Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000200 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000200
Unique NameTCONS_00000200
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length718

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000200 ID=TCONS_00000200|Name=TCONS_00000200|organism=Clytia hemisphaerica|type=transcript|length=718bp
GTTTTAAGtttgaataaattaaaaacaGCCATGGGGTTTCGTTCAAAGAA
GAATAAGGATGGTGAGAAAGGGAAGAAATTACCAAAGCGTAAAAACGGGA
CGTCTCAACGCAAGAAGAGTAGCGTGAACAGTGTTTCAATGGACGCTCCG
GTCAAAGATTTCATTGTTCACGTTTATAATAATTTACATGAATCGACGGC
TATGAAATTTACTGATGAACAGATTGAAGAGGTCAAAGAAGCATTTGCAA
TTTTCGATAAAAATGGTGATGGCACAATCACGACGAAAGATTTNCATTTG
CAATTTTCGATAAAAATGGTGACGGTACAATCACGACGAAAGATTTGATT
ACGGTCATGAGGTCGTTAGGGAAAAACCCAACAGAAGATGAAATTGACGA
CATGATTAATGAAGTGGATACTGATGGTAATGGAGTGATTGACTTCATTG
AGTTTCTGGAGATGATGGCCAAGATGTCAACAGATGTTGATGAGACAATC
AAAGAAGCTTTCTACATCTTTGACAGTGATGGTTCAGGTGCCATTAGTTC
AGAGGAGTTTCGTAAAGTGATGATGACGTTAGGTGCTCAAATGACTGACG
AAGAAGTGACAGAAATTATTGAAGAGGTTGATGTGGATGGTGATGGTCAA
ATTAATTTAGAAGAATTCGTTAACATGTTGAAAGGTGGAATCTAAAGAAA
ACACTCtaacacaacaac
Run BLAST on NCBI

transcript from alignment at sc0000001:1171384..1224866-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000200 ID=TCONS_00000200|Name=TCONS_00000200|organism=Clytia hemisphaerica|type=transcript|length=53483bp|location=Sequence derived from alignment at sc0000001:1171384..1224866- (Clytia hemisphaerica)
GTTTTAAGTTTGAATAAATTAAAAACAGCCATGGGGTTTCGTTCAAAGAA GAATAAGGATGGTGAGAAAGGGAAGAAATTACCAAAGCGTAAAAACGGGA CGTCTCAACGCAAGAAGAGTAGCGTGAACAGTGTTTCAATGGACGCTCCG GTCAAAGATTTCATTGTTCACGTTTATAATAATTTACATGAATCGACGGT ATGTACAATTCTTTTTTTATTTTATTTTATTGATTTTATGAATTAAACTT ATGAAGCATTATGCTCTAATTAAGATATGGCAGGGTAGTTCACTTGAAAG AGCATTCGCCTTACACTCCTAGGGTTTTGGGTTTCTATCTCCGGTCACCT CCAACTCAGTGAATGAGCAGCCTACATTGGTAATTTGATTTAGGTGGTAA GGTACTGGAAACTTAGAGTAGGTACGGTGATCCATTTCAGTATTCGAACT CCCAGGTCAAGCGCAAATAGAAAAAGGGATAGACTCCCTCACTCCCGTTT GTGCCGACAGCCGCATACTTACTTACTAAATACTATCATGATATAGGATA GCATTGCGCGTGCGCCATTACCTTGGCTAACAAGGTAAACAGTGATGATT