Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000233 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000233
Unique NameTCONS_00000233
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2268

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000233 ID=TCONS_00000233|Name=TCONS_00000233|organism=Clytia hemisphaerica|type=transcript|length=2268bp
CAGTAACGCAACAATCATGTAATGCTAATGTTTGCCCCGCATTATGGTAC
GTCACCGAATGGACCAAATGTTCGAAACTTTGTGGAAGTGGTACAAAGAC
AAGGAAACTTTATTGTTCACGTATCGACGGAACGGGACAACGTATCACAG
TTGACGATAGCGAATGTACGGGTGAAAAACCGGAAGACGTAGAGTTTACG
TCAACATGTAACGTTATTGCGTGTCCTGCGTATTACGTTTACGGAGAATG
GACCCAGTGTTCTGCTTCATGCAACGGTGGAAAACGCAGTCGATCATCGA
TCTGTAAACATATCAGTGAAGTTGGAAAACTTGTTACAATCAATGTACAA
GCTTGTCTATATCTTGGTGATCCTTTGGTCTCTGAAACATGTAATGCTGA
TATTCCATGTCCTGAATGGAAGATTGTATACTCCGAATGCTCCAAAACTT
GCGATGGAGgtATTCAAACAGCATCTGTTGTTTGTACTGACCCCGATTCA
GGAACTCAAGTGGATGCTTCAACGTGTGATGCTTCGAAAAAACCTACGGT
AACCGATGCGGATAGTAAAGCTTGCAACGAAGAATTATGTGATCCTTATG
TCTGGAGAGAACAAGATGGTGTTTGTAGCGTGACCTGCGGAAAAGGTCTT
TTGCCAATTACACAAGTCTGTTTCGGACgtgttgaaaagaaaaatgtcgA
AGAATCAAAATGTCCGTCGCCTAAACCTAAAGATCCGACACCGAAAGAAT
GTGATGCAGGCGCATGTCCAGAAACATATTCATGGAAAACCAAATTCAGT
GAATGTAGTGTTACTTGTGGCACAGGTACCAAAACTCTAGAACCTTATTG
CGTCAAAGATTCCGATCAAAGTACATCGAACGAGGTGTTGTGCGATCCAG
CAAAGAAACCTGGCACTAGTACCGAACAATGTGCGCTTGGTGATTGTCCA
ATCAAATATTCTTGGAACACGGAGATGAGTGAATGCAGTGTAACGTGTGG
TGAAGGTGTGAAAACGGCGTCGTACAAATGCGTCCGCAGTACAGATAACG
CTCAAGTGGATGACAGTAAATGCGAAGGAATCGCAAAACCAAATATTGCT
AATGAGAAATGTGTTGAAGCTGCCTGTCCACCTACTTACTCTTGGAGAAA
ACATAATTCGTCCTGCAGCGTCTCTTGTGGATCAGGAATCATTACTCAAT
CTGGTCATTGCCACCGAGACGAAGATGGCGAGAGAATGGAAGAATCCTTC
TGTAATGTTTCACAAAAACCAACAACACAGACTTTCTCATGTCATAAAGA
AGCATGTAAAGCACCGTTCTATTGGAAAGGCAACTTTGGGCGTTGTATGG
CTACTTGTGGAAGCGGGCACAAATTGAAAGTCTTGTCATGCGTAGAAAGA
GCAACAGGTCACGTGACAGAAAACGAAAAATGTAAAGATGCAGCAATTCC
CGATGACGAGCAATGTACAATGGAGCCATGTAAACCAGTATTTGAGACGG
ACAAGATGCCACCAACGTATGCAGTGGGTTGCTATGGTGACCAACCAACA
CCAAGACGTGTACCAATTTATTTGGAAAACATGAAAGATATCTACGATCC
AGCTAACCCACTTCCAATGATTCAGAAATGTGCTGAGAAGGCTCACTCCA
TGGGTTATGTATATTTCGCAACACAATACTTCGGAGAATGTTGGGCTGGT
GACTTGAATACTGCAGAACAATATTATTTGAATGGATACACTGATAGATG
TGAAAATGGTATTGGTAAAGTTGCTGCTAATTTTGTATACAAGATTGGAA
CGCCAGAATCATATCCACCAGTACCAGCTCTGGTCAACCTTGGATGTTAC
AATGATGACCCAGAAGATCGATCATTCCAAACACATCTTGATAACTTCCG
ACCAATCCTCGACTGGGACAAGAAAAACTTTGATGATCTGGTTACTAAAT
GTGCTCAATCAGTGAGCCGACGAAAATGGAATGTTTTTGGTATTCAATAT
TACGGTGAATGTTGGAGCGGTGAAAATGCTGTCAATACGTACGCGCATAC
GGGCAAAGCAGATCGCTGCTCGAACGGAATCGGAGAAGTCAACGCAAACG
CTGTTTACGTTTTTGTTGAATAATTTTCATCGATTCATTTATCGATTAGA
TGACATCATAATCTTTTTTTGGGAGGAATCTGggtataattttttataat
tatttctTTACGCatatttatttaatattttattttgggAAATTGTAAAT
GGATATTTATTTTTCGAA
Run BLAST on NCBI

transcript from alignment at sc0000001:2036582..2050502-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000233 ID=TCONS_00000233|Name=TCONS_00000233|organism=Clytia hemisphaerica|type=transcript|length=13921bp|location=Sequence derived from alignment at sc0000001:2036582..2050502- (Clytia hemisphaerica)
CAGTAACGCAACAATCATGTAATGCTAATGTTTGCCCCGCATTGTAAGTT CATTATAAATAAAACATTGAGTTTGAAGCCCCGAATGAGGTCGAGAGGAA TCTTTAACCTTTCACAAGCAAGAAAAAGTGAAAGCCTTAAGATTGGTGCC GTATTTATAATGACGGATTGAATCTATTCATTTCTTTGTTTTTAAGCGGA ATATTTTCCAAAATCTGGCGATAGGTTTTACTTTCAATCTGGCATTTATC TATTTTTTTTATTTACAGTAATATATTTCCCAGGTCTATCAACCTCTATG AAATAATCATGCTTAACATTTTACAATTTATGGAGATCTTTTTCCCATTC TGTGAGCACTTTTTCTTTGAAGTTGGCGACAGATGTTGCAGCTACAACAT CAACTCCAAGACCATTCCATATGTCAATACTTCTGTAGAACAACGAATTT GTTTGATACCCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNATACCCTCTGACACCATCATTTGCAAAGTTTCT TTGTAGTTCGTAATCGTGCTGACGTTTCGGGCGTTCGCGAAGGACAAACT TTTGACAGGCCGATGATGATTTTTGATGATATTTATGTGAAAACTTTTAG TTTTAAAACACGTTCAATTCGGTAGAAGGTGATAGAGAGTGAGAAATTCT CAATAAAGCTTGGAAACTTAGTCCGACTGTGAAGTTATTCCGTTCCTCCT TGTTATACGTTTTTCTTTCTTTATTAGATGGTACGTCACCGAATGGACCA AATGTTCGAAACTTTGTGGAAGTGGTACAAAGACAAGGAAACTTTATTGT TCACGTATCGACGGAACGGGACAACGTATCACAGTTGACGATAGCGAATG TACGGGTGAAAAACCGGAAGACGTAGAGTTTACGTCAACATGTAACGTTA TTGCGTGTCCTGCGTATTACGTTTACGGAGAATGGACCCAGGTACGGATA GCTTCTCATCTAACAGTTCTGTTAAGTTTCGAAACAAAAATGAAACCACT CTATTGGCTAGAATTGATGTAATCCTTCACCCAGATGTGGGTCAATAATA TAAGAATTATTTCGATTTTTTCCTTTATCGCTTAGGAAGTTTCAAACAAT AATTCCGACCATCCTATCTCTCTTTGTTCCTATCTCTGAAAAGGAATGAC GAAATTGAACAGGGTGTCCATTATAAGACCACCTCCGCCCACAAGTATCT