Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000219 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000219
Unique NameTCONS_00000219
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2938

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000219 ID=TCONS_00000219|Name=TCONS_00000219|organism=Clytia hemisphaerica|type=transcript|length=2938bp
ATGAACTATTTTCAGGTAAAATGTACATATATtacttaaatgaaaatatt
actACAAAATAGCAATCATATTTCTCAAGAATATCTAAACAAATTAAAAG
TACGTTTTAAGTCTGTTACCCCTTGCTCATAAATGATTTACGTAAACATT
GAAAAAAGCCGAACCAGCTGACATCAACGCAGTCGTTCGAGAAGGAAGGA
AAGAGCAAGTTGGGAGGAAGAcaaattttcgacattttttgagtgatatt
attcaaaaagaatatctttccaagtAACATAAAGAAGTCACAAAGATGTC
GACAAAAAGATCGAGAAATCTTCGCATCGCAGTCGTTTGCAGTAGTAACA
TGAATAGAAGTATGGAGGCCCACAGCTTTTTGAGTAAACGAGGATTCAAT
GTCAAGTCGTATGGCACTGGAAACCAAGTCAAGCTACCAGGACCATCAGC
TGACAGGCCAAATGTTTATCCGTTCACAACCCCATATGACCACATTTACA
GGGAACTCTACAGGAAAGACGCTCATTTATACAAACAGAATGGTGTTCTA
CACATGCTAGATAGAAACAGACGCATCAAGAAGTTTCCACAACGTTTCCA
AGATGAGAAAGAGGAAGAATTCGATCTTGTCATCACCGCTGAAGAAAGAG
TATACGATCAACTCGTAGAAGATTTCCAGCAACGAGAGGCGCAGTCATAC
ACACCAGTGCATGTCATTAACATTGACATCACGGATAACGCTGAAGAAGC
TACACTTGGTGCTTTCCAGATATGCGAGCTATGTGAAAAGCTTGAGAAAC
TTGACGATTTGGACGACGACATTGCAGAAACACTGGAacttttcgaaaag
aaaatccGTCGTCATTTATTGCATACTGTTGCTTTTTATTGATGCAATGA
GATGAGAATGTCGTGGTGAAAGTTGATGATGGAAACGTTTAAAATCCATT
TGAATGGTTTGGGTCTCATTGGTGATGATTAAAGAAAGATGACCACCGTT
CATGGTAAAATGTTGGACACAATGTTCAAACGAGAGGCTGTTGAGCCTGG
TTGTCTAACCGCCAGTTGATGATCTTCGCCTGTTTTAAAGGCTTAGAAGG
GATGAATATTGACGTTTGTGTTAAATAAAACGTGTATGTTACAATGAGGT
AAAGCAAAACATTGAGTTGGTGTTGGTTGCAAAAGAACATTGAATTTAAA
TTTAACAttgacagtttttttttttaaagaaaatttatcgTCTCAAACGG
AATTCGACAAATCTTCAAATGTTGATCatacaaaagtttttttcttcaat
gctaatacaccttttcgaccgtaaccgccaattgccgcgcaggcattttt
atcccactaaaaccgtcccagtccttttttcgcacataTAGAcgatagaa
aaatgtgtcaaaaaaggactgCGACGGTTTTAGTgagataaagcggacaa
aataatgcccgcgcggcaattggcggctacggtgtACGGAAGGTGTATAG
TCTTTCCATGGCGAGCATTTACCGGGAACTTGGGAAGGTTTTACAAAGGT
AAAGTAAAGTAATAACCCACATCTCTATCCGCTTGAGACATAAGTTTATA
AAAATTCAATATGGCGTAATGCTTATTATTCCCACTTGCCTTTATCTGCT
ATCTTTggtcggagttttttgaaaagttataaTACTTATCGATgtcaatt
tttgatttaatgaaTGAACGAACTTTcctgtttaaaattttttcaccCTG
TTTCACCCAAAGTGAGTAGTAAATGATACCATTACTGTCGTTTTGTATCA
TTCATTACAGTACCGCTTTTCTAGCGCAAAAAGACCAAGACTTCGGTTcg
ttgaaaaatgagcttcggaaagttaggcagttttGTGAGTatacacaaga
ttttccgtaacTTTAGAAACAAACCTTTTCCATCATCATGCCGGTTTTCC
CGGGAAAAAGGAAAAGTGTCTTGACATTTAGTGTGGAAATTataatctta
tacaaaacgaagGTAGGGCTATCCCTTTCGAAAAGCTCTGGCCAAAGATA
ATTTTGGCAACTGAGAAGCCTGTTCCGACCAGGGTTTTAAGGTCCGATTA
TATTCCCAGCAATATTATCTTACAAAAATTATTCTTTGTCACATTTCAAT
AATTTAAATCTTATGAATTTCATTTTGTAAGGTCAGATTATTCGGGTAAA
TTTAGATGAATGTTTAGatgctattcatgatattcatgtaCGGAAATATC
CcagttttagccagtagtgacAAATTTAAACTAGGCAAAAGTTGTATAAT
ATTTGCCACTGCTGGcgaaaaccggggtctttccgtagaaaacattacgt
cacgaaTATCATAAATAATCGAACGATAAAATATGATAAGGGTGTATCTC
CCGGTTCTTTCAACCCACTGGGTTGCAGTGACACTAGTTTTGGCCAGATT
AGATTTTGAACTTTCTGTAATGAAGCTTATATTCATTATTACACCCCTTC
TTACAGGCCCTCTGGGACTCCTTCCAACGGCCAAAATATCATTCTTGGTG
GACAATTACcatccaatttttgtccccgcacTGAATATAATCatataagc
aaatcctcactgcaaaatatttactattgtTCCCATcttcactgaatttt
ctgacttgaaaacaaaagaattgaaatccccagtcataaaaaatgTGAGA
ATATCAATTCCCACCGAGTTTTGGttcattatttttatccccactggctg
aaaaaatcctcaCAGTTCTgttgaagactttttttcttcactttataATG
TGTATGTCTTCAATTTTGGGATATTTTTGTATTAAGAACTTAAATTAATT
ATAGTGTATAATATAGAAAGAAGGCAATCCTCCTTTGGATCTACTTCAAG
ACCAAAGCATTTGTCAGAATTTTCCAAaccaattgaaa
Run BLAST on NCBI

protein sequence of TCONS_00000219-protein

>TCONS_00000219-protein ID=TCONS_00000219-protein|Name=TCONS_00000219-protein|organism=Clytia hemisphaerica|type=polypeptide|length=198bp
MSTKRSRNLRIAVVCSSNMNRSMEAHSFLSKRGFNVKSYGTGNQVKLPGP
SADRPNVYPFTTPYDHIYRELYRKDAHLYKQNGVLHMLDRNRRIKKFPQR
FQDEKEEEFDLVITAEERVYDQLVEDFQQREAQSYTPVHVINIDITDNAE
EATLGAFQICELCEKLEKLDDLDDDIAETLELFEKKIRRHLLHTVAFY
Run BLAST on NCBI

transcript from alignment at sc0000001:1605392..1630821-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000219 ID=TCONS_00000219|Name=TCONS_00000219|organism=Clytia hemisphaerica|type=transcript|length=25430bp|location=Sequence derived from alignment at sc0000001:1605392..1630821- (Clytia hemisphaerica)