ACAAATATAAATAGATATAAATACGATGATGACTTGCCAGGTTGGTCAGC TCTTCAAATTGTGATTTTTAACAAGCTCACAACCATTAAGGTTGAATTCC TTGAGGTGCGTTAAAGGAGTGAGGTGGCTCCGTGGCGTCAAAATTATTAG GTTAATATCATAATATCCGCAAAATCCTTCCTTCGCGCTTACGGGAATGC TTACGTTTTCGATTATTAGTCATCGATGAACCAAACTCTTTTTTGATTTT TAAAGGACTTTGTAGTAAAATCACGCTAATTAAAGGACTCGTATATAGTC TCATGCCTTATTTATTCATTTTCTTCCTTCGAAGTCCAAGTAGACTCGAA TCAAGGAGTTATGGAGTAAAATTTGAGAATCTCTCAGGGTTTCTTTTTAG CTGGAAATGACAATCATTTGAAATTAAAGAAAAATTCGAATTCGAAATAT TTGTAGGATGGATTTTTTATAAGATACTTTGATAATAAAAACGTAACAAA AAGTAATAAAAACGACGCGTTCTTTAAAAAAAGTAAAAAATTTGTTTTAA AACTGGTTAACGACCAATCAAATCAAATAAGAGCTTGAAAAAACTCAATC TCATTCCAATATTCATTCTCCACCAATAAAACCGAGAATAAAACAGTAGA CAGTCTGGATTCGATTCTCTGATCGTTTAAGAGCTACTATACGCAAAACT TGAATTATTCCTTAATATGACGAACAGTATGTTAGAGTGTCAAGTCCAGC CCCCTTTAATTAAGGTGCACAGTCGTCTGAGCTGATGCTTAAAATCAGAA AGTAGATACTCACTCATTGAATGTATAGTCTCAGGAAAGATGGTTTCTAT ATGAAGAGTTTTACAAAACATTTTCCTGAGAAAGCTTTAAAATTAGGAGT TCACAACTTGTGATGAATTATGATTTTTGACAAGGTCACAACCAGTAAGG CTCATGATGAGCTTTTTAAAAATTCAAAAATTGTATATTCTTTATGGGAA AATTTTATAATGTCCAAAAGAGCAAACCTCTTGGAATATTTCACTTTTAA GTTATGACTTCATTAAAAAATACTATTCAATATACATAAGAAGCAGGTTC TTGTTAATTGGTGTATTATACACGATTTATAACTACAACTATATTAAACC TTTCGAATCTTTACAACCAACTATTTTCCATTCCAGAGGGTTTTTTTGAA GTATTCGTAAAATTTGTAAAATACATTCGTTGGGGGGACTTTTGATTGTT ATGCACAATGGAAAGTTTGAAAGTAAAAAATTAGATTCCATTTTTTTTCC TTTTTCGGCTATTTGTAGTGTTTAATAGGAGAATGATTTTCAATCAGTTA TTTTTTTTATTGGGAAAGGGTGTATCCTGTCTATCCTGTCAGAGGGTTGT TTTCAGAACAATTCTAAATCATGAATCATATTTCAAGTGAAAACCAGTTC TACAATATTAACAATTTGTAGGTATGGCCTTAACTTGCTACTGTTCGAAT TCTCACAGCTTGAAACACATGATTTTGGTATTACTCAAATTTAATTAACT GAGTTGTAGAAAACTTGCTTTTGGAATTTTGGAGTAGAATTCAAAGAACC TTTTGTGTTTGAAAAGAGCCTTTATATTATTGCCAGGTAGTAGCAAGGAT AAAATGGGAAAGCATTTGCTACCGCCATAATGCGTGGAAATATAACAGTA AAACAGTAATTTGTCAAATTTTTAAATCCTGAATTAAACTTGCTTTAAAA TTTTGAAGTCGTACATTTTATTTGGATGCTATAAAATTTGAAAATAAATC CTTGGGAAGGGCTTTACAAGATCTTTATTGGTTATATAATTTTTGAAGTG AATTTTGAAGTAATAATGGTACATGTACGGTATGGAAGTCGTATTAAACG AACCTTACGAAAGATTGGAACTGTTTTTCGACCGAGAGAACTACACGAGA