTGCGGAAAAGTGTT
CTGCTTCATGCAACGGTGGAAAACGCAGTCGATCATCGATCTGTAAACAT
ATCAGTGAAGTTGGAAAACTTGTTACAATCAATGTACAAGCTTGTCTATA
TCTTGGTGATCCTTTGGTCTCTGAAACATGTAATGCTGATATTCCATGTC
CTGAATGGAAGATTGTATACTCCGAATGCTCCAAAACTTGCGATGGAGAT
GGTACGTCACCGAATGGACCAAATGTTCGAAACTTTGTGGAAGTGGTACA
AAGACAAGGAAACTTTATTGTTCACGTATCGACGGAACGGGACAACGTAT
CACAGTTGACGATAGCGAATGTACGGGTGAAAAACCGGAAGACGTAGAGT
TTACGTCAACATGTAACGTTATTGCGTGTCCTGCGTATTACGTTTACGGA
GAATGGACCCAGACAGGTATTCAAACACGGCTCTTACAATGTATTCGTGA
AGACGATCAAAGTGTGGTCAGTTCCTCATCATGCGAAGGTTTAGAGGGAC
CTGTAACGCAACAATCATGTAATGCTAATGTTTGCCCCGCATTGGACAAG
AAAAACTTTGATGATCTGGTTACTAAATGTGCTCAATCAGTGAGCCGACG
AAAATGGAATGTTTTTGGTATTCAATATTACGGTGAATGTTGGAGCGGTG
AAAATGCTGTCAATACGTACGCGCATACGGGCAAAGCAGATCGCTGCTCG
AACGGAATCGGAGAAGTCAACGCAAACGCTGTTTACGTTTTTGTTGAATA
ACATATCCACCAGTACCAGCTCTGGTCAACCTTGGATGTTACAATGATGA
CCCAGAAGATCGATCATTCCAAACACATCTTGATAACTTCCGACCAATCC
TCGACTGAGCTAACCCACTTCCAATGATTCAGAAATGTGCTGAGAAGGCT
CACTCCATGGGTTATGTATATTTCGCAACACAATACTTCGGAGAATGTTG
GGCTGGTGACTTGAATACTGCAGAACAATATTATTTGAATGGATACACTG
ATAGATGTGAAAATGGTATTGGTAAAGTTGCTGCTAATTTTGTATACAAG
ATTGGAACGCCAGAATTATTTGAGACGGACAAGATGCCACCAACGTATGC
AGTGGGTTGCTATGGTGACCAACCAACACCAAGACGTGTACCAATTTATT
TGGAAAACATGAAAGATATCTACGATCCGTCACGTGACAGAAAACGAAAA
ATGTAAAGATGCAGCAATTCCCGATGACGAGCAATGTACAATGGAGCCAT
GTAAACCAGGGCACAAATTGAAAGTCTTGTCATGCGTAGAAAGAGCAACA
GGAATCATTACTCAATCTGGTCATTGCCACCGAGACGAAGATGGCGAGAG
AATGGAAGAATCCTTCTGTAATGTTTCACAAAAACCAACAACACAGACTT
TCTCATGTCATAAAGAAGCATGTAAAGCACCGTTCTATTGGAAAGGCAAC
TTTGGGCGTTGTATGGCTACTTGTGGAAGCGGTGTGAAAACGGCGTCGTA
CAAATGCGTCCGCAGTACAGATAACGCTCAAGTGGATGACAGTAAATGCG
AAGGAATCGCAAAACCAAATATTGCTAATGAGAAATGTGTTGAAGCTGCC
TGTCCACCTACTTACTCTTGGAGAAAACATAATTCGTCCTGCAGCGTCTC
TTGTGGATCAGGTACCAAAACTCTAGAACCTTATTGCGTCAAAGATTCCG
ATCAAAGTACATCGAACGAGGTGTTGTGCGATCCAGCAAAGAAACCTGGC
ACTAGTACCGAACAATGTGCGCTTGGTGATTGTCCAATCAAATATTCTTG
GAACACGGAGATGAGTGAATGCAGTGTAACGTGTGGTGAAGGTCTTTTGC
CAATTACACAAGTCTGTTTCGGACGTGTTGAAAAGAAAAATGTCGAAGAA
TCAAAATGTCCGTCGCCTAAACCTAAAGATCCGACACCGAAAGAATGTGA
TGCAGGCGCATGTCCAGAAACATATTCATGGAAAACCAAATTCAGTGAAT
GTAGTGTTACTTGTGGCACAGGTATTCAAACAGCATCTGTTGTTTGTACT
GACCCCGATTCAGGAACTCAAGTGGATGCTTCAACGTGTGATGCTTCGAA
AAAACCTACGGTAACCGATGCGGATAGTAAAGCTTGCAACGAAGAATTAT
GTGATCCTTATGTCTGGAGAGAACAAGATGGTGTTTGTAGCGTGACCTGC
GGAAAAGTGTTCTGCTTCATGCAACGGTGGAAAACGCAGTCGATCATCGA
TCTGTAAACATATCAGTGAAGTTGGAAAACTTGTTACAATCAATGTACAA
GCTTGTCTATATCTTGGTGATCCTTTGGTCTCTGAAACATGTAATGCTGA
TATTCCATGTCCTGAATGGAAGATTGTATACTCCGAATGCTCCAAAACTT
GCGATGGAGATGGTACGTCACCGAATGGACCAAATGTTCGAAACTTTGTG
GAAGTGGTACAAAGACAAGGAAACTTTATTGTTCACGTATCGACGGAACG
GGACAACGTATCACAGTTGACGATAGCGAATGTACGGGTGAAAAACCGGA
AGACGTAGAGTTTACGTCAACATGTAACGTTATTGCGTGTCCTGCGTATT
ACGTTTACGGAGAATGGACCCAGACAGGTATTCAAACACGGCTCTTACAA
TGTATTCGTGAAGACGATCAAAGTGTGGTCAGTTCCTCATCATGCGAAGG
TTTAGAGGGACCTGTAACGCAACAATCATGTAATGCTAATGTTTGCCCCG