ATGAACTATTTTCAGGTAAAATGTACATATATTACTTAAATGAAAATATT ACTACAAAATAGCAATCATATTTCTCAAGAATATCTAAACAAATTAAAAG TACGTTTTAAGTCTGTTACCCCTTGCTCATAAATGATTTACGTAAACATT GAAAAAAGCCGAACCAGCTGACATCAACGCAGTCGTTCGAGAAGGAAGGA AAGAGCAAGTTGGGAGGAAGACAAATTTTCGACATTTTTTGAGTGATATT ATTCAAAAAGAATATCTTTCCAAGTAACATAAAGAAGTCACAAAGATGTC GACAAAAAGATCGAGAAATCTTCGCATCGCAGTCGTTTGCAGTAGTAACA TGAATAGAAGTATGGAGGCCCACAGCTTTTTGAGGTATATTATTTTCTTT TTACACCACCAACCACCCGTTTTTATTTCCATTATTTTCATCTTATTGCT CCAAGAATACATATATTTGACTTTAAGAGTGTTCTTAATCCAAAGGGTAT GTACATATATATCTTCCTGTATATAGTGGATCTACTTCACTAATATGGAT TGTTATTATTTTATGGAATATTCACCTCTTTAACTTGATGTTTGACCAGA TGTTTGATTAAAATCACACATTTCGGTGTTTCTGTCATCTTTATGAATTT ATACGTCGTCAACTGCTCTTACTTGGGACTATCTGACAAGACATGGGTCT ATCTGACAAGACATGGGTCAACCATTCAGCCACCATTTTACCGAACCTCC AAAGTCATTTAATACACCTTCATCGGAAATTCCACAAAAACAATCGTGCT ATAAAATGGGTCTGTTGAAATTGGGAGGTAAACATAAATGGTAGCGCGAG TAAACAAAACAAAGCTTTCAAGATGCTAGCAGAAGCTATAAGAAAGAAAA AAACAACAACTTCGGTGGTTCTTCAGTTGATTTGGAGGCTCTTTTGGCAT CAATATTTTGGGTATTTTGTAAGGCTTTTTGCCTGAAAACCGCAATATCG CGCTTTGTTTACCTCCCAAAAAGTGTTGCGTAGCAACAACGCGAGGAGGT GGAATTTCCGATGAGGTGTATTAACATAACCGCAAATCATAGGTAGCAAA TAATGTGAATACGCTACTCACCAGGTAGGCTTTCACACCGCAAAAGGAAC AAATCTTTTTGATGAGAAACATGTAAATGCGATCGCGCACATTTGCGCAA GCGTCCAATTTGAAGCAAACTAGTGCTCTATCTTAGCTGGGTAAGGCCTG AGTCACATATAACTTGTGTTTGTGTCATTTCCAGCCCCAAAATGTGAGTC GGTCGGCATATAAAATCATCGGAAAAATACACTCTGAACATAGGTTGTCA GTTAGTGCTGGATTCATCGGAAAAATGCGCTCTGAGTATATAGGTTTGTT CAGGCGGCAAGTTATCATCAGGCGCACGAGCTGTAATATGATTATTTTAC ATATCGCGACCGCACAAAAAGCAGTTGCATAGCGCTTTTTAAGGCAAAAA ATCTTTGAAACATTGCAGACAGAAGTCTTAAAAACATTCAATGATCAAAA CGCCGGCTACGCTGAATCTACAAAATTCTTTGAATAACATCGCTGAAAAA TCCGACAGATCTTCCGACTTTCCGACTCTAAAAGGGTTTGATTTTTAACA TAGAAAGTGAGTCGGTCGGGCGACGCGAACACAACTTATTTGTGATCTTG GCCTAAACCAAAGTTTGGTACTGACAATTTGGTCAATCAAGATATTTTTT TTGCCTTGTTTTTCTCACCATGTCCAGTTGTTTTCTGATTGAAAAAATTG GCTCTGAACTGCTCGTCTCGTCGTCAACAGTATATTAAGGCAACAATTGC CTTGTCTTATCCAGAAATATTCCAATAATTATGTAAAAAAGGAGAAATTC CCCAAAATTGCTGGAGTTTCTAAATCAGGAAGCATTTTTACTTTTGGTAC GAAAGTTGGCTTTGAGCACTCCAAACACTTTGGCCATGGAATATAATAAT AATATAGTTTTACAAATTCGCAGGCCACTGATATAAATGACTCAATATTA TACCTTATAAATAATTAACATTCACTGGGTAGTTAGGAAATTCACTTTAA GCAGCACTTCTTAATATTTTTCCTATTTTGACTAGTAAGTTACTACTTAA CTACTAAGTAACTATATATTGGATGGAGATAAAAATACCATTCTATGCTA GAAATTTTCACAGTGCTCAGTATTTCCCAAGACAGTGAGTAAGGGCAAAA TAGATTTAACAAAACTGAAATCAGATGAGCTCAGAGTGAATTTGATATTT GGGTATGATCGCTGAATGCTGTTCTTTATCCTATAAATAGCCCAAAACTC CAATTAACAATCAAAAGCATCAATTTTGGATAGATTGCTGTGGTATAGCC ACTTTTTATCGAATCAATTTTGATGCGTGCAATTACGACTATTATAAGAA AACTCATGCTTTTGATAAATCTGCCAACCTACTCATAGGTCTTTAATATA TGTAGTTGATATTCTTTACAAGAAATCTCTATCCCTCAGTTTTTATAGAA TGAAAATATACCATCAACTGCTCTGATTTGGGACGATTGGTCGAAACACG GGACTGTTGATATCTGGCCTGTATTTTCAATTACTGTTANCATATTAAGG CAACAATTGCCTTGTCTTATCCAGAAATATTCCAATAATTATGTAAAAAA GGAGAAATTCCCCAAAATTGCTAGAGTTTCCAAATCAGGAAGCACTTTTG GTACGAAAGTTGGCTTTGAGCACTCCAAACACTTTGGCCATGGAATATAA TAATAATATAGTTTTACAAATTCGCAGGCCACTGATATAAATGACTCAAT ATTATACCTTATAAATAATTAACATTCACTGGGTAGTTAGGAAATTCACT TTAAGCAGCACTTCTTAATATTTTTCCTATTTTGACTAGTAAGTTACTAC TTAACTACTAAGTAACTATATATTGGATGGAGATAAAAATACCATTCTAT GCTAGAAATTTTCACAGTGCTCAGTATTTCCCAAGACAGTGAGTAAGGGC AAAATAGATTTAACAAAACTGAAATCAGATGAGCTCAGAGTGAATTTGAT ATTTGGGTATGATCGCTGAATGCTGTTCTTTATCCTATAATAGCCCAAAA CTCCAATTAACAATCAAAAGCGTCAATTTTGGATAGATTGCTGTGGTATA GCCACTTTTTATCGAATCAATTTTGATGCGTGCAATTACGACTATTATAA GAAAACTCATGCTTTTGATAAATCTGCCAACCTACTCATAGGTCTTTTAT ATATGCAGTTGATATTCTTTACAAGAAATCTCTATCCCTCAGTTTTTATT GAATGAAAATATACCATCAACTGCTCTGATTTGGGACGATTGGTCGAAAC ACGGGACTGTTGATATCTGGCCTGTATTTTCAATTACTGTTAAATGTCTT TGACAACAAATTTGTAACTCCACCAAGTTTATCAATCATACTTTCTGTCA TAACATGTCACAATAACTTTCACTGATAGTGCGACCTTTTAACTTTTTTG TTTTCATTCAAAATGACCGAACGTCGATTGGAGAATTAGAGAATGCCTGC TGCCTATCGCCCGATGGGATTAACAAATAATGAGTTTGTAAATTGCCGCG CGAGTGACGTTAAACACCCCATCGTTTTGCCACTAATTTGGTCTTCTTCT TTCCAGACATTGTGTGTGATTTTTTTCATATTTCGATTTAAAAGCCTACT CGGTGGGAAAGAGAAATCATGTATTTTTTAATACGCCATTCATTAACTCA AATCAAATGACTTTGGAGGTTCGGTGAAATGGTGGCCGAATTGCCGTCCC ATGTTCTGTTAGATAGTCCCAAGTTGGAGCAGTTGACAGTAATTAATGCG CAGCATTTTACGAAGAAGAATTGATACGCCACATTTCCAATTCTGCTATC TTTACTTCTGCCCTCTTTTTTCTGCCTTTTTAAGTATCACGCTAGATCTA CATCACACCATTATGTCAAAAAAAATTTAGAATCTCGTTATACCAATAGC AGCCAATAGAATAGCCCAATTTATGCAAGCCACCAAGTCTTAAGGACCAA TTTTAAAATTATTCCTTGTTGTAACCACCTCGTAATTCACTAAGTCCTAA CCAATTTTTGTGTTGCAACCTCGTTCTTCTTGCTGAATAAAATTCTGAAA ATAAAGCTAAATTTTATGTTGTTTTATATAGTGTTTTAAAATTAATATAA TTCAGAAAACATACAAAAACCCTTTGGATTAATACATAGAAAAAAATTCT TAAAGTTAGAAAAAATCAGNATAGCCCAAAACTCCAATTAACAATCAAAA GCGTCAATTTTGGATAGATTGCTGTGGTATAGCCACTTTTTATCGAATCA ATTTTGATGCGTGCAATTACGACTATTATAAGAAAACTCATGCTTNTTGA ATATTAAGCATGAATAAAAAATCAGCTTGGTTAGTATGGGTTAGTTTAAT CTTAGACTTGCAAAATTAACAATCTGTTTTTACTTTATTTTTTGTAGTAA