AAGGGCATGGGGTAAGAAAAGTGATTTTGTAATTTCGTATCAATATTTTG ATTTCTAAAGGACAGGTTTTAAAAGTTTATGATAAATTGGCCGGTTGAAA TGGGTATGGTTGGATTTGAAGAAAGACATTTAATTGGCGATTTCGACTTT TGTAAACCTTTTTTATATGACTTTGGCTAAAATTTGGACAGTATAAACCC CAAAAGGCCAAAAGAAAAGGGTTTAAAAAGGACCAAAGGGGGGGGGGAGA TTCTTTCCCTTGACAATAAACCTCTAGTAAATTTAAACTTTTTCCTTGCG ATGAATTTGTGGATTTTCCAAAAATTTAGGCATTTGGCAACCTGTCTAGT TGGTATTTTACAGACCAGAACATTGAACAGATATGTCTGAGTAGCTGGTT TGCGGAATTCCTGAAATTATCAATAAGATTTGTTATTATTTGAGGTCAAT AAAAAGATCTGAGGTCGGTAAAAAACGACCACCTCTGGAACTAAGTCTTT TTAACTTTTTAACCACCCAAGGTGGTTAGCGAATTATATTGACTATTTAG ACACATATGTGAGTTATAGACAACGGCGTGTCTAAATATGGCCTGTTATA TTTTGGCGACGTCTACATCTACGTTTGGTGAAAATGTTCACAGCAAATTT GATTCTCAAAACAAATAATGGAGTATATGAGAAATAGGATTCTACCCCAT GGGACAGGCTTTCAAATTTGCAGACTGATCTTTAAGATACAGATAAATCC AGGTTAAGTCTGCGGTATCATCTCGTGTAACTTATCCAGCTGGTACACAA CGTTGTTTAAACGTTCAAATAACGTTGTGAACGTTAGTTAAACGTTGAAA CAACGTCGCGTGCCGGCTTGGTATGGCCCCAATAAGGAGATCATTAGTTT TTGAGATATTCAAATTTTAAGCTTTATAAGGTCATCAATTATGACGCCAT TTAACACATTTTCCCTAATTTCTTAAAAAAGAAAAAATTGATTTTATTAA CAGGCATTTCTTAAACCTACATGCTAATACGCTTCCTTTAACGGAAAGAA TGACCATGCCCAAGGCCCCCAGTTCTTTGCGCAATCCTTTTTGGACATGT CATTAGTTACACGAGATAGACCTTAACTCCCAATCATGTCTGAAGAATAG GTGCTGATTAGAACCTATGGCGATAAGGGAAAATAGTACTTTGTTTAATT CTAATTAACAATAACGTAATGAGTAATTGATCGTTTGATTTGGATCAATC CAAAATCGATCAAATCTTGACCAATCATATTGATTTAAAAGTTGATTAAA CTTTAGAAAAGATAGCTGTATCTACGGTAGACTATAAGCACCTTTCTGAC TGAACTTTACTTTCAGATCATTTTTGTAAAGCTGAGTCCAGTGAAGCAAA CTAGAGCATATCATCATTTTCGAATGTTTTGTAAAAAAGTTCTTAAAAAT TGCATAAAAACACAAAAACACCATGGAATTTTCATATAGGCGATTGGCAA ATCAAATCTAAAAACATTTCTGGAAAATAAGTGAATACGCCGTGGAAAAT GTCAAAAATTGCAAAAAAAACTCGGAAAAAAATTCCTTTCATACTATAAA GCGGCAGTGGACTAAAATCAGTTTATTACCAACTGGAAATTCTAAAATAA TTTCTTACTACCTGGAAAAATGAAAAACACTCTTTTAGATATTCTGCTGG AATTGTTCGTTCATCCCATGTATGAATATAAAATGGAATGGCCCAATAGA AATTATTCCAAAACCCCATCAAAGTTTACTATAGTAGAAACATAAGAATA CCTCTTAAATTAAAAAAGAATTAATCCTGATTTTCCGTTTGTTTTACTTC GAAAAGGGACTGGATCTAGTGGTATGGATTTGCTACTCAAGCAAAGTAAG AAAATGATGTGTGCCAAATTGCACCGGGCCACTAAACACCGCCATCCAGT CTATCAAAAAGCTGTAAGTGGCCCACGGGCCATTATCACGGTAGGCGAGA