CATT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000129XLOC_000129Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000234-proteinTCONS_00000234-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000234-exon-sc0000001-1575043694:2050510..2050641TCONS_00000234-exon-sc0000001-1575043694:2050510..2050641Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1575043694:2049312..2049525TCONS_00000234-exon-sc0000001-1575043694:2049312..2049525Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1575043694:2048588..2048789TCONS_00000234-exon-sc0000001-1575043694:2048588..2048789Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1575043694:2047363..2047548TCONS_00000234-exon-sc0000001-1575043694:2047363..2047548Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1575043694:2046902..2047081TCONS_00000234-exon-sc0000001-1575043694:2046902..2047081Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1575043694:2046150..2046329TCONS_00000234-exon-sc0000001-1575043694:2046150..2046329Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1575043694:2045115..2045294TCONS_00000234-exon-sc0000001-1575043694:2045115..2045294Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1575043694:2043661..2043840TCONS_00000234-exon-sc0000001-1575043694:2043661..2043840Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1575043694:2043354..2043395TCONS_00000234-exon-sc0000001-1575043694:2043354..2043395Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1575043694:2041336..2041416TCONS_00000234-exon-sc0000001-1575043694:2041336..2041416Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1575043694:2040027..2040138TCONS_00000234-exon-sc0000001-1575043694:2040027..2040138Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1575043694:2038823..2039031TCONS_00000234-exon-sc0000001-1575043694:2038823..2039031Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1575043694:2037832..2037937TCONS_00000234-exon-sc0000001-1575043694:2037832..2037937Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1575043694:2036582..2036934TCONS_00000234-exon-sc0000001-1575043694:2036582..2036934Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2050510..2050641TCONS_00000234-exon-sc0000001-1510915933:2050510..2050641Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2049312..2049525TCONS_00000234-exon-sc0000001-1510915933:2049312..2049525Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2048588..2048789TCONS_00000234-exon-sc0000001-1510915933:2048588..2048789Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2047363..2047548TCONS_00000234-exon-sc0000001-1510915933:2047363..2047548Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2046902..2047081TCONS_00000234-exon-sc0000001-1510915933:2046902..2047081Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2046150..2046329TCONS_00000234-exon-sc0000001-1510915933:2046150..2046329Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2045115..2045294TCONS_00000234-exon-sc0000001-1510915933:2045115..2045294Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2043661..2043840TCONS_00000234-exon-sc0000001-1510915933:2043661..2043840Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2043354..2043395TCONS_00