TGACTGCAAGTTGACAACAGTAGTTGACCTTACGGGAAATTTGTTCAATC AGAGCTAAACAACTGACATGTCAAGAAATGAGGAGGCAAGAGAGTTGTCC TGTTTGATTAAATTACCGGTATCCAAACTGTGGTCTACTTTTAGAAGATT TAGAATTATTTTGCTTCAGCCAAGGATAGAGTAACTCCATCTAGTGTTCT ATATAAGAAATATGTGTGTCTCAGCTACGGTATGTTTTATTTCAATATTT TTTCTGGCACTAGTGTTCTGCTTCATGCAACGGTGGAAAACGCAGTCGAT CATCGATCTGTAAACATATCAGTGAAGTTGGAAAACTTGTTACAATCAAT GTACAAGCTTGTCTATATCTTGGTGATCCTTTGGTCTCTGAAACATGTAA TGCTGATATTCCATGTCCTGAATGGAAGATTGTATACTCCGAATGCTCCA AAACTTGCGATGGAGGTACCTAAGTTATTTTCAACTTACTTTTACCATAG TTTTTCTACTTGGAAAGTTTATAATATTTCGTCTGGCTCTGATGGGACCG AGACTCCCAAAACCATCACAGCAGAATCACCTAAATATTTCATCACTTAT ATGGTTTTGCTCACACGGGAACCAATCCTGACTAGATTTGAAATCGGACC TTCACTTCTACTTAAACTCAACATGAGCAGAGGATATGTTCTCTCCGTCT CCGGAGAGAACATCCGTCTTTGAATAGTCTCATCTCCGTCTTTGAATAGT TATGTGATTGAGATATCAGGCCCGGAGGAACAACCGTAAAAGTGGGCTCA AATGAAATAAAATTCGCTAGGAATTCGAGGAAAAAAATCTCATTTGCTCA AAAGGGTAGAGGCTGAATTTTCCCCAGTCTGCCCGCTTCCGCTGGGCCTG GACATGCGCGATGAAATTCTTATAGTCTGTCGCCACAGGTTAAATTTCAG TAAAAGCTAAACTGTGGTGCTCATGGTAATAATCGTTAAAATTCTTCTTA GAAGCAATATACTGTCAAACTTTCAAAATTTGTGCGAAACGTCCAAACAC CGTCCATATAGAGTCATATAACCTTTATATACCCGGGACACAGTTCCTTG CTTTTGGTCAAAAGAAATCTTCGAAAGTGGTACCCTTTTCTTTTTGGTAC CATTACAAAAACAGTCATTCGATTTCAAACAATGCTATGTTACTACACGT TTTTTTATAACAACATCCAAAATTTTTGAAGCCTTTGGATGTTCTTAACT TTTTGAGTTTTAAGCCTAAAATATTCTTAACATGTTCATATTTGACCATT TTGTGAGTATTTTTGACCATTTTTCTAAAAAATAGAGTGTTTTTGAGTCT ACAAAGCCTTAAAATGTTCTTTAACTTGTTCTTAACATTTCGGCCATCGA AGCCTTGTGTTCTTATATAGTTTGTTCTTATAAAAAAAACGTGTACCTGT AAAGTATCCATTGAAAGTGGCCCTCGTCATTTTTCATGATTTCATTTTTT TCAGGTATTCAAACAGCATCTGTTGTTTGTACTGACCCCGATTCAGGAAC TCAAGTGGATGCTTCAACGTGTGATGCTTCGAAAAAACCTACGGTAACCG ATGCGGATAGTAAAGCTTGCAACGAAGAATTATGTGATCCTTATGTCTGG AGAGAACAAGATGGTGTTTGTAGCGTGACCTGCGGAAAAGGTAATCTCGT TCCCAAACATCTCGATGTATGATTTTATTCGTGATATCTGTGACGTAATG TTTTATACGGAAATAACTAAAATATCCTAGGCAATTACCACTATTTTTGT TTTTTAAATACAAGATTATGGTCAAATACCCGGGACAGTGCAATTTCTTT TCCAAAAAGGATGGGAAGCTACGGTTTTTAAAAGATGTAACCATTTGGAG ATTGAGTGGCCCATTCGTCAAAATAAGGTTTTCAATGAGATTTTTTATTT AATATTTCAATTCATTTATAGGTCTTTTGCCAATTACACAAGTCTGTTTC GGACGTGTTGAAAAGAAAAATGTCGAAGAATCAAAATGTCCGTCGCCTAA ACCTAAAGATCCGACACCGAAAGAATGTGATGCAGGCGCATGTCCAGAAA CATATTCATGGAAAACCAAATTCAGTGAATGTAGTGTTACTTGTGGCACA GGTTTGCATATTGTTACTTCTTAGTGTTGATTTCAACTCTTATTGTTTCA ATTTAGTTAACAAAAGGAAGAACAACGAGGCCGCGCGAGCATAGATTTGA AATAATAGACCTTTTGATAAATTACGTCACGAACCTCACTTGCCTCGTTT TGAAATTATTGCCAAGGTGATTAACTCCCAGCAGATTTTATTAAAACTAC TTTCTATTTATAAAAAAATTATTTTTGGTAATTGTTTGAATACGAGGCAA GCGATGCTAGTAACTTAATTTATCAAAAGGTCTATTCTTTCATCAGTTAT CCTTTAGTCCTACGACAGACCATCCATATTGAACCAGCACTGCTCTAAGG GTGCAGATATTATTATTATGATCTGTCGAACTTGTTTAGCTTATGCGATC AACACTGCGACAACTTTCGCCTGAAAACAAAGTTGAAAACAACGGGGTCA TGTTATTGATCGCCGTATATTGTTTTGAAAATTACGTCGTGTCCAGCTGG ATAATATACTGCCTCCATCTAAACTAAATTGTTAAAAAAGGAAACAATAA AACTTTATTTTAATTCTTTTCAGGTACCAAAACTCTAGAACCTTATTGCG TCAAAGATTCCGATCAAAGTACATCGAACGAGGTGTTGTGCGATCCAGCA AAGAAACCTGGCACTAGTACCGAACAATGTGCGCTTGGTGATTGTCCAAT CAAATATTCTTGGAACACGGAGATGAGTGAATGCAGTGTAACGTGTGGTG AAGGTATTTTCAGACTTTTCTTTCTTTAAACACAGTAAATAACTTCGAAG TTTCTTGCCTCTTCAGCACTACACACTTTTTTATAAGCAACCAGGCTGCT AAGGCTTGATCCCTCAAATTCTGTTTCACTATCTCGTAAAGTAAAAGCGT TTTAGATAATCTAACCATGGTAGGTGATAGCCATTGACCCAATATGTATA AATATGGTTGTACAGTCAAAGCAAATTTTTCAGAAAGTGAGCTTTAATGC TAAAAGCAAGCCCAGCCCTGACCCGCAAAAATTGAAGTTGCTTATACAAA AAAAATGTGCTATACTTTACAAAAGGAAAAAAAGTACCTTTTAGGGACGT CTCGCACTTTCGTCCTACGAAAATCGACCTATTTTCAATTTTTGGGATTA CAGTAGTTTTTATCATAATCTTTCGGAATTGAAAATAGATCAGCTATCCG TCCAACATTTTCATCGTTAATGTTTCTTTAGGCTGAGCGTATCCCCGAAA TTGATTTTGATATAGGGGATGTGTATTATGAATAAAATTCCCGCCCGACA GTTACCCCCGTCTTTGTGTTTTTGGGTGGTATATTTTATCGAACAGGCTA AGTGAGCTTTACGCTTTCTGTGTGTCTTTACTCGAAAAACGAAGGAGAGT CATATCAGCCGAAAGGTTGGCGTGCTTTTAGCTTTTCCAAGCAGAAAAAA ATATGATTGCTGTTGTTTTCGAAAACCCACGGAGCTTATGAAATTATATT GTGATGTCACGTGGCCTAGATAGGATTTCCTACCTAACCACGGCGCACTC TATCTGCTACCCCTTTACAGAAATCTGTGATCACATCTGATCTGTATTAT TTTTTTAGGTGTGAAAACGGCGTCGTACAAATGCGTCCGCAGTACAGATA ACGCTCAAGTGGATGACAGTAAATGCGAAGGAATCGCAAAACCAAATATT GCTAATGAGAAATGTGTTGAAGCTGCCTGTCCACCTACTTACTCTTGGAG AAAACATAATTCGTCCTGCAGCGTCTCTTGTGGATCAGGTATAAAATGCT TTAGTCTAATACACGGGATGTAAAATTATACCAGTGCAGTCAAAACATGT GATTACTAAAAAAAGTTCACATGATTTTATTCCCATGTTACTTATGCTTT ACAACTTACAGCTGATAACTTTATTAGTGTCAATAAATTCGAACCAATCA GAAATAAATGTCATGTAACAAACACATAGAAATTTCGAGTAAAAGCGTGA TTTGTCTTCAGACTTTAATTTTGCAAGCTGTGTATTGAATTTTCACGAGT