AAAAGTCTAACCAGCTAAATCATTGAGTTTTAAAATTTTCGACAATGCAA AGATATTTAAAAGTAAATTACGTGACGTTTGGAAATTCTTTCTACCCCAC CTAGCTCGGTTAATACAAACCATCTCTTGTATGGCTTGTTGGGGCTTGCT ATCAAATACATTTCACAAGTCACGTCATAGATGCAAATTTGAAAGTTTTG AATAGCATTTTGTTAAAAACAAAGCCAATTTCTATATTATTCCGAATAGG ATTAAATGGAGATTAATGGGGCTTATGCAAAACAAACTGCGTTTCTAATT ATCGAAAACATATACATAATGGGTTCCAATTTGAATTTGATAATGTTACC TGTCATCTAACTGTGCTCTTATCGCTGTAAGTACACCATGCGGTCTTTTA TTTCAATGTGCACTAGAGAATTAAACATCAGCATGGCTTACTAATATATC TAGTAAACTATTCTAAAAATGAACTTCTGATTAAAATGATACTGTTATCG ACGTGTCAATTTATTTTATAAGCATTTGATTAGTAATAGTGTTTAAATTC TAGTTCGAAATTTGACCAAGCTATCAATTAGCTCTGTGAGCTAGGCCAAC CTTTTTCAAAGAAAATAATCATTGTAGCCATTACTGAAACTATTAAATGC CATGGCTTGGCCTTGATCGGGCTCCTCTTCGTCTCCGTACAAGGTGCAGT GATCAAATATGGTCAAAAGCGTCAGCAACTCAAATCAGAGGATCGTGGCT TGGATTCTAACTCCTTCCAATGTTCCGTTTCACTTCATAAATAGCGGAGC CATCTGACCATGGACAACGAAAAGACTGCCTGAAAGTCCCAAATTATTAG GCTATCCTGACTCTTTATATATGAATATGTATATGAATTCCAGAGTCAGG GAAAGAAAGAAGACATTTTTGTGCCATTCTAAGTGAATTTCTTTCCCTTC AAACTTTTTCGATTTACTGAAATTATACTTCGATTTCATCTAAAGTATTC TGCAGTTAAAGCCTGCAAATAATCTTTCAACTTGATAAGATCCTGATAAA ATCATGCGATTATAAGAAAACAAAACTTTCAGTATGGATCTTATTAATGA TAGCCTTGTTCGTATCTTATCAAACAGCTGCTGATTTTGCGATGTCCAAT TTTTTGAAAAAAAAAAAGATATATCATTTTTGAGTAATCACTGCAAGGCT ACAGAAGAGGGAGGTCAAAAAACAAACAAAACCTCATGGATCTATAAATT TACTTTGCTTTTTGTGTCTATAATGCGACATCCCTCTAATTCAGAATATT GGGAAGAACTAAGAATCACAGATTTGCTTGTCATTTTGAGAATCATGGTT TTTGTTAAATTTAAGAAATTTTTGCGTTTTAATTCTGAAGATGAAGACAT TTTGGACTTTGGAGATGAATTTGGAGTGATTCAGAAAACTGAAGAAGAAA AAGAAGATGAAAAACATCAGGTTTGACACATTTTATTTCACGAAACTCAC TGTACTTCTTTTAACTTTGAAATTTTGAGATAAATTCATTAATTGAAAGC CATGTAATTATTTTTACGTTTATCAATCCCTCTATTCGGTTTTATCTATT AGTATGGAATTATCATAGACACTGGAATAACAACTGACTGATTTTTTGCC AACTTCTCAAATACAAATCTTGTCCTCAGTAATGACATCATTGTTCACTC TCCTTCAACCATCAAATTATTTTTCGTAGCATGTTCTTTGTATTTCTCTT CAAAACGCACTTATCTACTTCTCAAAGGAGACTTTTTAAAGTTAAGTGTT CCTTCGAGGGTCAAACTTATCTATTTAATGTCCCTTTTAATTGCTATGTT ATTGTTGTTGATATGTTGTTATAACGTATAATCGATTCCCTCCACGCTTT GTTGGGATCGGGAAAAATAATTTTTTCGGATTTGGGTATGATTTCAGCAA TATGAAAAGAAATTCATTTTATTAATCTTAAAGCTAACTAGGTCTCGCTC