000234-exon-sc0000001-1510915933:2043354..2043395Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2041336..2041416TCONS_00000234-exon-sc0000001-1510915933:2041336..2041416Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2040027..2040138TCONS_00000234-exon-sc0000001-1510915933:2040027..2040138Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2038823..2039031TCONS_00000234-exon-sc0000001-1510915933:2038823..2039031Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2037832..2037937TCONS_00000234-exon-sc0000001-1510915933:2037832..2037937Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1510915933:2036582..2036934TCONS_00000234-exon-sc0000001-1510915933:2036582..2036934Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2050510..2050641TCONS_00000234-exon-sc0000001-1491911889:2050510..2050641Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2049312..2049525TCONS_00000234-exon-sc0000001-1491911889:2049312..2049525Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2048588..2048789TCONS_00000234-exon-sc0000001-1491911889:2048588..2048789Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2047363..2047548TCONS_00000234-exon-sc0000001-1491911889:2047363..2047548Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2046902..2047081TCONS_00000234-exon-sc0000001-1491911889:2046902..2047081Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2046150..2046329TCONS_00000234-exon-sc0000001-1491911889:2046150..2046329Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2045115..2045294TCONS_00000234-exon-sc0000001-1491911889:2045115..2045294Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2043661..2043840TCONS_00000234-exon-sc0000001-1491911889:2043661..2043840Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2043354..2043395TCONS_00000234-exon-sc0000001-1491911889:2043354..2043395Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2041336..2041416TCONS_00000234-exon-sc0000001-1491911889:2041336..2041416Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2040027..2040138TCONS_00000234-exon-sc0000001-1491911889:2040027..2040138Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2038823..2039031TCONS_00000234-exon-sc0000001-1491911889:2038823..2039031Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2037832..2037937TCONS_00000234-exon-sc0000001-1491911889:2037832..2037937Clytia hemisphaericaexon
TCONS_00000234-exon-sc0000001-1491911889:2036582..2036934TCONS_00000234-exon-sc0000001-1491911889:2036582..2036934Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2036582..2050641 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.930128 0.90689 0 0 0.358378 0.242012 0.170832 0.377715 0.111972 0 0.269241 0.176989 11.0464 9.6139 0 0.161941 5.18695 6.00495 51.9464 61.1842 8.56107 9.77556 3.5041 4.15531 8.7054 9.74909 0 0.0725104 0.574911 0.60104
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000884TSP1_rpt
IPR002889WSC_carb-bd
Blast
BLAST of TCONS_00000234 vs. Swiss-Prot (Human)
Match: ATS20 (A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens GN=ADAMTS20 PE=2 SV=2)