ACGAGGATTCAATGTCAAGTCGTATGGCACTGGAAACCAAGTCAAGCTAC CAGGACCATCAGCTGACAGGCCAAATGTTTATCCGTTCACAACCCCATAT GACCACATTTACAGGGAACTCTACAGGAAAGACGCTCATTTGTATCCTCC TCCATTGATCAGTTCAAGTCCTTTTCCATGATTGAATTTTGTTCATTTCA TGAACAATTTTGAATGGTATGGAGGTTAAAATCAGGTTTGCATACACTAT GTGCTTAGCCAGGTTAAGTCAGTCAGTTAGTAAGGTCAGGAAAAGAATTT AAAGTTTTAAAATTCAAGAAGTAATGCTGTGATTCTCAAGGAATGCCTGA CAGGTAAATTCGGAGAGATGGTGTTTTGGACTCGTCTAATGAATAAATAC TAATTCATGATATGCACCACTGGAGGGTCTTCTGAGAACTTTAAAATTTT CCACCCAATACGTCACTTAAACAATAGAAAAAGTGACGTATTGGGTGGAA CAAAAACAGAAAAGTTGCATAATTTCNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNGCATAATTTCGTGAAGTCATTGCAGTGGTGCATA ACATGAATTGTTTACTCGTTAATGTTCTGTTCAATATAGTATATGGCCTT ATATTTGGTAATCGGAATGGTATCCCTATGTCTAAAGAATTTAGAATTTT CACCACCGAAGTACAGTAACTGCTGTTACCACAGCTTTTATTTGACGTGT CCAAGCAAAGAAAAAGGTAAGAACGAACCTTCTTTGTTCTATTTTCTAAC GTTTGAGATATATTTCATAAATATTTTTTTTGCATTTTTCAATATTATTA TATGAATTTTACTGTGTCTGTTGTTTTGCACTCTGACAATATTATTCCTA ATGTTTCCCTATTCTATTGAATGTGTGAAATATATCCAAAATAAAATGAT TACAAAAATTTATTTGTTTGGTTGTTTTCTGTGTCAATTCTTTTTGTCTG GCGTTTCGATTGATACTCTAAAAATGCCTGTCTTAAATTTCTAATTTCTT TCGATCTGAATTTTATTTTCTAAATATTTCAGCTGAACTTTTTTAATTTA TTCTCGGCTATATTTAACCAGAGATCTGATTCAACACTAAACAGCAAAAC ATCCCTTTTTGAGTAGAAAGATTCTTTTGTAAGAGGCCTTTCTTGACTTT TCAACGATATGGCTTTTATTTTCATCAAAAACATCGAACGCTTTTGACCA AATCTAGAAAATTGTTACGGTTGATTTTTCTTGATATCTAACAAGCAACT CTTGTTATTACTTTGTCACTTTGGATCATACTTCTTTCTTCTTTTGGTCT AGTTCCATCTGACTAGATATAATTTTTACCCTCGTTTGCATTTTTTAAGA AGTCTTACTGAATGATGCGCGTTTGTTTGATAGCCCTTTTATTACGTATT TTTGGAGCTTTATAAAAACGAAGTGAGTGATTCCAATCTGGAGAATATTT TTTAATGAAATGTATCATAGAAAGTTTGCTGAAGTCTACCGATTTTTGTC TTAAAAAATGGGTGTAATTTTCAGGGCTTGGGATTATATATAGTGAAGAT ATAATATCTGTCATTGTAGAAAAAGAAAAGTATTGATATATAGATAACTC AAACTGATAAAAACGAAAAAAGTGACGAATATTTTTGTTAATTATGTATA TTTACGAATATTATATGCATCCTTATACACAGGAAAAAATTAGCATATTA CAAGTTTCTGAAACGTCGTTTCCGGCCCTTAAAAATCGGATTTTCAAAAT TTAGTTTGAAATAAAGTTTGTGAACATTGGGTTTTCTTATTTCACATTGA AATTTTCTTTTCACAATTTAAATAAGCATTTTTTCAGCCTTTTCAACCCT GGGCCTAAGCATCTTCGAGCCTGTTTCCGAATTTTTTTATGCTTATGAAA TAAAAATATGTACTATGCTTTGGGTTTGCAGAGGTATGCGCAATAGTGCT AGACAAAACCCGAAAAAGTCGTCGTTTCTGAAACCCTAGATAAGCTTAGA ATAGTAATTAATTCTCTTGAAATTCGTCTGATGTACGTACTGGGTCAGTA CAAAAAACATCTTAAAACGGTTTTACGAAGATTTGGTTTTTCGTTTTTCT TCAATGAAATTTCGAGGCTGAGCTCTTCTCACTTTTTTGATTGAGAGAAT TAGTGAACTAATGAGAGAATAAGTTATTTTGCGAGAAATTTGACTGAAAG GAGGGAAAATTGTTGTTTTTTGGCAATTATTAATTTGACGAGTGAGGTGA ATTTAAAGGTAAGTCCCTCCCTTAACAGTAAACATAAAATGACAGTGCCA ACAAAGTGACGCTCGACATTCAAAAATACCAAATGGGGGTAAATTTGGGC CGAAAAATACATAGAAATATTTTTTTGACTTTGTATATGAAAAAGCCTCA TTAGTTTGTACGCCTAAAGTAGCCCGACTTTCGAAGAAAAAAAACTGCAT ACAAATGGGATATTTAGTACTTCGTGCAAAATTTCTTCATCAGCGTTTTC TAATTTCTTCTAAATACAGAAGGCAAGGTTCTCTAAAAGCTGACTTTTAC CGTTTTCCCCGGAAAGTCTTTTAGCCGTAACCCAAAACCAAGTTTCTTGC CAAAATTAAGCATGTTTTTTATCCAAAAAATCATTTTATATGGCAGGCAA TATCACCTCTAAAACATCTGAAATCCAGCTTTGAAACAAGTTTTTCATTC TTCCGCGCCTCTGTGATATGCTGTTCTGTCTTTCCTTTTTCGTTAAACAT TTTGATCACCATTCAGCATGTTGCTGTTTTTCCTTACCGGGGTGTTTACA CCACTCTACCACTTTTGATCTACCTTAATAAATATTTTCTACTTGGTGAC GTCATTGAAAATGACACCTGTCAACTACTTAACTGGAGAGAGAACCCGTA CCTGAGAGAAAATCAATTCAAAGTAAATTAGAAGAAATTTTGGAATTCTG TTTTGAATATGGTTTGAAATTTCGGTGTATGGATTCTGGTACTTATATCG TGAATGAGATCTTTATTGTATATTTTATTATATATTGAATATTGCTAAGA TTTGTAACATTTTGTGTGTAATATTCTTTGCTGTGGATACGAACTTTAAG ACACGAAGATTATAAGAAGAAAACGTGTTGCAGAGATGAAGTTATACGCG TCACGAAGAACTTAAACTTTAATAATGGTAACTATAATTTGTTTATTATT TCATTTTTGCTTAAATCCCTAGCCTGTACCAAACTGAATTATTCAGCACC TGACGCAATTATAAAGGTTTCTCTTACTTCATACCGGCTATCTATCTCTC CAAAATCAGTAATCAAATTATTTTTCGATTGATGTTACTTATACGTCTGA TTGAATGAAAAGGTACGAACCTTGGTGAGGCCGCTGACATCTACTAAAGG ATTCGTGCTTTCATAGATTAGAATAGAGAATGTTTATATACTACCGTTTT CGTAGAGTTCTGTAATTAGGCTAATCTATGGTACTAAAACCATTTAACAT ATGAAGCACTTATATCGATGGTCATTTTTTGATAGTATCATCGATGATAG TATATATCTTTTGATTGCTCTTTGAAAACTTTCTATTTATACTCTGTAAT TTTAATTTCAAAACAGCTAACTAAATATTGCCGAGAATTCGTACAAATCA TAGTGATACTTCTATGGGCTTAAATCTTGCAAGACCAAACGTTTTTACGA ACTTTTGCCGTTTTTGCACAAATACTTTAGGCGTACAAACTTTCGCGATT TTAACGAAAAATATTTTTCGCGAGCATAAACTTTCGCGAATCAAGACGTA GAATTTAGAATTTTCACATGAAAAAATGACTTAGTGGGACAAATACTTCT TGGATTGGCTTGAAACATTTTTCCTTTGACTCATTAGTCTTTTAGCAGGC TAAAAAGTGCCATAAAAGCTACATTTTATTCAAACTTTGAGGTTTTATAC AGATTTTCTATTACAGTATGTCAAGAATATTTCGCGAGCATAAACTTTCG CGAATGGCCCTTCCTAGAATTTTTAAAGACATTTAATTTACTTTCACGAA AATCGCGAAAGTTTCTGCTCGCGAAAGTTTGTACGCCTAAAGTAAGAAGC ACAGGATTTCAAATAATTTGAGGTATTTACGAGCGCGCGGAATTTTATTC AATAGACTATATGACCCCCTATATCGGCTTTACATGAAAACTCAGTTTTG