ATTCTCCTCTTTCGTCATATTGAGATTTTATTTCAAAACATTATGTTTTC GATATCGTAAATCAGTTTCTTTCCTTACACAGCCGTTTGCGACACATTTG CTTATCAAATAAACTCAAATCAACCAGCTCTGGCGCCTATAACGTTTGAA CGCTAACTTCAATAAATACTTAGCTAGCAAGTTTCTCCACGTCTTTTAAA AAGATAAAGAATTTTGCAAAACTAACTCGTTCCAATACCAAGGACTATAG TATAGGTTCGACAAAAAGCCACCGATTTCTATCTTATATGTCTTGGAAAA TGCCTTTATATCTTCAGTAATAGTAAAAGAGAAAGATGAAGATGAAGGCT GTGGTGAAAGATTCATAACAAGGAACAGGTTGGTTTCCAACCTTCCCTTC AATTAATACTCATCGAACCTTCTTGTCAGCAGTAGCGTGATGGAGACAGG GGGTAACTGAATTAATTACAATGACCCATATTTCGGAGAGGAGGCCCAAT GTAAGTTTGTCACCAAATTTGTTATTATTAGGGGATACCAAAGTGAGCGT TTTGGAAATATTTAGTCAAGGCATTCTTCTTGCTTCTGAGAACAGATGAC TTTGCGGTCAAAAGGCTTAAAGCTGTAAGTCTTTATCATATCTAATGTGT TTAAGAACCCATCTGGTTAGTGGAAGTTGTAGTTAAGAGAAACGCGAGAT TTAATCCAAGCTAAACAGTAATTGAAGAGTTCGAATGTTTCCATATCAAT ATTAGGATTGAATTAATAGGATTATGATTAACATTTTTTAAGGTGGACAG GACTTACTTACAATTATTGAGACATGTTTAAATCCAATGATTACTCTTAA TAACAGCTTTGAAAAACACATAATGAGTTAGTTAAGAGTAATCCTTACTG TAATCGAGAACCCTCACTGAAAATTGTCAATTCTTTTTCATTGTAACTAA GGATTTAAAGGCATTTTCAAGGTATTAATCAAGTTTAATCAAGTTATTTT TAGACTTGAGTACATAACATCTCACTGGCTGTTGGGTAGGTGGACGTAAA ATTAAGCCTCCACTACTTTAGGCCCAATAATCCTTTAAAATTTAGTTTGA AACTTTTCATGAAATCATTGATAAGGGACCAACCTTCAAAAAACATCAGA TGCTTTTCGAGAAGAAATTCTAACAAGTCATCGACCCAAGTGTAGGATGA ATGAATGAAAAATTACGATTTTAGATGCTTAAAAGATAAGCATTGATTTG GCTTTACACATAAGATTCGAGGATAGATATACGATATAGCTAAGGACACA CCTAACTGCTCAATACTCAATATTTATGAGCCGAAAGTATTTTGATATAA GTTCTACTTCTGATCAATCGCCTTAAGATTATTGAGGAAAATGGGGCTTA CTCGGGCTTATACGAAATGATGACCTCAAAAAAATCTTTTCCGCTACCAA GATTAGAAAAGAAAAAATATGAAAGTCGAAGTTCTCCTAGGCGATCAAAC AAAACTAACAAATGATCAAGTTTAATCAACTTGAAGAATGATTTGACCTG AGTACTTAGTTCTAAGGCGACTTTCCACAGGCGAGCCAGGTCCTTCCAGA TTCGAAAGAGACCTAAAGTCTCAGAGATCTCAATTCTCTGACATGTGAAT AATGTAAATTATTTACAATTACAAGTAGGTTTGCTTATTAGATCAACTTA AAGATCCTTGGCTGCCCTCTGAATTGTCCCTTTGAAATCAAATTTTACCG AAAGGGGTTTCTAGAGATGTCTTATGTCCTTAAAATGTCTGAAGTTTAGA AATTATCTAAGCGTATAAGGAAAAGTAAGATAACCATCATGATTTAAAAG TAGTTCCCAAGCCTCTTATCATTTTGGTAATTGTAAAAGGGTCTAAGTGC CTTCCCCCTGAAACGCCCATTTAAATACCCTAATAATACCTAATACTGAA ATTTTGAATGTGAATTTCTTTCTTTATGATCAGATTCAGATCAAAGTCAA