TTTTATCACGCTTTTCGCAAAATCTCTTTCAAGCATTTTCTAAACGTATT ATATTATGAATATCATACAGGAGTTGAAATACAGTCTTTGCTTATAGAAA ATTGAAAAAAGTCAAAATCTTGACTTTTTGTTAAAGTTGAAATTAGGCAT CACATTAACTTAAGACGGTCAACTTTCTGTGATCGCCCAAAGTAAGGCGA AGTGAGGTTACATTTTGCAAGTCACCAAAGTCGCAAACCTTGAAATTATA ATTTCGCCTTTTGTAGATTTTATCGCTGATAATATTTATATTGACTCGTA AACTTTTTATCCAATAAACTTTTCGATTTTGATGACTCGCAAAATATAAC TTCAATCGTTTTCCTTCGGACGATCTTCTCACAGAAAGTTCATCGTCTAA AGTCAATCTGATGTCTAATTTTGACTTCAAAATATTGGCTTTTTCAATTT TCTTTAAGCAAAGACTGTATTAAGCAAGTTCTTTAATGCTTATCTTATGT CACGTGACCTAATTTGAAGAGACTGGGATTCGAGTCGGGGCCCTTAGTTA TAGTTGCGTTGATACCTTAGACCATTCGTCTATACGCTTCTCAGTGTTAA AAGTTCTTATGTCTCAGACGGATTTCCGTCTCAGCAAAGTATGTAAAGAG GTTCCCGTCTCGAAACTCTGCATAATGTACCAAAATCTCAAGAATATATG TGCTATTAGACCTTTTCATAAATTACGTTACGAAAATCACTTGCCTCGTT TCGAAATTATTGCCATGGTGATTAACTCCCAGCAGATTTTATTAAAACTA CTTTCTATTCATAAAAAAATCATTTAATGTCTCGAGGGGACATAATCATT ATGGTAATTGTTTGAATACGAGGCAAGTGAGGTTCTTGACGTAATTTATG AAAAAGGTCTATTTGCTATGTAAAATCCATTTCCCGTTTCAAACTAAAAA ACTTGCTTTGACCACTGATTCCTATAATAAGAATTTCTTTTGATTTCATT ATCTCACATCAGGAATCATTACTCAATCTGGTCATTGCCACCGAGACGAA GATGGCGAGAGAATGGAAGAATCCTTCTGTAATGTTTCACAAAAACCAAC AACACAGACTTTCTCATGTCATAAAGAAGCATGTAAAGCACCGTTCTATT GGAAAGGCAACTTTGGGCGTTGTATGGCTACTTGTGGAAGCGGTAAGTGG CCCCATGATTTTCGTGTATTGTATTTCAACATAAAATTCGTGCATTTGTT ACATGATATGTGCAGATTTCCCTGTGAGAAAGATGTTGAAAAAATCTTTT GACGGAAGGTGCTTTTTAGCCATATGCCTTATAAGGAAATGAAGGTTCTC CGTCGTAAATTTTGAACCCCCTGTGATCCGCAACTGTTTGAGAGATTTTT TTATCCCCCTTCTTTTTATGATTTCCACACACAACCTATTCCTTTTCTTA CCGTCAGGGCACAAATTGAAAGTCTTGTCATGCGTAGAAAGAGCAACAGG TCACGTGACAGAAAACGAAAAATGTAAAGATGCAGCAATTCCCGATGACG AGCAATGTACAATGGAGCCATGTAAACCAGGTACAACTTGATTCTCCCTG ATCGTTTCCCGATTTCCCCCAATAGTTGGCCGATTATACCTTGATCAATA ATTGGAGCTGTTATTTATTTTCCACATTTTGATTTCATCCATTTTAAATG AAGATATTGCATAGAACGTCTTTTTTGACGGAAAAATGAGGAAAAAAATG GATTAGATCTTTAATTTTTAATGTTATTTTTAATTAGTCCAATTCTAATG ACAATATGCTTCGTGAGTGGAAGGAAAGACTAGTTTTGAATAACTGAGAG CTCCCCTATCGTCTGGCTAAATATGTTACCCCTTAGCCAAANGGGATAAC ACACACAAACTTTTCTACTCAATCGCATGTTCAAACTCGATACTTTAATT AGGGACACCCTGTATTATGAATATCATACAGGAGTTGAAATACAGTCTTT GCTTATAGAAATCTTGACTTTTTGTTAAAGTTGAAATTAGGCATCACATT AACTTAAGACGGTCAACTTTCTGTGATCGCCCAAAGTAAGGCGAAGTGAG GTTACATTTTGCAAGTCACCAAAGTCGCAAAATTTGAAATTATAATTTCG CCTTTTGTAGATTTTATCGCTGATAATATTTATATTGACTCGTAAACTTT TCATCCAATAAACTTTTCGATTTTGATGGCTCGCAAAATATAACTTCACT TCGTCTTCCTTAGGACGATCTTCTCACAGAAAGTCCATCGTCTAAAGTCA ATCTGATGTCTAATTTTGACTTCAAAATATTGGCTTTTTCAATTTTGTCT AAGCAAAGACTGTATTAAGCAAGTTCTTTAATGCTTATCTTATGTCACGT GACCTAATTTATAGAGACTGGGATTCGAGTCGGGGCCCTTATTTATAGTT GCGTTGATACCTTAGACCATTCGTCTATACGCTTCTCAGTGTTAAAAGTT CTTTCGTCTCAGACGGATTTCCGTCTCAGCAAAGTATATAAAGAGGTTCC CGTCTCGAAACTCTGCATAATGTACCAAAATCTCAAGAATATATGTGCTA TTAGACCTTTTCATAAATTACGTTACGAAAATCACTTGCCTCGTTTCGAA ATTATTGCCATGGTGATTAACTCCCAGCAGATTTTATTAAAACTACTTTC TATTCATAAAAAAATCATTTAATGTCTCGAGGGGACATAATCATTATGGT AATTGTTTGAATACGAGGCAAGTGANGATGTCTCGAGGGGACATAATCAC CATGGTAATTGTTTGAATACGAGGCAAGTGAGGTTCTTGACGTAATTTAT GAAAAAGGTCTATTTGCTATGTAAAATCCATTCCCCACCTTGCTTTGACC ACTGACTCCTATAATAAGAATTTCTTTTGATTTCATTATCTCACATCAGG AATCATTACTCAATCTGGTCATTGCCACCGAGACGAAGATGGCGAGAGAA TGGAAGAATCCTTCTGTAATGTTTCACAAAAACCAACAACACAGACTTTC TCATGTCATAAAGAAGCATGTAAAGCACCTTTCTATTGGAAAGGCAACTT TGGGCGTTGTATGGCTACTTGTGGAAGCGGTAAGTGGCCCCATGATTTTC GTGTATTGTATTTCAACATAAAATTCGTGCATTTGTTACATGATATGTGC AGATTTCCCTGTGAGAAAGATGTTGAAAAAATCTTTTGACGGAAGGTGTT TTTTAGCCATACTCCTTATAAGGAAATGAAGACTCTCCATTTTAAATTTT GAACCCCCTGTGATCCGCAACTGTTTGAGAGATTTTTTTATCCCCCTTCT TTTTATGATTTCCACACACAACCTATTCCTTTTCTTACTGTCAGGGCACA AATTGAAAGTCTTGTCATGCGTAGAAAGAGCAACAGGTCACGTGACAGAA AACGAAAAATGTAAAGATGCAGCAATTCCCGATGACGAGCAATGTACAAT GGAGCCATGTAAACCAGGTACAACTTGATTCTCCCTGATCGTTTCCCGAT TTCCCCCAATAGTTGGCCGATTATACCTTGATCAATAATTGGAGCTGTTA TTTATTTTCCACATTTTGATTTCATCCATTTTAAATGAAGATATTGCATA GAACGTCTTTTTTGACGGAAAAATGAGGAAAAAAATGGATTAGATCTTTA ATTTTTAATGTTATTTTTAATTAGTCCAATTCTAATGACAATATGCTTCG TGAGTGGAAGGAAAGACTAGTTTTGAATAACTGAGAGCTCCCCTATCGTC TGGCTAAATATGTTACCCCTTAGCCAAAATTGATTATGGTTTTTCCTCTC TAATATCGTCCGCCAACTAGCCGAGAATCCGCCAACTGACCAAAGGAAGT GCCGTCTTTTTAATACAATCATATGAACAAGTTTACTTTCCATTAAATCG AATCTAATATATAAGAAAATCAAAACTAGCCACAAAATTGTATAAATAAG CTTCATCTAAAGTTCTATAGGAACTTGCCTGGACACCAAACCGTCCGCCA ACAGGACCAATGACTCTAGCGGAAATTCTGTTTAGAGATAGGTGACTTTA ATTTCTTTTTCGTNCAACTTGATTCTCCCTGATCGTTTCCCGATTTCCCC