ACCTCCGAGAATTCCCCACAATGCTTTGCGTGGAAAGAATTTCACCGTGA ACTTTTTTCCGCGCAAAGCATTGTGGGCAATTTTCGGAGGTCAAACCTGA GTTTTCACGTTAAGCCGATATCGTCTTTTAGAAAGAAATTGTGATGGATT TAAAAGACATTTTTGCTAATACTTTTCATATAAGATACTTTGAAGTTTCT GGCATTTTACGGGTAATGTCATTATAAGTTACCATAGCTACTAAAATATT TAAAGGTAATTAAAATTCGTTGACAAATTCATCGCCAAAAAATTGTCACT TTTTGCCGACGAATAGTTCTTTAACATAGTAACNCAATTCATTGCCAAAA AATTGTCACTTTTTGCCGACGAATAGTTCTTTACCATAGTAACGTCGGCT TTTTAGAGGAAAAAACCTTTTCATAAATTACGTCACGAACATCGATTGCC TCGTTTTGAAATTATTGCCATGGTGATCAACTCCCAGCGGATTTATATTA AGACTACTTTCTATTCATAATAAAAGCCATTTAATGTTTCAAGCGAAGGG ACATAATCACCATGGTAATTGTTTGAATACGAGGCAAATGATGTTCATGA CGTAATTTATTTCGTAAACAAATAACTTCATTGGCAAAATGTAATGGTCG GTCAAAAATTCTCAGCTTTGAGTTCGTCGGTCAAAATTTTTCACATTTAC GTCTTTGTTCACGCGAAATTTTCAAAACTTTTTTTTTTGCTTTTTCGTAA AAACCACTCAAAAGTAATAAAGGTAGTTACTTTGCTTAAAAAAAGTTTCA GTTTCCTTTTCAGCTGATTATGCAAAATTCTTGGCTCAATAAATTAAATC TCAGGAAGTCGATTAACGTTCGAGCTTCCTATTTTCGAACATGGCATCTT GCTCGAAGTGGGTAGATTAATCTTTTATTATAAGCAACAACTTTATATAA GAAACCAATCAGTAACTTTGTTACATCAGCGATTCTTCGAACTGAAAGCC CGGGGGGGTACTTAGGCAAAAATAGGTGCTGGGTATGTGCGGACGGTAAG GGTCGGGTTTTCCACCTTTCAAAGTCTCTCTAAGGGTGGGAAAAATCACG ATTTTTAGAAAAAAAAATTGATTTTGAGAGAAAAAATTACAAAAAAGTCT CACTAAGGGTAGAAAATTTTTGAAAATCAGAGAAAATTTTTCGAAAAAGT CTCTCTAAGGGTCACTTTTTCACTAAAATTTGGTCTCTCTAAGGGTCGGT TTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCC CCCGGGACTGAAAGCGATCGTATTCACTTTTCTTATAAGCATCAATTACT AATTTATAACTTTATAACAAATAAAAGAACTTTTCGTTGATATCTTCCTT CAATCTTTCAAAGCAAATATGAAGATGAAATTGGCTAACAACGAACGCAT TTTTATTTCTTATAAGCATCAGTTTTGAAGCCATTAGATGTTAACTTTTG AGTTTTAAGCCTTAAAATGTCCTCTTAACATGTTCTTATTCTCACCATTT TGTGAGTCCATTTTCTTAAGAAATTGGGAGTAGAGTCTGCAAAGCCTTAA AATGTTCCTTAAAATAACTTGTTCTTAATATTTTGGTTATCGAAGCCCTA GTTTATTTTTAGAAAAAATGTAGGAGAGAGATAAGGCATAAGAAGGAAAG GCTTTTCAACTTTTAAGGGCTGGTCATGGCTGAGTTAATTATCTATTTTT TTGCACCATAAAACTTATGACTAAAAGCGAATTCTTCTCATCGGTTCAAA AGTTAATGATGACGTTTCTTATGAAATTGATTCTTAAAAAACAAACGGAA TGGAAATTCTTATTAATTTGAAATATATGAATAGGCTTCATTGAGGTACA CCATTGATAAAAAAGACGATGGTCTCACACATCTGAGCAGGAGACAAGTA CTTGGATATCTGCGTACATCAAGGTCCGTTCCCACGAATCAAATGATCGG TTATCGCGATAAGCTAGCCTCTCAATTAAGCTAATGTTTTCACCCAATGT TTGTTTAACGATATCTTGTTAATGATGTCAAAGTCTGAATACCTCTTTTG TTGAGTGGAAGTTGAAATTTCCTGCCGAGATTTTGCGTTTTTTGTGTCAT AAGACACATAAGGATAAAGTTATTTTTGCCATTCTCGGCCATTCTCAGTA TGGGCTTTTCCAGAAAAAATTTGAACAAGGGGTGGAGGATATAATAATTT TCAGTGACTTACCCCCCGGACAAAGTGACTTTTGGACCCCCGGACAACGG GTTTTACCCCCTGGACAAGCATCAGTTGACCACCCGGACAGAGAAAATTT ACCCCCCGGACAAGGCAAATGTTGATGATTTTTCACTACCCCCGGACATT AAATCGTCCACCCCCCACGTACGGACATGTTCTGGAAGAGCCCTGTGCGT AAATTGAAAAAAACCTTTTTGAGCTTCAACTTATTCACTTACCTTAATGG TATTAAATTTCGCGGGTTATAGCGAAATTTTTTCGAGGAAACGTGTTTCG TGTGTATTAAATTTCGCGATTCACTAAATTGGGCATTTTCAAAAAGTGGG AATAAAGCAAGAAAATGACTGATTTCGCTTGAAACACAACGTATTAGGTG TAAACATAACAAAAATAGTAACAAAACTAGTGACAAAAATTATCGAAAAT ACTTATTTGTTACACTTAGTTACTATAATAGTAAGGGTAAGAAATAAGTA TTTTCGATTTTCGGCCTATTTTAAAAATCTTTCGCGTGCATTTAATTTTG CGATTTTGTATTTTTGAAAAATTTAAACGGTATTAAATTTCGCGAAGTTT GACTTAAAAATCGCGAAATTAAGTACCCGCGAAATTTAATGCCAATAAAG TGGAGTGAATTCCTATCTGTGTTTTTTATCTTGTCGAATTTTTTTAATTT GAAAATATTCTCAAAATTTGTATGTATTTTTACAAACCTATTGCCAAATG TATATGAATATACATTGAAGTTTAAGTAATCAGCAAACGGGATTCTTCAT GCCAACTGGTTCAATATGTTGTGCCAAAACTTCAGAATACCGTAAGAGCG ATACACAGGGTGTCCAGAAAAAAGTCAAATATTAAAAAACGGACGCAGAC GCGTTACTTTCTTTTTCATTTGTTCTAATACGCAATAATGCAAAGCACAC AAAAAAATCTCCACTCAACGAAATGGCAATGATTGAATTATCAAAGCTTG TATTGTATTTGAAAGAAAGCGCATAAGATGTGATACTGACTTTATTGCTA TGGAGATACATAAACATTCCTCGTTACAGCTATGCATCTTGCAGCAGAAA ACGTCGAAATTATACCCAAACAAACCCCTAAAGATTGATCCTTCCGTCTT TTGCCTTTGATTTTTTTCATTTGAAAGCTTTTAAATGATCACTAAATTCG ATATCGAATTTTGGTGTCTGTAAACATCACAAAAACTAGTGAACTTGCGA GAATGTTCACAACTTCAGTTTCATTTAATAACTCTCCCAGTCTTTGATAA AAGCCTTGATAAAAGTTTGGAATTATAATTTACAATGCTTGCAGAAAATT TCAAGTGGCTTGGCTGAAAACTAGTGGGTTTTAAGCAATCAAAAACTCTC CAGTTTTACGTGAGGTTTAGCAATCACTGCATTCGAAGGACGTAACAAAT GTCAATGTCGAAACTAATGTAAGTAAAAAAAGTTTGACTTTGATGATTCT TGAGAATTGTTTGATGGCTCTGGTAACTCTTGAGAAGGATTTGCTGGCTC TGGTGATTCTTGAGAATGATTTGATGGCCCTGGCGATTCTTGAGAATGAT TTGATGGCTCTGGTGATTCTTGAGAAGGATTTGATGGCTCTGGTGATTCT TGAGAAGGATTTAATGGCTCTGGTGATTCTTGAGAAGGATTTAATGGCTC TGGCGATTCTTGAGAAGGATTTGATGGCTCTGGTGATTATTGAGAATGAT TTGGTGGCCTTGGTGATTCTTGAGAAGTTATTGATGGCTCTGGTGATTCT TGAGAAAGATTTGATGGCTCTGGTGATTCTTGAGAAAGATTTGGTGGCTC TGGTGATTCTTGAGAAGGATTTGATGGCTCTGGTGATTCTTGAGAAGGAT TTAATGGCTCTGGTGATTCTTGAGAAGGATTTGATTGCTCTGGTGAATTT TTAGAAGGATTTGATGGCCCTGGTGATTCTTTAGGAAGGTCTGATGGCCC