GATTTGCAGTGTAACTCTTCAGATTTTGTCAATAGAAAGCTATCATACTA AGTAATATTTTCTAGATCGCCAGATAATACAGCTTTTCGACCGTGGCTGC CTATTTCCGCGCGGGCATTTTTTGTCTGTTTTACCACCCTAAAAACCGAC CCAGTCTTTTTTTGCACCTAAATACAATAGGAAAAAGTGTAAAAAAGGAT TGGGTCAAGTTTAGGGTGTTAAATTAAATCATAAAGTGGCACGAGCCAGA CCACGCAACTACGGTCGAAAAGGTGTGTATGTCTCAAACACTGTACAATC AAATTTCAATCGCGCATATATTCAAATTTAAAGAGATTCCTTTTATTTCA TCCAGACACTGGCAAATGTTATGAAATTTTGTCTTTTTGTCTGTCTTTTC AGAGACTTTGTTTCATAAACTGTAGCTTTTAATAACCAAAAAATGTTTTC AGAGCATGAAATTCTGTTGAAGGAGTGAATTATTATTGCTAAGAGAAACA GACCAGTTTCTCGGACATGATTACATATAGTTGAATAAACGGATTAATTG GTCTTAGACAAACTATCAAAACCATGCTAATGGGGTATAAAAATAATCCT GAATTCCAGTACTTATAGTAGCTCTAAAGCAGAAGAAATTAAAGACATTT GCAAGGTGAGCTGGTGTTTCAAATTTTTTGATTGAAGGGGTATTCATTCC GTATAAGGAAAATTGATAAAAAAAGATACCCTCTATTATGGATAATAGTT TTCTTTTAAGTTCTTTAACAAAAGGGAATTATTTTGTGGGTAGAAATTGT TAGGGTATAAGCTGCGAGAAATAGATAGTTTTGATATGGTGGAGTAAGCA TAGAGATAGGAAAATGAAGTGGTTTACTTTTCAATATAATGCACACCCCC TTCTCACAGACCCGGTGGGATTTTATCAGCCAGTTGGGGGTAAAAATAAC GGACCAAAACTCGATGGGGATCGATATTCCCATGTTTTTATGGCTGGGAT TTGAATTACATTGTTTTCTAGCCAGAAAATTCAGTGGAGACGAATATTTT ATAGTGGGGATTTGCTTATCTGATTATTTTGAGCGGGGACAAAAATTGGA GTATAATTTTCCACTGAGGACGATATTTTGGGCAATTTTTCCAGTGGGAA GGGTCCCAGTGGGTCTGTGAGAAGGGGGTGTAAGAGCTGACCAAGTGATT TTAGTTTTCTTATATTTCAAGATTCTGGCAGATTAGAATAAGCTGCCAGA GTAAAATCAAATTTGGTTAGGTCACAAATAATGTAGTTGTCATTGCCACC ACCATACCTTTCATAACAGAGGACGTTGTTTTTACGTCAGTCTAACGTTC ATAACGNCCACCACAATACCTTTCATAACAGAGGACGTTGTTTTTACGTC CGTCTAACGTTCATAACGTCAATATAACGATAGATGAACGTTAAAACAAC GTTTGGCAGACTTCTCATTAAACAGGAAACGGTAGGCTGGTAGTGGATAA TGGTGACAATATTTTGGAGTGATTATTCAATATGGTAGTTATGGTGGAAT TCAGTATGATAAAGTCAGTAAATAATTGATCGATAAAGTTCTATAAAGGT ATGTGTGATAAATAGATTTTTAATTAAGTGAATCGAGAAGGATTAGTATA ATGGTAAAAAAGGAGGAATCGGGGAATTTTGTTGTTCATAAGCGGCTTCA TCGTGTTATGATATTATATTCATTTATTATGATTAGGTTGATATAATAAG CAAACATTGGTAAACGCGATAGATCAAAGTTTCATTTGGTTTGTGATTTC TATAAAATTTTGTGACTTACATGGTTGGTTGATTTAGTTTAGATTTAGAT TTACAAATTTGGAGTTTTCAACTGACATATGACGTTTTGAAAACATTCAT CTAGCGTCAATTTAACGTCCATTTAAGACCATGTTCACACGTTACTGTTC