CAATAGTTGGCCGATTATACCTTGATCAATAATTGGAGCTGTTATTTATT TTCCACATTTTGATTTCATCCATTTTAAATGAAGATATTGCATAGAACGT CTTTTTTGACGGAAAAATGAGGAAAAAAATGGATTAGATCTTTAATTTTT AATGTTATTTTTAATTAGTCCAATTCTAATGACAATATGCTTCGTGAGTG GAAGGAAAGACTAGTTTTGAATAACTGAGAGCTCCCCTATCGTCTGGCTA AATATGTTACCCCTTAGCCAAAATTGATTATGGTTTTTCCTCTCTAATAT CGTCCGCCAACTAGCCGAGAATCCGCCAACTGACCAAAGGAAGTGCCGTC TTTTTAATACAATCATATGAACAAGTTTACTTTCCATTAAATCGAATCTA ATATATAAGAAAATCAAAACTAGCCACAAAATTGTATAATAAGCTTCATC TAAAGTTCTATAGAAACTTGCCTGGACACCAAACCGTCCGCCAACAGGAC CAATGACTCTAGCGGAAATTCTGTTTAGAGATAGGTGACTTTAATTTCTT TTTCGTCTGTACAGTATTTGAGACGGACAAGATGCCACCAACGTATGCAG TGGGTTGCTATGGTGACCAACCAACACCAAGACGTGTACCAATTTATTTG GAAAACATGAAAGATATCTACGATCCGTAAGTAGGAGATTATACTTTAAG GAAACTTATTTTGGCGGGAACTAATTGTGACGAGCGGCAAAAATCCTGAA AATTTTTAATTTTGGCAGGAACTAATTTTGGCGAGTGAGCAAAATATTTG ATTTTGGCGGGAATTAATTTTGGCGAATTTTGTCTAAATTCGCCGAATTC GCCAAAATTAGTTCCCGCTAAAATAAGTTCACCTTTGACCAAGCTAGGTA ATTCCGACCCATCCCCCTATTTTTTGGTTTCACTACATTTCAAAAAATTT CTTGTAATTTTTAAGTCGGTGTCTAGATGCAACTCTATCTTAAGACCTAA TTTCCGCGTAGAGCTTTGTACTCTTTCGCATTTTCGGCCAAACAAAACCT TTCATTGGATTTAATAACCTAGATGATTATTGTCCATGGCCAACTCGGTT TTCTATGACCTGAATTCAAGATGGAAGAAGCGAGGACTCGAACCGAGAGC CCCGGGTTTATTCTTTTTACGGTTTACACACTATTACGCTCTTGTCTTGT ACTGTGTTTTAAAGTTCTGATTTTACACTTAGAAATTTGTTTTTTGAGTA CTCTATTGACCGTTTTGAGGAGCAAACTCTGCTACTCTCGACACTTGGTG TTTTGAGCATTCTTGGGGCAACAGCAATATCTATGCTCGCTTACCCGAGC TGCACTGACGAGTCCTGGGAAGGACGAAGCACTTGTCTGTAGATATAATT CGAATTACACCTTTTTTTATAAGAGCAAACTATATAAGAACATAAGGCTT CGATGACCAAAATGTTAGGAACAAGTTAAGAACATTTTAAGGCTTCATGG GCTCTAAAAAATCCAACTTCTTAGGCAGTTGCACAAAAATAATCGCAAAA TGGTGAAATTAAGAATATTCTAAGAACATTTTTAGGCTTAAAACTCAAAA AGTTAAGAACATTCGAAGGCTTCAAAAATTTTGGATGTTCTTATAAAAAA CGTGTACTGCTTTATTTTTAGAGCTAACCCACTTCCAATGATTCAGAAAT GTGCTGAGAAGGCTCACTCCATGGGTTATGTATATTTCGCAACACAATAC TTCGGAGAATGTTGGGCTGGTGACTTGAATACTGCAGAACAATATTATTT GAATGGATACACTGATAGATGTGAAAATGGTATTGGTAAAGTTGCTGCTA ATTTTGTATACAAGATTGGAACGCCAGAATGTAAGCTTTTGTATTCTCTG ATCATTCGTAAGGATGCCCCCAACTCTGATCACGATATCACGCAATTTTT TGTCTTCAACCACGGTCACGCAAATCAGCAAAGAAAATGGACAACACGCA TTCCTTTGAAAAAGTCCAAATCACGCATCACGGCTCAAAAATCTTTCAAA TCATGATCACGTTTTGACCTCTCATCACGCAATCACGAAGAATAAATTAC CAAATCAAGTAATCACGCTGCAAAAAAAGTCCCTTTCACGAAAACCGCTT GGGGGCCTCATGCATGATTGTTTTGTTAGAATATCTATTAAAGTCCATTT GCTTTAAGTGTGCACTCTTTCTTGCCACCATGTAGAAACCATGCCAGTGA AATTATGGTAATAGATCTTATCGGAGTAATTCCTCGAGGGAATTCTATTT TAATACCTCTGAAACAATCCCACAATGCATCGCTGTTTTAGAAAAATCAA AAACTCCGATAAGGTCTATTCTTTTGAAAACGGTTTCCACATAATAGCAC AATAGAGTGCACACTGGAATTGCATGGTCTTTACATTGAAAATTGCCCGA ACCCTACGTGCTACGAAGACAAATTTAGATAAGTTTGAATCTGAAAAAAT AAGCTCCTTCAATTTTAGTTGATTCTTAAGAATACATCGCACTTCCAGAC AATGAACTAAAAATAGTGAATCATATAGAAGAATTAGTTCCAGGCTTTTG TAACAATATTTGGGGTGCCTTATAACGAGGGAAAATTTTCTTTGAAAATA TTAATTTTTTATGAATCCCCGGGTGGTTCGTCCCAAAAGTTTTCGTAAGA GGAGTCTTCGGGGTGCCTCCGAATGTGGTTGCAGACTTACTTACTTTCTT ATCATATTTCTTCAGCATATCCACCAGTACCAGCTCTGGTCAACCTTGGA TGTTACAATGATGACCCAGAAGATCGATCATTCCAAACACATCTTGATAA CTTCCGACCAATCCTCGACTGGTATGTATTCTTTAATCAATCTCCTCAAA ACTTTAAAACTGCAAGTGATTTTTAAGTGCTTTGAAGTACAGTTCGGAAG TAAAGTTTTAACTCTGAGTTTTAACATTACATTAGACTTAATACTTAAGA CCTTATAATCTGAGGATCTAAAAGCTCAAAAATGTTTCAATAAGGCTGAG AATATAGCCTGAAAGCCACTTAACCCCTCCCAAATCGAAAAATCCTATGA AGCAAAGTGGAAGTACTGAAACTGCAATTCTCGCCCGACCTTTAAATTCT GAAAAACGTTAAAATATCCAAAATTGCCAATATATTTCGGCGCTGATTGT ACCATTCACCATTTTGAACTCGTTGTGTTTTTCAACTTTCACTAAACACA ATTACAATAAACTCCCTCTAATTCGTTCGAACCTCTGTTATTCGAATCAT TGAACCCCAGAAGCTAAAAGCTTTAGTCCATTCATATATTCCATCAATCT TTAGGAAATCTCCTTGTTCCTATATCTTGTGAAAAAAGTCGTATGCATTG GACCATTCCATTTTATATCCATACAGGGGGTTGGACGAACATTTCCAGAG GGTAATCTGAGAAATATTTCCAGGGGGTGTTTTTCCATTTTTCCAAGGGG GTAAAAAGTTATTTTAAAATTTCCAGGGGTTAAAAGACAGATTTTAGTTT GTCCACCCTCACTTTAAGGTATGAAAAGAACTTTTCAAAGGGCAATTTAT CCACACATTTTCTATAATTTTCTTTTGACTTGAAAAGGTTCGTCCATCCC CTGTATGTTTTTTTTATGGAACAACCCATTTTCGAGAAGCGAATCACTTC CAATTTTTTTGAATTTTTTATGACTTTTCTTCAAGTAATTTACCCCTATT GCTTTTCTCTTTTTCTAGGGACAAGAAAAACTTTGATGATCTGGTTACTA AATGTGCTCAATCAGTGAGCCGACGAAAATGGAATGTTTTTGGTATTCAA TATTACGGTGAATGTTGGAGCGGTGAAAATGCTGTCAATACGTACGCGCA TACGGGCAAAGCAGATCGCTGCTCGAACGGAATCGGAGAAGTCAACGCAA ACGCTGTTTACGTTTTTGTTGAATAATTTTCATCGATTCATTTATCGATT AGATGACATCATAATCTTTTTTTGGGAGGAATCTGGGTATAATTTTTTAT AATTATTTCTTTACGCATATTTATTTAATATTTTATTTTGGGAAATTGTA AATGGATATTTATTTTTCGAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000129XLOC_000129Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000233-exon-sc0000001-1575043694:2050460..2050502TCONS_00000233-exon-sc0000001-1575043694:2050460..2050502Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1575043694:2049312..2049525TCONS_00000233-exon-sc0000001-1575043694:2049312..2049525Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1575043694:2048588..2048789TCONS_00000233-exon-sc0000001-1575043694:2048588..2048789Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1575043694:2047363..2047548TCONS_00000233-exon-sc0000001-1575043694:2047363..2047548Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1575043694:2046902..2047081TCONS_00000233-exon-sc0000001-1575043694:2046902..2047081Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1575043694:2046150..2046329TCONS_00000233-exon-sc0000001-1575043694:2046150..2046329Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1575043694:2045115..2045294TCONS_00000233-exon-sc0000001-1575043694:2045115..2045294Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1575043694:2043697..2043840TCONS_00000233-exon-sc0000001-1575043694:2043697..2043840Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1575043694:2041724..2041759TCONS_00000233-exon-sc0000001-1575043694:2041724..2041759Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1575043694:2041336..2041458TCONS_00000233-exon-sc0000001-1575043694:2041336..2041458Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1575043694:2040027..2040138TCONS_00000233-exon-sc0000001-1575043694:2040027..2040138Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1575043694:2038823..2039031TCONS_00000233-exon-sc0000001-1575043694:2038823..2039031Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1575043694:2037832..2037937TCONS_00000233-exon-sc0000001-1575043694:2037832..2037937Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1575043694:2036582..2036934TCONS_00000233-exon-sc0000001-1575043694:2036582..2036934Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2050460..2050502TCONS_00000233-exon-sc0000001-1510915933:2050460..2050502Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2049312..2049525TCONS_00000233-exon-sc0000001-1510915933:2049312..2049525Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2048588..2048789TCONS_00000233-exon-sc0000001-1510915933:2048588..2048789Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2047363..2047548TCONS_00000233-exon-sc0000001-1510915933:2047363..2047548Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2046902..2047081TCONS_00000233-exon-sc0000001-1510915933:2046902..2047081Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2046150..2046329TCONS_00000233-exon-sc0000001-1510915933:2046150..2046329Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2045115..2045294TCONS_00000233-exon-sc0000001-1510915933:2045115..2045294Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2043697..2043840TCONS_00000233-exon-sc0000001-1510915933:2043697..2043840Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2041724..2041759TCONS_00000233-exon-sc0000001-1510915933:2041724..2041759Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2041336..2041458TCONS_00000233-exon-sc0000001-1510915933:2041336..2041458Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2040027..2040138TCONS_00000233-exon-sc0000001-1510915933:2040027..2040138Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2038823..2039031TCONS_00000233-exon-sc0000001-1510915933:2038823..2039031Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2037832..2037937TCONS_00000233-exon-sc0000001-1510915933:2037832..2037937Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1510915933:2036582..2036934TCONS_00000233-exon-sc0000001-1510915933:2036582..2036934Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2050460..2050502TCONS_00000233-exon-sc0000001-1491911889:2050460..2050502Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2049312..2049525TCONS_00000233-exon-sc0000001-1491911889:2049312..2049525Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2048588..2048789TCONS_00000233-exon-sc0000001-1491911889:2048588..2048789Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2047363..2047548TCONS_00000233-exon-sc0000001-1491911889:2047363..2047548Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2046902..2047081TCONS_00000233-exon-sc0000001-1491911889:2046902..2047081Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2046150..2046329TCONS_00000233-exon-sc0000001-1491911889:2046150..2046329Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2045115..2045294TCONS_00000233-exon-sc0000001-1491911889:2045115..2045294Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2043697..2043840TCONS_00000233-exon-sc0000001-1491911889:2043697..2043840Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2041724..2041759TCONS_00000233-exon-sc0000001-1491911889:2041724..2041759Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2041336..2041458TCONS_00000233-exon-sc0000001-1491911889:2041336..2041458Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2040027..2040138TCONS_00000233-exon-sc0000001-1491911889:2040027..2040138Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2038823..2039031TCONS_00000233-exon-sc0000001-1491911889:2038823..2039031Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2037832..2037937TCONS_00000233-exon-sc0000001-1491911889:2037832..2037937Clytia hemisphaericaexon
TCONS_00000233-exon-sc0000001-1491911889:2036582..2036934TCONS_00000233-exon-sc0000001-1491911889:2036582..2036934Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2036582..2050502 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.896959 0.387812 1.40467 0.572605 0.24934 3.02758e-09 0.373608 0 0.419118 1.18702 0.641197 0.249366 17.9702 22.2034 0.587045 0.53266 5.48426 14.3023 82.1173 83.1591 0.978011 7.72751 2.50707 2.74729 0.017093 0 0.425278 0 0.0175512 0.535073
Blast
BLAST of TCONS_00000233 vs. Swiss-Prot (Human)
Match: ATS9 (A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens GN=ADAMTS9 PE=1 SV=4)

HSP 1 Score: 120.939 bits (302), Expect = 7.640e-28
Identity = 114/361 (31.58%), Postives = 162/361 (44.88%), Query Frame = 3
Query:    9 QQSCNANVCPALWYVTEWTKCSKLCGSGTKTRKLYCSRIDGTGQRITVDDSEC-TGEKPEDVEFTSTCNVIACP--AYYVYGEWTQCSASCNGGKRSRSSICKHISEVGKLVTINVQACLYLGDPLVSETCNADIPCPEWKI-VYSECSKTCDGGIQTASVVCTDPDSGTQVDASTCDASKKPTVTDADSKACNEELCDPYVWR-EQDGVCSVTCGKGLLPITQVCFGRVEKKNVEESKCPSPKPKDPTPKECDAGAC---PETYSWKT-KFSECSVTCGTGTKTL-----EPYCVKDSDQSTSNEVLCDPAKKPGTSTEQCALGDCPIKYSWNT-EMSECSVTCGEGVKTASYKCVRSTD 1046
            Q++C +  CP  W    W +C+KLCG G +TR + C R +G        D  C   +KP D E    CN  ACP  A +  G W+ CS SC  G + R+  C  +++ G    +    C +L  P     C     CP+WK   +S+CS +C  G+Q   V C     GT   A   + +  P       + C    C  Y WR E+   C+ TCG+G      VC     K  V  ++C      D + +  D  +C   P  Y W T ++SECSVTCG G K       E Y  K++ + +    +  P  +P  S   C L DCP+  +W       CSV+CG GV   S +C+ + D
Sbjct: 1375 QRACESGPCPQ-WAYGNWGECTKLCGGGIRTRLVVCQRSNGE----RFPDLSCEILDKPPDRE---QCNTHACPHDAAWSTGPWSSCSVSCGRGHKQRNVYC--MAKDGS--HLESDYCKHLAKPHGHRKCRGG-RCPKWKAGAWSQCSVSCGRGVQQRHVGC---QIGTHKIARETECN--PYTRPESERDCQGPRCPLYTWRAEEWQECTKTCGEGSRYRKVVCVDD-NKNEVHGARC------DVSKRPVDRESCSLQPCEYVWITGEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQP-PSVHPCYLRDCPVSATWRVGNWGSCSVSCGVGVMQRSVQCLTNED 1709          

HSP 2 Score: 116.701 bits (291), Expect = 1.541e-26
Identity = 149/541 (27.54%), Postives = 235/541 (43.44%), Query Frame = 3
Query:   33 CPALWYVTEWTKCSKLCGSGTKTRKLYC---SRIDGTGQRITVDDSECTGE-KPEDVEFTS-TCNVIACPAYYVYGEWTQCSASCNGGKRSRSSICKHISEVGKLVTINVQACLYLGDPLVSETCNADIPCPEWKIV-YSECSKTCDGGIQTASVVCTDPDSGTQVDASTCDASKKPTVTDADSKACNEELCDPYV---WREQDGVCSVTCGKGLLPITQVCFGRVEKKNVEESKC-PSPKPKDPTPKECDAGAC------PE----TYS-----WKT-KFSECSVTCGTGTKTLEPYCVKDSDQSTSNEVLCDPAKKPGTSTEQCALGDCPIKYSWNT-EMSECSVTCGEGVKTASYKCVRSTDNAQVDDSKCE-----------------------GIAKPNIANEKCVEAACPPTYS-------WRKHNXXXXXXXXXXXXTQSGHCHRDEDGERMEESFCNVSQKPTTQTFSCHKEACKAPFYWKGNFGRCMATCGSGHKLKVLSCVERATGHVTENEKCKDA-AIPDDEQCTMEPC 1481
            C   W+V   ++CS  CG G +T  +YC   SR+DG  ++  VDD  C+   KP + E  S  CN       + Y  WT+CS SC+GG + R +IC +     +   ++   C +  + +  + C ++ PCP+WK   +SEC  TC  G +   V C   +   +++   CD   KPT      + C +  C  +    W    G CSVTCG+G       C        V+++ C  + +P D   ++C+  +C      PE    TYS     W+   ++ CS TCG GT+     C +D + S ++E  C    +P  + E+C++  C     W   + S CSVTCG+G  T    CV  +D+  +D S+C+                       G+A+    NE     +  P+ +       WR        S  +G   +     +DE+G    +  C    KP  Q  +C    C  P +  GN+G C   CG G + +++ C +R+ G    +  C+     PD EQC    C