TGGTGATTCTTGTGAAGGATTTGGCGGCCCTGGTGAATTTTGAGAAGGAT TTGATGGCTCTGGTGATTCCTTGGAAGAATTTGATGGCTCTGGTGATTCT TGAGAAGGATTTGAATGCTCTGGTGATTCTTGAGAAGGATTTGATGGCCC TGGCGATTCTTAAAAGGATTTAATTGCTCTGGTGATTCTTGAGAATGATT TGATGGCTCTGGAGATTCTTGAGAAGGATTTGATGGCCCTGGTGATTCTT GAGAAGGATTTGAATGCTCTGGTGATTATTGAGAAGGATTTGATTGCTCT GGCGATTCTTGAGAAGGATTTGATGGCTCTGGTGATTCTTGAGAAGGATT TGAATGCTCTGGTGATTATTGAGAAGGATTTGATTGCTCTGGCGATTCTT GAGAAGGATTTCATGGCTCTGGTGATTCTTTAGAAGGATTTGATGGCTCT GGTGATTCTTGAGAAGGATTTTTGTGACTCTGGTGATTCTTGAGAAGGAT TTGATGGCTCTGGTGATTCTTGAGAAGAATTTAATGGCTCTGGTGATTCT TGAGAAGGATTTGATTGCTCTGGTGAATTTTTAGAAGGATTTGGTGGCCC TGGTGATTCTTGAGAAGGATTTGATGGCTCTGGTGATTCTTGAGAAGGAT TTAATGGCTCTGGTGATTATTGAGAAGGATTAAATGGCTCTGGCGATTCT TGAGAAGGATTTGATGGCTCTGGTGATTATTGAGAATGATTTGGTGGCCT TGGTGATTCTTGAGAAGGTATTGATGGCTCTGGTGATTCTTGAGAAAGAT TTGATGGCTCTGGTGATTCTTGAGAAAGATTTGGTGGCTCTGGTGATTCT TGAGAAGGATTTGATTGCTCTGGTGAATTTTTAGAAGGATTTGGTGGCCC TGGTGATTCTTTAGGAAGGTCTGATGGCCCTGGTGATTCTTGTGAAGGAT TTGGCGGCCCTGGTGATTCTTGTGAAGGATTTGGCGGCCCTGGTGAATTT TGAGAAGGATTTGATGGCTCTGGTGATTCCTTGGAAGGATTTGAATGCTC TGGTGATTCTTGAGAAGGATTTGAATGCTCTGGTGATTCTTGAGAAGGAT TTGATGGCCCTGGCGATTCTTAAAAGGATTTAATTGCTCTGGTGATTCTT GAGAATGATTTGATGGCTCTGGAGATTCTTGAGAAGGATTTGATGGCCCT GGTGATTCTTGAGAAGGATTTGAATGCTCTGGTGATTATTGAGAAGGATT TGATTGCTCTGGCGATTCTTGAGAAGGATTTAATGGCTCTGGTGATTCTT TAGAAGGATTTGATGGCTCTGGTGATTCTTGAGAAGGATTTTTGTGACTC TGGTGATTATTTAGAATGATTTTTGTGACCCTGGTGATTATTTAGAATGA TTTAGTGGCTCTGGTGATTCTTGAGAAAGATTTGGTGGCTCTGGTGATTC TTGAGAAGGATTTGATGGCTCTGGTGATTCTTGAGAAGGATTTAATGGCT CTGGTGATTCTTGAGAAGGATTTGATTGCTCTGGTGAATTTTTAGAAGGA TTTGATGGCCCTGGTGATTCTTTAGGAAGGTCTGATGGCCCTGGTGATAA TTGTGAAGGATTTGGCGGCCCTGGTGAATTTTGAGAAGGATTTGATGGCT CTGGTGATTCCTTGGAAGGATTTGATGGCTCTGGTGATTCTTGAGAAGGA TTTGAATGCTCTGGTGATTATTGAGAAGGATTTGATGGCCCTGGCGATTC TTAAAAGGATTTAATTGCTCTGGTGATTCTTACGAAGGATTTGATGGCTC TGGTGATTCTTGAGAAGGATTTGATGGCCCTGGTGATTCTTGAGAAGGAT TTGATGGCCCTGGTGATTCTTGAGAAGGATTTGATGGCTCTGGTGATTCT TGAGAAGGATTTGATGGCCCTGGTGATTCTTGAGAAGGATTTAATGGCTC TGGTGATTCTTGAGAAGGATTTGATGGCCCTGGTGATTCTTGAGAAGGAT TTGATGGCCCTGATGATTCTTGAGAAGGATTTGAATGCTCTGGTGATAAT TGAGAAGGGTTTGATGGCTCTGGTGATTCTTGAGAAGGATTTAATGGCTC TGGTGATTCTTGAGAAGGATTTTTGTGACTCTGGTGATTATTTAGAATGA TTTAGTGGCTTTGTTGATTCATGAGAAGGATTTAATGGCTTTGGTGATTC TTGAGAAGGATTTGATGGCTCTGTTGATTATTGAGAACGATTTGGTGAAT ATATTGATTCTTGAGAAGGATTTGATGGCTCTGGTAATTATTGAGAACGA TTTGGTGAATATATTGATTCTTGAGAAGGATTTGATGGTTTTGTTGATTC TTTAGAAGGATTTGATCTCTGGTGTTTGTTGAGAAGGTTTTGGTGAATGT GGTGATTCTTTAGGAGGATTTGATGGCCCTGGCGATTCTTTAGAAGGATT TAATTGCTCTGGTGATTCTTTAGAAGGATTTGATGGCTCTGGTGATTCTT GAGAAGGATTTAATGGCTCTGGTGATTCTTGAGAAGGATTTTTGTGACTC TGGTGATTATTTAGAATGATTTAGTGGCTTTGGTGATTCTTGAGAAGGAT TTAATGGCTCTGGTGATTCTTGAGAAGGATTTTTGTGACTCTGGTGATTA TTTAGAATGATTTAGTGGCTTTGTTGATTCATGAGAAGGATTTAATGGCT TTGGTGATTCTTGAGAAGGATTTGATGGCCCTGGTGATTCTTTAGGAAGG TCTGATGGCCCTGGTGATAATTGTGAAGGATTTAGTTGCTTTGGTAATTC TTGAGAAGGATTTAGTAGCTCTGATGACTCTTGATAAAGATTTAGTTACT CTGGTGATTCTTGAGAAGGATTTGATAAATCTGGTGATTTTTGAGAATTA TTTGATGACCCTGGTGATTCTTGAGAAGTTATTGATGGCTCTGGTGATTT TTGAGAATTATTTGGTGGCTCTGGTGACTCTTGAGAAGGATTTTGATATA AATTGGGTTGCTCCGGCGATTCTTTAGAACGGTTTAAAAAATATTCTAAA AAAATCTATCGATCTGGAAAGTCCCGAGTTAGGATTTGTCGTTCTAAATT AAGGAAAGTTGGTGTTCCTAACGATACTGCACGACTTGGTGATTTCGAAG AGTCGAAGTCAAGTTGATTGTCCTCGCGATACTAAGTGACTCGTTGCTTC TGAAACATCTAATTAAGGAAATGTGATTCTTCTAGTGATACTTTATGATT TTGTGCTCGACGGCTGATTTGATTCGACGGTTCTGGTAGTTTAAATTTAG GAGACTTAATGTTTGACGATATACGCAACCCGGTGGTTCTGGCAGAGCTA AACCAAGGAGAGTTGAATTTCAAACCATGACTTTTTTTGGCTTATACTGA ATTCGTTTTCACCTATTCAATACAGTAACATCTTCAAATACAGCAAGTGG TTATTCAGAAAATGAGTCCATTTACGAAAAACTTAGTTTGAGATAATTTA CCGTAACGTTTTCGAATCCTGAATCGAAGCTGGGAGATATCGAAACTGTC CGTCATTACGTTGTCAATATTATAAAATTTCTGTAATTTATGATCCTACT CCTTCTTTACCAACAGAAGCAAAAANGAAAATTTCTATAATTTATGATCC TACTCCTTCTTTACCAACAGAAGCAAAAAGCTCTCGAAAAGCTCAGTGGT TGTGATTTCTGACACCTCCCTTCTTCCCCTTTGAAAGGCCAGCCAAGGCG CTTCGTTTTGGATGATACACTCGCCTTTTACAGCTGGTATATTTTTGAAA AAACTAAAGAGGGGTGGTTAATAAGGCATCTAGGAGTAAATTATTGCGGT GCTTACAGGTGCCTCTAATAAGAAATACGGACAAAATTCCGGTCATAATG CATCTCATAACAGATCATCCATTCTCCGCATACTATATGCTTTACTCTTA AGGGATATGGCAAATGTGACGGTTCCTAATTTTGCTCAAATGATGCTGAA TCGTTCACTTAGGTTTTTTTGTAAGAATTGATGACTACTTTTCACAATAC ATGAAGTTGATGCTCCAGGGAACAAGATTCTGTTATGTACGGGAAATTCC TACAAAACTTTTATCACTGAAATTCTTAAGAATAAGATTAAAAAAAACGA ACACATTCTATGGCTTCGATAGACCGTACTCAGCTCGAAGTGCAGATGAG GAAAATGGACTTGCTTAAATACACACGCGCTGACGCTTTCAAATCAATCT