CGTTTCGTTCCGGTATGATTTTTGTTGCAGATCAAGTGTGTTCACATTGG TTTCGGAATGTTNCTTACATTTAGTTTAGATTGAGATTTACGAATTTGGA GTTTTCAACTGACATATAACGTTTTGAAAACATTCATCTAGCGTCAATTT AACGTCCATTTAAGACCATGTTCACACGTTACTGTTTCGTTTCGTTCCGG TATGATTTTTGTTACAGATCAAGTGTGTTCATATTGGCTTCGGAATGTTT CGGAGCAAGAAGACGGAGCAGTTCCGTTCCGATGAAAAAAGTGTAGCGAA ACCGTTTCGATCTGTTTTGCTTTGTAACGTCTTCCTTTTTACGTTCATAC TTCACTTGTTTCAGAACCGTTTTGGAACGGAACGGAACGGAACGGAACGG AACGGAAGTGGTATTGGAAATATTGGATATTGCAATATCGTAACGTTTGA ACATGGTTTAAGTGTATAATGCGCAAATGTTGAAAACACAGTTTTTTTGT CAGCTTGATCTGATATTTCAGTAATTGATCGTTTTGAAAAGCGAAGGAGA TATTGAGTTTTTCCAGAAAAAATCGTTCATATGAGTGGGAGAGATATTGC TCTTGGGTATTGGAAGAATTATGCAAAACAAATGCTATTTCCTTGGTGTA AATTTGAAGCGTGTCCAGTGGGTAAATGTTAATATTCAGGGGGATCAATT TGATCATTTTCAAAGGTCAAAACACGTTTGCAGGGGTATCGAAATTAGGG GTAGATTATTATTAGAAATGCATTATAGCCTCCACCCCCATGAACGGATT TTTTCTGGAAATTCTATTGTTTATTTCAAGACTTGTCTTTTATAACTAAG TAGTTGAATATGTGATTTACAGTTTTGAGAATTTGGAAGTTTTGAATAAG AATACATGGATTTTAACCTCCTATAGTAAATGATCAGTATTCGTGACAAA CACTCTTGTATTAGTCACCAGTTGTTTTCTTCAGGTAGAATGATTCTGTT TTCCTGGTTTTTAATTAGTTTCCGTGTTTCCCTTTCATCTTTTTCGCATG TTTGAGAAAACAAAGCAGAATATATTTCAACTGTTAAAAAGATATCTTTG CACTACTCTTGAAATTAAAGAAACAGTTGAAAAGTTGTAAGAACCGTGAG ACTCGTTTCAAGTAAAGTATAGTTGAAGATCGTCACTTAGACGAAAGTGG TTTGATAGATTGATGAAAATAAGTCGAAAAGCCAAGTTTGTTTATGTTTC AAAGCCTTAATTTTGACCTCGTTATCGCACATAAGTTTGTTTTAGTTTTA GAAAGGATTATCATAAGATGATCAAGACCCTCTATATATCAAGGTCATTA AGATTATGGTTATGTTAGATTCGTTGAAAATCCTCTCATAGAAAGTTTTT CTACTGTATTTTGCTCTGAGCCTTATCAATTTGGATTCGAGTTAAATTAA GTCGAATGATATGACCTTTGTCTTAGTGAGCCTGCTAATTCAACACCCAT AGACCTTTAAAGTCATCAGATTCAGTTAACTTAAGCAAAGTTTAGTTCAG GGGCTCTTTCCTAGAATAGCAAACATCTGCCTTTCCTTGGACACAGGAAC GCAGGAGAAATGTTGAGTGGTTTGGAAAGCCAGCGTATTAAGCAAACGTA GTGAGCCTATGCAAGCGTAAGCAGCAGAAAAATACAACGATGCCGTTTAT TAGTCTACTTTCCTCTAGTCCTTGTTCGAGAAAGATTAGGCAAGAACCCA CTCTTAGAGCAGCTTAGATTGTAGACAATTTGATAAAATGATTAGTCTCA GATAGACTTTCAACCATGTGACTTGAAGTTTTTTGACAATGAGGCTATCC GTCAGGCACGTCCGAGAAGGTAATCCATAGATGGAGTTTTGAGAGGAGAG ATATAACTACCTACCATTTCATAAATATTAAGTCATTCTCAACCAATAGG ATAAGTGCTCTTAAGATTTCACCATTTCAACTCAAAGATAAAAATCTGAA