HSP 1 Score: 132.88 bits (333), Expect = 1.720e-31
Identity = 157/585 (26.84%), Postives = 242/585 (41.37%), Query Frame = 2
Query:    5 GIQTRLLQCIREDDQSVVSSSSCEGLEGP-VTQQSCNANVCPALWYVTEWTKCSKLCGSGTKTRKLYCSRID-GTGQRITVDDSECTGE-KPEDVEFTSTCNVIACPAYYVYGEWTQCSASCNGGKRSRSSICKHISEVGKLVTINVQACLYLGDPLVSETCNADIPCPEWKIV-YSECSKTCDGGIQTASVVCTDPDSGTQVDASTCDASKKP-TVTDADSKACNEELCDPYVWREQDGVCSVTCGKGLLPITQVCFGRVEKKNVEESKC-PSPKPKDP-----TP----KECDAGACPETY-----SWKT-KFSECSVTCGTGTKTLEPYCVKDSDQSTSNEVLCDPAKKPGTSTEQCALGDC--PIKYSWNTEMSECSVTCGEGVKTASYKCVRSTDNAQVDDSKCEGIAKPNIANEKCVEAACPPTYS---------------------------------------WRKHNXXXXXXXXXXXXTQSGHCHRDEDGERMEESFCNVSQKPTTQTFSCHKEACKAPFYWKGNFGRCMATCGSGHKLKVLSCVERATGHVTENEKCKDAAIPDDE-QCTMEPC 1570
            G+Q R + CI + D SVVS   C+ L  P    QSCN + C   W+V   ++CS  CG G +T  ++C +     GQ + VDD  C  + KP   E    C+       + Y EW+QCS SC GG+RSR S C  ++  G  +  N   C  L   +  E CN +  CP W    +SEC  TC  G +   V C    +   +    C++S KP +++  +   C      P+      G C+ TCG G       C   +    +E+++C  + +P D      TP     + +    P         W+   ++ CSV+CG GT+     C +D+    ++E  C    +P        + DC  P       + S CS +CG G  T    C+    +  +D++ C+   +P +  ++C  AACPP +S                                       WR        S  SG +       +DE+G+    S+C+ + KP  +   C    C  P +  GN+G C  TCG G K +++ C +   G + E+  C+    P    QC M  C
Sbjct:  865 GLQRRNITCIHKSDHSVVSDKECDHLPLPSFVTQSCNTD-CELRWHVIGKSECSSQCGQGYRTLDIHCMKYSIHEGQTVQVDDHYCGDQLKPPTQEL---CHGNCVFTRWHYSEWSQCSRSCGGGERSRESYC--MNNFGHRLADN--ECQELSR-VTRENCN-EFSCPSWAASEWSECLVTCGKGTKQRQVWCQ--LNVDHLSDGFCNSSTKPESLSPCELHTCASWQVGPW------GPCTTTCGHGYQMRDVKCVNELASAVLEDTECHEASRPSDRQSCVLTPCSFISKLETALLPTVLIKKMAQWRHGSWTPCSVSCGRGTQARYVSC-RDALDRIADESYCAHLPRPA------EIWDCFTPCGEWQAGDWSPCSASCGHGKTTRQVLCMNY--HQPIDENYCDPEVRP-LMEQECSLAACPPAHSHFPSSPVQPSYYLSTNLPLTQKLEDNENQVVHPSVRGNQWRTGPWGSCSSSCSGGLQHRAVVCQDENGQ--SASYCDAASKP-PELQQCGPGPC--PQWNYGNWGECSQTCGGGIKSRLVIC-QFPNGQILEDHNCEIVNKPPSVIQCHMHAC 1415          

HSP 2 Score: 93.5893 bits (231), Expect = 2.620e-19
Identity = 169/682 (24.78%), Postives = 265/682 (38.86%), Query Frame = 2
Query:    5 GIQTRLLQCIREDDQSVVSSSSCEGLEGPVTQQSCNANVCPALWYVTEWTKCSKLCGSGTKTRKLYCSRIDGTGQRITVDDSECTGEKPEDVEFTSTCNVIACP-------------AYYV----------------------------YGEWTQCSASCNGGKRSRSSICKHISEVGKLVTINVQACLYLGDPLVSETCNADIPCPEWKI-VYSECSKTCDGGIQTASVVCTDPDSGTQVDASTCDASKKPTVTDADSKACNEELCDPYVWREQDGV-CSVTCGKGLLPITQVCFGRVEKKNVEESKCPSPKPKDPTPKECDAGACPETYSWKTK-FSECSVTCGTGTKTLEPYC-VKDSDQSTSNEVLCDPAKKPGTSTEQCALGDCPIKYSWNTEMSECSVTCGEGVKTASYKCVRSTDNA--QVDD----SKCEGIAKPNIANEKCVEAACPPTYSWRKHNXXXXXXXXXXXXTQ--SGHCHRDEDGERMEESFCNVSQKPTTQTFSCHKEACKAPFYWK-GNFGRCMATCGSGHKLKVLSCVERATGHVTENEKCKDAAIPD-DEQCTMEPCKPVFETDKMPPTYAV---GCYGDQPTPRRVPIYLENMKDIYDPANPLPMIQKCAEKAHSMGYVYFATQYFGECWAGDLNTAEQYYLNG-YTDRCENGIGKVAANF 1873