ATCATAATGAGAAAATTCGATCCTTACTCGGTGCTCCCCTTAATGCTTGT TCTCATTCGAAGATTTATTTTCGAAGAAGAAACATCCATTATGANATGCT TGTTCTCATTCCAAGATTTATTTTCGAAGAAGAAACATCCATCACGACGA CAGCATTATCGGTCAATCCGTGACATTTAATACTGATTTGAATTTCGGTA TGCCTCTTGCTGCGTCCAGAACTGAGATACGGAGGTCTCTTACTATTCTT CAAAATCGCGCAATGTGGTTTGATGATTAATGACGTTTTAAGCCATCAAC AATTGATCTCGATCAAAGTTGACCATTGTTTAATCATTTTATTCTCACTC AATCAATTGAACGTCAATCGAATAGTGGGATATCAATCAAGCAAAGGGTT ATTACTCCGACTCCGATCAAGTAAATTGAGTAAACGCCAATGGAATCAGT CAAACATTAATCAACAGTTTATCAAATATCGAATCGAAATCAGTCGACGA GCAGTGTAACATCCAGGTACTGATGCCATCTTTCTCTGGCTTATCATTCT GCACGAAGCAACATTCCTACAACGATGCTGCGTTGATACCCCTTTAAATT GACCTTGAAAACATTACCGAAACAATACTGAAATAATGCAAAAATGTGGT CGATTAATCAATGTCGTATCAAGTCATCAACTACTGAAAAAGTGTAAAAT TGATTCTGAAAGTATTACTGAAACATCTGACAAAATTATTGATACGAGAT ATTCTCATATTCTGAAGTTTCGTTGCTACAACATTTCAGGGAGGGTGGTC AAAATTTTTGACGTCGCCTGTTTCTTTTACCCATACTCATAAGGAAATAA AGACTCTTCTTCATAAATTTTCAACCCCTCTCAGATCCGCCAATGCAGTT TTTATAAAGGCCTCTTCAATTTCGCAACTACGCAAACCTAGTCCTTCCAA TTTTATGAATTTGACTGGCGGGTCCCAGTGGTCTGATTTTCACCTTGGTA TTAAATGGTCCAACACTAAGGGGAATCAATGTGAAATCAATTTCATAAAT TTTGTAAACCTGCGTGAAACGTTTCCATAGGTGACCTGGTGAGTCTGAAT GCCTTTAGGAATGGTGGAAAGGGAGTATTGTTTACAGCATCGTTATTCCC AATAGATGCTGAGATTTCAGCTTCATTTTCATATGGGAATAAAATTGTTT TAACCTTGGAAAAATCTTTGGTTGATTTTTCTACTTTGTAAGAGTTTCCA TCGGTTCTATAACAAAGAGGTTGTATAGTGATACCTTTGTACTTTAGATA TTTCATGAAAATACATTTGAAGTTTATAGTTTCAGCAGTTATGTTTGAAG CAATTGGAAATTTTCAAGATAGTTATACGGTTACTCGGATTTAGAAGATT TAAAGTAGTTAAGATTGTGAAGTAGAAATCAGGAAATGAGATTTTTTCTT TTCTTTCTCGTAATATATTTATTTTTTGTTCTTGAATTATAATCCCTTAA AATCTGTATAATCCTTAACTCCTGACAACCACAATAAAAAAAACTATAGA TACAAACAGAATGGTGTTCTACACATGCTAGATAGAAACAGACGCATCAA GAAGTTTCCACAACGTTTCCAAGATGAGAAAGAGGAAGAATTCGATCTTG TCATCACCGCTGAAGAAAGAGTATACGATCAACTCGTAGAAGGTAAGGTG GAGTTTTCTGACACACCACACCCCTGTCTCATGACTAGGGGAGGGTTTGT TAAATATACACTGTGTCCCGAACAAAACTCATCATCTTAACTTGGTTTAG AATGATTGGAATAAGATTAAAATTCTCTGTTCAATCAATAGATATTCAAC TCCCAAGATGATTGAATAGGTTCTCAAGATGGAAATATTAAGTACCCTAA GTATTCAAGTCATAAAATTTCGCANTGCGAGATGGAAATATTAAGTACCC TAAGTATTCAAGTCATAAAATTTCGCATAAGTTATGAGGATCTTGTCTGC TTTTTCTGAACACACTGCAGAGGGAAAGCATGAGAAAAAGCTTAAGGCCA ATAGGACTGAAAACTTTTTACCCAAATTAATGATATTTGCTGGAGTCTGA AATTCCTTCTCTGATAAGACTTTTAGCTTTTGTATTTTGTACCCTTGTTT TCACTGGCTCATTGTACATAATGTACGGAAAAGCAGAACAGATTTTATTA TAATGTAAAATCCACAAAATTCGTAGGCTCACTGGAGTTTGAAATCATTT AATGACATAGGATTTCTTTGTTCAATTTAGGCATTCAAAGAAAACTAAAA TGAATTTTGAATAAAGAGAAATTGTGTATAAATTAGGTTGTAATGTAACA ATCCGTATAAATTGATTGATTGATTGATTGATTGATTGATTGATTGATTG ATTGATTGATTGATTGATTGATTGATTGAGTGATTGATTGATTGATTGAT TGATTGATTGATTGATTGATTGATTGATTGATTGATTTCCTTAGATTTCC AGCAACGAGAGGCGCAGTCATACACACCAGTGCATGTCATTAACATTGAC ATCACGGATAACGCTGAAGAAGCTACACTTGGTGCTTTCCAGATATGCGA GCTATGTGAAAAGGTATGTGACCAAATCATCTTCATATTTTTTCGGCTTT CTGTAAATGAAGAAGTACCCTCTTAATAAGTAAATTAATTTTAGCGAGGA TTTCGGATCAGCCTCTTTGTGGCCAAATATCTTTCATTTTCCTAGAGGTT TTCGCGAAAAATCATGATTTCAAACTTTTTACATTCTGATGTACTATTTG GAGAATCAATTTTTAGCAATTGAACTTTGTTTTAAAAGAAATTATTAACA TCATGGTACAATTTCTTGCTAGTTTTTCAAGCATTCAGTTGGTCAATACT TTTAAGTATTGGAAAAAAGGTTTCTCCTATTATTTCAAAGTATGATACCG CTCTTCCAGAATTGTAGCACTGAACACTCTGTTGAATTTAAAGATAGTTT TACACGTTTTACACATTATACATTTTTTTTATTTATAAGCATAACGCTTA TAAGCATAACAAGGCTGAAACTTGGGCCTGAAAAAAATAGACCTATTGTT ATATAACAATAGAATTCTAAGCATATAACCAGCCTCAGCTCAAATGATCA GTATTTTAGAAAACAAATATACATTAGTCTCAATAAGGGTCGTAAAAATC GCAAAATTTTCCTATTTTTCTCCTTTTTAGTCCCGCTAAGGGTCCGAGGG GGTCAGAAGTCGGGTGGCACATACCCGTCAGCTCGCAACCCTAGTACCCA CCTTGGGGTTTTAGAATATCTGGGTTACTCTGCGATGTGACAGTCCAGAT TAATCTTATTCATGTTGTTCTAATCCTTTCAGCTTGAGAAACTTGACGAT TTGGACGACGACATTGCAGAAACACTGGAACTTTTCGAAAAGAAAATCCG TCGTCATTTATTGCATACTGTTGCTTTTTATTGATGCAATGAGATGAGAA TGTCGTGGTGAAAGTTGATGATGGAAACGTTTAAAATCCATTTGAATGGT TTGGGTCTCATTGGTGATGATTAAAGAAAGATGACCACCGTTCATGGTAA AATGTTGGACACAATGTTCAAACGAGAGGCTGTTGAGCCTGGTTGTCTAA CCGCCAGTTGATGATCTTCGCCTGTTTTAAAGGCTTAGAAGGGATGAATA TTGACGTTTGTGTTAAATAAAACGTGTATGTTACAATGAGGTAAAGCAAA ACATTGAGTTGGTGTTGGTTGCAAAAGAACATTGAATTTAAATTTAACAT TGACAGTTTTTTTTTTTAAAGAAAATTTATCGTCTCAAACGGAATTCGAC AAATCTTCAAATGTTGATCATACAAAAGTTTTTTTCTTCAATGCTAATAC ACCTTTTCGACCGTAACCGCCAATTGCCGCGCAGGCATTTTTATCCCACT AAAACCGTCCCAGTCCTTTTTTCGCACATATAGACGATAGAAAAATGTGT CAAAAAAGGACTGCGACGGTTTTAGTGAGATAAAGCGGACAAAATAATGC CCGCGCGGCAATTGGCGGCTACGGTGTACGGAAGGTGTATAGTCTTTCCA TGGCGAGCATTTACCGGGAACTTGGGAAGGTTTTACAAAGGTAAAGTAAA GTAATAACCCACATCTCTATCCGCTTGAGACATAAGTTTATAAAAATTCA ATATGGCGTAATGCTTATTATTCCCACTTGCCTTTATCTGCTATCTTTGG TCGGAGTTTTTTGAAAAGTTATAATACTTATCGATGTCAATTTTTGATTT