Sbjct:  935 CDLRWHVASRSECSAQCGLGYRTLDIYCAKYSRLDGKTEK--VDDGFCSSHPKPSNREKCSGECNT----GGWRYSAWTECSKSCDGGTQRRRAICVNT----RNDVLDDSKCTHQ-EKVTIQRC-SEFPCPQWKSGDWSECLVTCGKGHKHRQVWCQFGED--RLNDRMCDPETKPT----SMQTCQQPECASWQAGPW----GQCSVTCGQGYQLRAVKCIIGTYMSVVDDNDCNAATRPTD--TQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGSWTPCSATCGKGTRMRYVSC-RDENGSVADESACATLPRP-VAKEECSVTPCG---QWKALDWSSCSVTCGQGRATRQVMCVNYSDHV-IDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYTAND--CVERIKPDEQR-ACESGPC--PQWAYGNWGECTKLCGGGIRTRLVVC-QRSNGERFPDLSCEILDKPPDREQCNTHAC 1439          

HSP 3 Score: 116.316 bits (290), Expect = 2.047e-26
Identity = 130/442 (29.41%), Postives = 192/442 (43.44%), Query Frame = 3
Query:  240 YGEWTQCSASCNGGKRSRSSICKHISEVGKLVTINVQACLYLGDP-LVSETCNADIPCPEWKIV-YSECSKTCDGGIQTASVVC---TDPDSGTQ-VDASTCDASKKPTVTDADSKACNEELCDPYVWREQDGVCSVTCGKGLLPITQVCFGRVEKKN--VEESKCPSPKPKDPTPKECDAGACPETYSWKT-KFSECSVTCGTGTKTLEPYCVKDSDQSTSNEVLCDPAKKPGTSTEQCALGDCPIKYSWNT-EMSECSVTCGEGVKTASYKCVRSTDNAQVDDSKCEGIAKPNIANEKCVEAACPP---------TYS-----WRKHNXXXXXXXXXXXXTQSGHCHRDEDGERMEESFCNVSQKPTTQTFSCHKEACKAP--FYWKG-NFGRCMATCGSGHKLKVLSCVERATGHVTENEKCKDAAIPD-DEQCTMEPC 1481
            +G W  CS  C G +R R  +C   S+    +T++ Q C  L  P  ++E C  D     W +   SECS  C  G +T  + C   +  D  T+ VD   C +  KP+  +  S  CN        W E    CS +C  G      +C   V  +N  +++SKC     +  T + C    CP+   WK+  +SEC VTCG G K  + +C    D+   N+ +CDP  KP TS + C   +C    SW      +CSVTCG+G +  + KC+  T  + VDD+ C    +P    +  + +  PP         TYS     WR  + +   +             RDE+G   +ES C    +P        KE C       WK  ++  C  TCG G   + + CV   + HV +  +C    IP+ D+ C+M PC
Sbjct:  884 HGPWQACSKPCQG-ERKRKLVCTRESD---QLTVSDQRCDRLPQPGHITEPCGTDCDL-RWHVASRSECSAQCGLGYRTLDIYCAKYSRLDGKTEKVDDGFCSSHPKPSNREKCSGECNTGGWRYSAWTE----CSKSCDGGTQRRRAIC---VNTRNDVLDDSKCT--HQEKVTIQRCSEFPCPQ---WKSGDWSECLVTCGKGHKHRQVWCQFGEDRL--NDRMCDPETKP-TSMQTCQQPECA---SWQAGPWGQCSVTCGQGYQLRAVKCIIGTYMSVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGSWTPCSATCGKGTRMRYVSCRDENGSVADESACATLPRPVA------KEECSVTPCGQWKALDWSSCSVTCGQGRATRQVMCVN-YSDHVIDRSECDQDYIPETDQDCSMSPC 1295          

HSP 4 Score: 113.62 bits (283), Expect = 1.640e-25
Identity = 132/494 (26.72%), Postives = 197/494 (39.88%), Query Frame = 3
Query:   45 WYVTEWTKCSKLCGSGTKTRKLYCSRIDGTGQRITVDDSEC-TGEKPEDVEFTSTCNVIACPAYYVYGEWTQCSASCNGGKRSRSSICKHISEVGKLVTINVQACLYLGDPLVSETCNADIPCPE----------------------------------WKI-VYSECSKTCDGGIQTASVVCTDPDSGTQVDASTCDASKKPTVTDADSKACNEELCDPYVWREQDGVCSVTCGKGLLPITQVCFGRVEKKNVEESKCPSPKPKDPTPKECDAGACPETYSWKTK-FSECSVTCGTGTKTLEPYCVKDSDQSTSNEVLCDPAKKPGTSTEQCALGDCPIKYSWNT-EMSECSVTCGEGVKTASYKCVRSTDNAQVDDSKCEGIAKPNIANEKCVEAACPPTYSWRKHNXXXXXXXXXXXXTQSGHCHRDEDGERMEESFCNVSQKPTTQTFSCHKEACKAPFYW-KGNFGRCMATCGSGHKLKVLSCVERATG 1409
            W    WT CS  CG GT+ R + C   +G+      D+S C T  +P   E    C+V  C  +    +W+ CS +C  G+ +R  +C + S+      I+   C     P   + C+   PCP+                                  W+   +  CS TC GG Q   VVC D +  T   A+ C    KP     + +AC    C  + +    G C+  CG G+     VC  R   +   +  C     K P  ++C+  ACP   +W T  +S CSV+CG G K    YC+   D S      C    KP     +C  G CP    W     S+CSV+CG GV+     C   T      +++C    +P  +   C    CP  Y+WR                       D++   +  + C+VS++P  +  SC  + C+  + W  G +  C  TCG G+K +++SC E  TG
Sbjct: 1186 WRFGSWTPCSATCGKGTRMRYVSCRDENGS----VADESACATLPRPVAKE---ECSVTPCGQWKAL-DWSSCSVTCGQGRATRQVMCVNYSDH----VIDRSECDQDYIPETDQDCSMS-PCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYT---ANDCVERIKPD----EQRACESGPCPQWAYGNW-GECTKLCGGGIRTRLVVC-QRSNGERFPDLSC-EILDKPPDREQCNTHACPHDAAWSTGPWSSCSVSCGRGHKQRNVYCMA-KDGSHLESDYCKHLAKP-HGHRKCRGGRCP---KWKAGAWSQCSVSCGRGVQQRHVGCQIGTHKI-ARETECNPYTRPE-SERDCQGPRCP-LYTWRAEEWQECTKTCGEGSRYRKVVCVDDNKNEVHGARCDVSKRPVDRE-SCSLQPCE--YVWITGEWSECSVTCGKGYKQRLVSCSEIYTG 1645          

HSP 5 Score: 107.457 bits (267), Expect = 1.288e-23
Identity = 134/509 (26.33%), Postives = 200/509 (39.29%), Query Frame = 3
Query:    3 VTQQSCNANVCPALWYVTEWTKCSKLCGSGTKTRKLYCSRIDGTGQRITVDDSECTGEKPEDVEFTSTCNVIACPAY---------------------------------YVYGEWTQCSASCNGGKRSRSSICKHISEVGKLVTINVQACLYLGDPLVSETCNADIPCPEWKI-VYSECSKTCDGGIQTASVVCTDPDSGTQVDASTCDASKKPTVTDADSKACNEELCDPYVWREQDG---VCSVTCGKGLLPITQVCFGRVEKKNVEESKCPSPKPKDPTPKECDAGACPETYSWKT-KFSECSVTCGTGTKTLEPYCVKDSDQSTSNEVLCDPAKKPGTSTEQCALGDCPIKYSWNT-EMSECSVTCGEGVKTASYKCVRSTDNAQVDDSKCEGIAKPNIANEKCVEAACPPTYSWRKHNXXXXXXXXXXXXTQSG-HCHRDEDG-ERMEESFCNVSQKPTTQ---TFSCHKEACKAPFYWK-GNFGRCMATCGSGHKLKVLSCV 1394