            G Q R + C R+    +   S C  L  P     C        W   +W+ CS  CG G  TR++ C           +D++ C  E    +E    C++ ACP             +YY+                             G W  CS+SC+GG + R+ +C+   E G+    +   C     P   + C    PCP+W    + ECS+TC GGI++  V+C  P+     D +    +K P+V      AC  ++     W ++    CS +CGKG       C  + ++K +E++ C S   K PT K C +  CP   SWK   ++ECSVTCG+G +  + YC +K   Q    E +CD + +P  S  +C   DC            CS +C    +  S++ +  TDN   QV++    S    +   N  N  C         S   +N   S        T+  S   H+      +    C V   P++Q + C   +C     WK G + +C  TCG G   + + C+   T H   ++ C +   P   ++C    CK      ++     +   G Y      R + IY  +M  + +P   L ++Q                + F E +   L    Q   NG   + CE   G +AA +
Sbjct: 1171 GTQARYVSC-RDALDRIADESYCAHLPRPAEIWDCFTPC--GEWQAGDWSPCSASCGHGKTTRQVLC-----MNYHQPIDENYCDPEVRPLME--QECSLAACPPAHSHFPSSPVQPSYYLSTNLPLTQKLEDNENQVVHPSVRGNQWRTGPWGSCSSSCSGGLQHRAVVCQ--DENGQ----SASYCDAASKPPELQQCGPG-PCPQWNYGNWGECSQTCGGGIKSRLVICQFPNGQILEDHNCEIVNKPPSVIQCHMHACPADV----SWHQEPWTSCSASCGKGRKYREVFCIDQFQRK-LEDTNC-SQVQKPPTHKACRSVRCP---SWKANSWNECSVTCGSGVQQRDVYCRLKGVGQVV--EEMCDQSTRP-CSQRRCWSQDCVQHKGMERGRLNCSTSCE---RKDSHQRMECTDNQIRQVNEIVYNSSTISLTSKNCRNPPCNYIVVTADSSQCANNCGFSYRQRITYCTEIPSTKKHKLHRLRPIVYQECPVV--PSSQVYQC-INSCLHLATWKVGKWSKCSVTCGIGIMKRQVKCI---TKHGLSSDLCLNHLKPGAQKKCYANDCKSFTTCKEIQVKNHIRKDGDYYLNIKGRIIKIYCADMY-LENPKEYLTLVQ--------------GEENFSEVYGFRLKNPYQCPFNGSRREDCECDNGHLAAGY 1799          

HSP 3 Score: 87.0409 bits (214), Expect = 2.715e-17
Identity = 121/457 (26.48%), Postives = 188/457 (41.14%), Query Frame = 2
Query:  329 YGEWTQCSASCNGGKRSRSSICKHISEVGKLVTINVQACLYLGDP-LVSETCNADIPCPEWKIVYSECSKTCDGGIQTASVVCT----DPDSGTQVDASTCDASKKPTVTDADSKACNEELCDPYVWREQDGVCSVTCGKGLLPITQVCFGRVEKKNVEESKCPSPKPKDPTPKECDAGACPETYSW-KTKFSECSVTCGTGTKTLEPYCVKDSDQSTSNEVLCDPAKKPGTSTEQCALGDCPIKYSWNT-EMSECSVTCGEGVKTASYKCVRSTDNAQVDDSKCEGIAKPNIANEKCV----------EAACPPTY------SWRKHNXXXXXXXXXXXXTQSGHCH-RDEDGERMEESFCNVSQKPTTQTFSCHKEACKAPFYWKGNFGRCMATCGSGHKLKVLSCVERATGHVTENEKCKDAAIPDDEQ-CTMEPCKPV---FETDKMPPTYAV 1615
            YG W  C+  C G +R R+  C H S+      ++ + C +L  P  V+++CN D       I  SECS  C  G +T  + C           QVD   C    KP   +     C         W +    CS +CG G       C      + + +++C   +    T + C+  +CP   SW  +++SEC VTCG GTK  + +C  + D  +     C+ + KP  S   C L  C    SW       C+ TCG G +    KCV    +A ++D++C   ++P+   + CV          E A  PT        WR H S    S   G  TQ+ +   RD      +ES+C    +P  + + C     +   +  G++  C A+CG G   + + C+      + EN  C     P  EQ C++  C P    F +  + P+Y +
Sbjct:  853 YGPWEGCTKMCQGLQR-RNITCIHKSDHS---VVSDKECDHLPLPSFVTQSCNTDCELRWHVIGKSECSSQCGQGYRTLDIHCMKYSIHEGQTVQVDDHYCGDQLKPPTQELCHGNCVFTRWHYSEWSQ----CSRSCGGGERSRESYCMNNFGHR-LADNEC--QELSRVTRENCNEFSCP---SWAASEWSECLVTCGKGTKQRQVWCQLNVDHLSDG--FCNSSTKP-ESLSPCELHTCA---SWQVGPWGPCTTTCGHGYQMRDVKCVNELASAVLEDTECHEASRPS-DRQSCVLTPCSFISKLETALLPTVLIKKMAQWR-HGSWTPCSVSCGRGTQARYVSCRDALDRIADESYCAHLPRP-AEIWDCFTPCGE---WQAGDWSPCSASCGHGKTTRQVLCMNYHQP-IDEN-YCDPEVRPLMEQECSLAACPPAHSHFPSSPVQPSYYL 1281          
The following BLAST results are available for this feature:
BLAST of TCONS_00000234 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ATS201.720e-3126.84A disintegrin and metalloproteinase with thrombosp... [more]
back to top