AATGAATGAACGAACTTTCCTGTTTAAAATTTTTTCACCCTGTTTCACCC AAAGTGAGTAGTAAATGATACCATTACTGTCGTTTTGTATCATTCATTAC AGTACCGCTTTTCTAGCGCAAAAAGACCAAGACTTCGGTTCGTTGAAAAA TGAGCTTCGGAAAGTTAGGCAGTTTTGTGAGTATACACAAGATTTTCCGT AACTTTAGAAACAAACCTTTTCCATCATCATGCCGGTTTTCCCGGGAAAA AGGAAAAGTGTCTTGACATTTAGTGTGGAAATTATAATCTTATACAAAAC GAAGGTAGGGCTATCCCTTTCGAAAAGCTCTGGCCAAAGATAATTTTGGC AACTGAGAAGCCTGTTCCGACCAGGGTTTTAAGGTCCGATTATATTCCCA GCAATATTATCTTACAAAAATTATTCTTTGTCACATTTCAATAATTTAAA TCTTATGAATTTCATTTTGTAAGGTCAGATTATTCGGGTAAATTTAGATG AATGTTTAGATGCTATTCATGATATTCATGTACGGAAATATCCCAGTTTT AGCCAGTAGTGACAAATTTAAACTAGGCAAAAGTTGTATAATATTTGCCA CTGCTGGCGAAAACCGGGGTCTTTCCGTAGAAAACATTACGTCACGAATA TCATAAATAATCGAACGATAAAATATGATAAGGGTGTATCTCCCGGTTCT TTCAACCCACTGGGTTGCAGTGACACTAGTTTTGGCCAGATTAGATTTTG AACTTTCTGTAATGAAGCTTATATTCATTATTACACCCCTTCTTACAGGC CCTCTGGGACTCCTTCCAACGGCCAAAATATCATTCTTGGTGGACAATTA CCATCCAATTTTTGTCCCCGCACTGAATATAATCATATAAGCAAATCCTC ACTGCAAAATATTTACTATTGTTCCCATCTTCACTGAATTTTCTGACTTG AAAACAAAAGAATTGAAATCCCCAGTCATAAAAAATGTGAGAATATCAAT TCCCACCGAGTTTTGGTTCATTATTTTTATCCCCACTGGCTGAAAAAATC CTCACAGTTCTGTTGAAGACTTTTTTTCTTCACTTTATAATGTGTATGTC TTCAATTTTGGGATATTTTTGTATTAAGAACTTAAATTAATTATAGTGTA TAATATAGAAAGAAGGCAATCCTCCTTTGGATCTACTTCAAGACCAAAGC ATTTGTCAGAATTTTCCAAACCAATTGAAA

Coding sequence (CDS) from alignment at sc0000001:1605392..1630821-

>TCONS_00000219 ID=TCONS_00000219|Name=TCONS_00000219|organism=Clytia hemisphaerica|type=CDS|length=2985bp|location=Sequence derived from alignment at sc0000001:1605392..1630821- (Clytia hemisphaerica)
CTTGAGAAACTTGACGATTTGGACGACGACATTGCAGAAACACTGGAACT
TTTCGAAAAGAAAATCCGTCGTCATTTATTGCATACTGTTGCTTTTTATT
GAATTTCCAGCAACGAGAGGCGCAGTCATACACACCAGTGCATGTCATTA
ACATTGACATCACGGATAACGCTGAAGAAGCTACACTTGGTGCTTTCCAG
ATATGCGAGCTATGTGAAAAGATACAAACAGAATGGTGTTCTACACATGC
TAGATAGAAACAGACGCATCAAGAAGTTTCCACAACGTTTCCAAGATGAG
AAAGAGGAAGAATTCGATCTTGTCATCACCGCTGAAGAAAGAGTATACGA
TCAACTCGTAGAAGTAAACGAGGATTCAATGTCAAGTCGTATGGCACTGG
AAACCAAGTCAAGCTACCAGGACCATCAGCTGACAGGCCAAATGTTTATC
CGTTCACAACCCCATATGACCACATTTACAGGGAACTCTACAGGAAAGAC
GCTCATTTATGTCGACAAAAAGATCGAGAAATCTTCGCATCGCAGTCGTT
TGCAGTAGTAACATGAATAGAAGTATGGAGGCCCACAGCTTTTTGAGCTT
GAGAAACTTGACGATTTGGACGACGACATTGCAGAAACACTGGAACTTTT
CGAAAAGAAAATCCGTCGTCATTTATTGCATACTGTTGCTTTTTATTGAA
TTTCCAGCAACGAGAGGCGCAGTCATACACACCAGTGCATGTCATTAACA
TTGACATCACGGATAACGCTGAAGAAGCTACACTTGGTGCTTTCCAGATA
TGCGAGCTATGTGAAAAGATACAAACAGAATGGTGTTCTACACATGCTAG
ATAGAAACAGACGCATCAAGAAGTTTCCACAACGTTTCCAAGATGAGAAA
GAGGAAGAATTCGATCTTGTCATCACCGCTGAAGAAAGAGTATACGATCA
ACTCGTAGAAGTAAACGAGGATTCAATGTCAAGTCGTATGGCACTGGAAA
CCAAGTCAAGCTACCAGGACCATCAGCTGACAGGCCAAATGTTTATCCGT
TCACAACCCCATATGACCACATTTACAGGGAACTCTACAGGAAAGACGCT
CATTTATGTCGACAAAAAGATCGAGAAATCTTCGCATCGCAGTCGTTTGC
AGTAGTAACATGAATAGAAGTATGGAGGCCCACAGCTTTTTGAGCTTGAG
AAACTTGACGATTTGGACGACGACATTGCAGAAACACTGGAACTTTTCGA
AAAGAAAATCCGTCGTCATTTATTGCATACTGTTGCTTTTTATTGAATTT
CCAGCAACGAGAGGCGCAGTCATACACACCAGTGCATGTCATTAACATTG
ACATCACGGATAACGCTGAAGAAGCTACACTTGGTGCTTTCCAGATATGC
GAGCTATGTGAAAAGATACAAACAGAATGGTGTTCTACACATGCTAGATA
GAAACAGACGCATCAAGAAGTTTCCACAACGTTTCCAAGATGAGAAAGAG
GAAGAATTCGATCTTGTCATCACCGCTGAAGAAAGAGTATACGATCAACT
CGTAGAAGTAAACGAGGATTCAATGTCAAGTCGTATGGCACTGGAAACCA
AGTCAAGCTACCAGGACCATCAGCTGACAGGCCAAATGTTTATCCGTTCA
CAACCCCATATGACCACATTTACAGGGAACTCTACAGGAAAGACGCTCAT
TTATGTCGACAAAAAGATCGAGAAATCTTCGCATCGCAGTCGTTTGCAGT
AGTAACATGAATAGAAGTATGGAGGCCCACAGCTTTTTGAGCTTGAGAAA
CTTGACGATTTGGACGACGACATTGCAGAAACACTGGAACTTTTCGAAAA
GAAAATCCGTCGTCATTTATTGCATACTGTTGCTTTTTATTGAATTTCCA
GCAACGAGAGGCGCAGTCATACACACCAGTGCATGTCATTAACATTGACA
TCACGGATAACGCTGAAGAAGCTACACTTGGTGCTTTCCAGATATGCGAG
CTATGTGAAAAGATACAAACAGAATGGTGTTCTACACATGCTAGATAGAA
ACAGACGCATCAAGAAGTTTCCACAACGTTTCCAAGATGAGAAAGAGGAA
GAATTCGATCTTGTCATCACCGCTGAAGAAAGAGTATACGATCAACTCGT
AGAAGTAAACGAGGATTCAATGTCAAGTCGTATGGCACTGGAAACCAAGT
CAAGCTACCAGGACCATCAGCTGACAGGCCAAATGTTTATCCGTTCACAA
CCCCATATGACCACATTTACAGGGAACTCTACAGGAAAGACGCTCATTTA
TGTCGACAAAAAGATCGAGAAATCTTCGCATCGCAGTCGTTTGCAGTAGT
AACATGAATAGAAGTATGGAGGCCCACAGCTTTTTGAGCTTGAGAAACTT
GACGATTTGGACGACGACATTGCAGAAACACTGGAACTTTTCGAAAAGAA
AATCCGTCGTCATTTATTGCATACTGTTGCTTTTTATTGAATTTCCAGCA
ACGAGAGGCGCAGTCATACACACCAGTGCATGTCATTAACATTGACATCA
CGGATAACGCTGAAGAAGCTACACTTGGTGCTTTCCAGATATGCGAGCTA
TGTGAAAAGATACAAACAGAATGGTGTTCTACACATGCTAGATAGAAACA
GACGCATCAAGAAGTTTCCACAACGTTTCCAAGATGAGAAAGAGGAAGAA
TTCGATCTTGTCATCACCGCTGAAGAAAGAGTATACGATCAACTCGTAGA