            V ++ C+   C   W   +W+ CS  CG G  TR++ C           +D SEC  ++    E    C++  CP                                   +  G W  CS++C GG + R  +C+   E G         C+    P     C +  PCP+W    + EC+K C GGI+T  VVC   + G +    +C+   KP     D + CN   C P+      G    CSV+CG+G       C  + +  ++E   C     K    ++C  G CP+   WK   +S+CSV+CG G +     C +      + E  C+P  +P  S   C    CP+ Y+W   E  EC+ TCGEG +     CV    N +V  ++C+ ++K  +  E C    C   Y W     S           Q    C     G E  E S+      P TQ      C+   C     W+ GN+G C  +CG G   + + C+
Sbjct: 1229 VAKEECSVTPC-GQWKALDWSSCSVTCGQGRATRQVMCVNYSDH----VIDRSEC--DQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQ--DENG----YTANDCVERIKPDEQRACESG-PCPQWAYGNWGECTKLCGGGIRTRLVVCQRSN-GERFPDLSCEILDKP----PDREQCNTHAC-PHDAAWSTGPWSSCSVSCGRGHKQRNVYCMAK-DGSHLESDYCKH-LAKPHGHRKCRGGRCPK---WKAGAWSQCSVSCGRGVQQRHVGC-QIGTHKIARETECNPYTRP-ESERDCQGPRCPL-YTWRAEEWQECTKTCGEGSRYRKVVCVDDNKN-EVHGARCD-VSKRPVDRESCSLQPC--EYVWITGEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYLRDCPVSATWRVGNWGSCSVSCGVGVMQRSVQCL 1705          

HSP 6 Score: 103.99 bits (258), Expect = 1.362e-22
Identity = 138/534 (25.84%), Postives = 210/534 (39.33%), Query Frame = 3
Query:    9 QQSCNANVCPALWYVTEWTKCSKLCGSGTKTRKLYCSRIDGTGQRITVDDSECTGEKPEDVEFTSTCNVIACPAYYVYGEWTQCSASCNGGKRSRSSICKHISEVGKLVTINVQACLYLGDPLVSETCNADIPCPEWKI-VYSECSKTCDGGIQTASVVCTDPDSGTQVDASTCDASKKPTVT-DADSKACNEELCDPYVWREQDGV------------CSVTCGKGLLPITQVCFGRVEKKNVEESKCPSPKPKDPTPKECDAGACPETYSWKT-KFSECSVTCGTGTKTLEPYCVKDSDQSTSNEVLCDPAKKPGTSTEQCALGDCPIKY-------------------------------SWNT-EMSECSVTCGEGVKTASYKCVRSTDNAQVDDSKCEGIAKPNIANEKCVEAACPPTYSWRKHNXXX-XXXXXXXXXTQSGHCHRDEDGERMEESFCNVSQKPTTQTFSCHKEACKAPFYWK-GNFGRCMATCGSGHKLKVLSCVERATGHVTENEKCKDAAIPDDEQ 1463
            ++ C+       W  + WT+CSK C  GT+ R+  C       +   +DDS+CT ++   ++    C+   CP +   G+W++C  +C  G + R   C+   +      +N + C     P   +TC     C  W+   + +CS TC  G Q  +V C      + VD + C+A+ +PT T D +  +C+     P   R                 CS TCGKG       C  R E  +V +    +  P+    +EC    C +   WK   +S CSVTCG G  T +  CV  SD    +   CD    P T  + C++  CP +                                 W T     CS TC  G   +  + V   D      + C    KP+     C    CP    W   N    +  CG GI T+   C R  +GER  +  C +  KP  +   C+  AC     W  G +  C  +CG GHK + + C+ +   H+ E++ CK  A P   +
Sbjct:  989 REKCSGECNTGGWRYSAWTECSKSCDGGTQRRRAICVNT----RNDVLDDSKCTHQEKVTIQ---RCSEFPCPQWKS-GDWSECLVTCGKGHKHRQVWCQFGED-----RLNDRMCDPETKPTSMQTCQQP-ECASWQAGPWGQCSVTCGQGYQLRAVKCIIGTYMSVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGSWTPCSATCGKGTRMRYVSC--RDENGSVADESACATLPRPVAKEECSVTPCGQ---WKALDWSSCSVTCGQGRATRQVMCVNYSDHVI-DRSECDQDYIPETD-QDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTCAGG---SQRRVVVCQDENGYTANDCVERIKPD-EQRACESGPCP---QWAYGNWGECTKLCGGGIRTRLVVCQR-SNGERFPDLSCEILDKPPDRE-QCNTHACPHDAAWSTGPWSSCSVSCGRGHKQRNVYCMAKDGSHL-ESDYCKHLAKPHGHR 1491          

HSP 7 Score: 103.605 bits (257), Expect = 2.110e-22
Identity = 98/317 (30.91%), Postives = 140/317 (44.16%), Query Frame = 3
Query:    9 QQSCNANVCP--ALWYVTEWTKCSKLCGSGTKTRKLYCSRIDGTGQRITVDDSECTG-EKPEDVEFTSTCNVIACPAYYVYGEWTQCSASCNGGKRSRSSICKHISEVGKLVTINVQACLYLGDPLVSETCNA-DIPCPEWKIV-YSECSKTCDGGIQTASVVCTDPDSGTQVDASTCDASKKPTVTDADSKACNEELCDPYVWREQD-GVCSVTCGKG----LLPITQVCFGRVEKKNVEES-----KCPSPKPKDPTPKECDAGACPETYSWKT-KFSECSVTCGTGTKTLEPYCVKDSDQSTSNEVLCDPAKKP 911
            ++ CN + CP  A W    W+ CS  CG G K R +YC   DG+     ++   C    KP        C    CP +   G W+QCS SC  G + R   C    ++G         C     P     C     P   W+   + EC+KTC  G +   VVC D D+  +V  + CD SK+P     D ++C+ + C+ YVW   +   CSVTCGKG    L+  +++  G   K+N E S      CP  +P  P+   C    CP + +W+   +  CSV+CG G       C+ + DQ +    LC    KP
Sbjct: 1431 REQCNTHACPHDAAWSTGPWSSCSVSCGRGHKQRNVYCMAKDGS----HLESDYCKHLAKPHG---HRKCRGGRCPKWKA-GAWSQCSVSCGRGVQQRHVGC----QIGTHKIARETECNPYTRPESERDCQGPRCPLYTWRAEEWQECTKTCGEGSRYRKVVCVD-DNKNEVHGARCDVSKRP----VDRESCSLQPCE-YVWITGEWSECSVTCGKGYKQRLVSCSEIYTG---KENYEYSYQTTINCPGTQP--PSVHPCYLRDCPVSATWRVGNWGSCSVSCGVGVMQRSVQCLTNEDQPSH---LCHTDLKP 1721          
The following BLAST results are available for this feature:
BLAST of TCONS_00000233 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ATS97.640e-2831.58A disintegrin and metalloproteinase with thrombosp... [more]
back to top