AGTAAACGAGGATTCAATGTCAAGTCGTATGGCACTGGAAACCAAGTCAA
GCTACCAGGACCATCAGCTGACAGGCCAAATGTTTATCCGTTCACAACCC
CATATGACCACATTTACAGGGAACTCTACAGGAAAGACGCTCATTTATGT
CGACAAAAAGATCGAGAAATCTTCGCATCGCAGTCGTTTGCAGTAGTAAC
ATGAATAGAAGTATGGAGGCCCACAGCTTTTTGAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000122XLOC_000122Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000219-exon-sc0000001-1575043694:1630438..1630821TCONS_00000219-exon-sc0000001-1575043694:1630438..1630821Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1575043694:1626131..1626274TCONS_00000219-exon-sc0000001-1575043694:1626131..1626274Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1575043694:1609230..1609372TCONS_00000219-exon-sc0000001-1575043694:1609230..1609372Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1575043694:1608309..1608427TCONS_00000219-exon-sc0000001-1575043694:1608309..1608427Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1575043694:1605392..1607539TCONS_00000219-exon-sc0000001-1575043694:1605392..1607539Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1510915933:1630438..1630821TCONS_00000219-exon-sc0000001-1510915933:1630438..1630821Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1510915933:1626131..1626274TCONS_00000219-exon-sc0000001-1510915933:1626131..1626274Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1510915933:1609230..1609372TCONS_00000219-exon-sc0000001-1510915933:1609230..1609372Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1510915933:1608309..1608427TCONS_00000219-exon-sc0000001-1510915933:1608309..1608427Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1510915933:1605392..1607539TCONS_00000219-exon-sc0000001-1510915933:1605392..1607539Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1491911889:1630438..1630821TCONS_00000219-exon-sc0000001-1491911889:1630438..1630821Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1491911889:1626131..1626274TCONS_00000219-exon-sc0000001-1491911889:1626131..1626274Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1491911889:1609230..1609372TCONS_00000219-exon-sc0000001-1491911889:1609230..1609372Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1491911889:1608309..1608427TCONS_00000219-exon-sc0000001-1491911889:1608309..1608427Clytia hemisphaericaexon
TCONS_00000219-exon-sc0000001-1491911889:1605392..1607539TCONS_00000219-exon-sc0000001-1491911889:1605392..1607539Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000219-proteinTCONS_00000219-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1605392..1630821 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
13.4661 12.8915 5.86859 5.39031 19.9708 16.8388 16.1408 18.8634 11.089 13.0366 13.2411 9.09511 9.58875 8.9672 10.1425 9.3358 13.136 14.8633 10.9514 14.2393 17.1268 16.0511 19.7405 18.9229 7.91782 6.20167 10.7369 12.2693 17.0699 16.2469
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR006811RNA_pol_II_suA
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Molecular Function
TermDefinition
GO:0004721phosphoprotein phosphatase activity
Vocabulary: Biological Process
TermDefinition
GO:0006397mRNA processing
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006397 mRNA processing
cellular_component GO:0005634 nucleus
molecular_function GO:0004721 phosphoprotein phosphatase activity
Blast
BLAST of TCONS_00000219 vs. Swiss-Prot (Human)
Match: SSU72 (RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Homo sapiens GN=SSU72 PE=1 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.600e-68
Identity = 120/193 (62.18%), Postives = 151/193 (78.24%), Query Frame = 2
Query:  311 SRNLRIAVVCSSNMNRSMEAHSFLSKRGFNVKSYGTGNQVKLPGPSADRPNVYPFTTPYDHIYRELYRKDAHLYKQNGVLHMLDRNRRIKKFPQRFQDEKEEEFDLVITAEERVYDQLVEDFQQREAQSYTPVHVINIDITDNAEEATLGAFQXXXXXXXXXXXXXXXXXXXXXXXXFEKKIRRHLLHTVAFY 889
            S  LR+AVVCSSN NRSMEAH+ LSKRGF+V+S+GTG  VKLPGP+ D+PNVY F T YD +Y +L RKD  LY QNG+LHMLDRN+RIK  P+RFQ+ K + FDL++T EERVYDQ+VED   RE ++  PVHV+N+DI DN EEATLGAF ICELC+ ++  +D++++I E L+ FE+K  R  LHTV FY
Sbjct:    3 SSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCK-DLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY 194          
The following BLAST results are available for this feature:
BLAST of TCONS_00000219 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SSU722.600e-6862.18RNA polymerase II subunit A C-terminal domain phos... [more]
back to top