AATTTCTGATAACATTTCATGTTCATTGACGGGAAAATGAACGTCAAAGA AATTTCTTAACTTAATAAGACCAGAAACAAATCACAAAAAAATCATCCTC TACTTGTACTTCTCACATGATTATGTCATCATAAGTCAAGAATTCCATTA CGTAATCGACTCGAAATGGTAGCTTAACTTTGGTTAACTTCCTACTGACG GCAAAAGAAGTCTTTATCAAAATAAATGTTTGCCGCACAATTATGAACCA TTTGTGAACTCAAAAAAAAAAAAGATTCTAGAGGGACCCTGGCTCTGAAT TGATATTATCTTATTATACTATCTCTCAACGTAAGGTTTCTTATAGAAAG CTGTTTCTAACAATAAAATAATGTCATCAAAAAGTGTCAAAATAAAAAGA AGGCTTAATAGTCAACGTAAGAAATATGACTAAGATAGGATAAGCTGGGT GATAATGAAAGCTCATGAAGTTGTGCTAATTTCGTAGTAAATAAAGCTGA AAAATTTTATAAGAATCTTTCAAACTTAGGCTTCATATCATTAAGATAAC CTTGATTATTCAATCTTAGGCGAAATTAAGAGTAAAGGGATTTACAAAGA AAAATACGCTGGCTTCACTGGTGGCCAATAAAACAAACATATTCTAAGAT TTGTTTATTTTCTGAAGCAAAAGATGTGAAGTCTACCATAAAATTTGTTA TGAATATTTTTGCAGTTTTAAAAGTTCTAAAGATTTGACGTGATGACTGT CATTACAAAATCTCACCTTCTATTTTGCTTATTTTTCAAAGTCACGCAGC GTTACGTGTGTGCTTTATGTTTTTGGTTCTTGAAAAAAGTTACTATTTAC GTGAATATGTGAAAAAATATCTCAGTTGCAGTTGTTGTTCTAAGCTGTTT GTATTTTCTTGGAAATTTGGAGTAAGTAGAAGACAAGTCTACGCAATTTG CTTTACCCAATCCAGCTGACACTCGCCGTTGTTACAAATGTTCATCTATC GTTACATGGACGTTATGGACGTAAAATGGACACAGAAACAATGTTGGGTG TAAGCTGGGTACTAGCGCAACATTCGTTTAATGAAGACCAGCTGAAGCAG AATGCATTAATAGAAATTGAAATCAAAGAGCGCTTCTGTAAATGCAGTAC AGTAATATCGATAGTGAAATTGAAGTTTTAGGGTTTTTAATGATCCAGCG ATATTATTGTTGTAAGCTTGATTTGATATAATAGCAGTTATTTGCAGAGG ATTTAGAATTTTTAGACGGTCTCTATGTGTTTGGTATTAAAACATATTTA AACAGTTAAATACTTGAAAATTCGAGAATTGACATAGCACAGTATTAAAA GTCTATCAAAATCAAATCATCATTCAACATTCATTTAGTTGGTCTTATCA AGGAGGAAGGAAATTAGAAGTTTAGGTTGCAGCGGAAAATAGACAAACCT GCTAAACAATGAAGATTATATTTTGATATGACGTGGTAAAACAGTCTATT TTACGGAAAAGTGGAGTAGAATGCATTTACGTTGTTTCAACGTTCATCTA AAGTTATTTGGACGTTAATGAGGTTAGATGAACGTTGAGATGACGCTTTC GTATCAGTTAGAAAGTTAGTAGAAAAATTGCTAGGATAACTAGAATAAAA AGCACTAGATCCTTATCATTATAAAAAAAACACTCACACGTGCTTAAAAA TATCAAAATTTAACGCTAGGGAAAGGTAATTGGAAGCCATGGTTTTATTG GCTTTGGGGAGATACAAATATAATATGATTTTGGATTTATTTTGATTAGA ATTTTGAGATTTTGAAAAATTTAAATAAACGTAAACATGTCGCTGGACGT ACCAAAGAATGAAGACAAAATTGCGACTTCTTTTATTGAAGACACGGTCA ATTCGGTAAGGTTTCTCATATTCTTTACTATAATTCATAGTTGTTATAGG GTAATAATGCCTCTACAGTCCCCTCTAGGCAGAATAAGTTTTAACACTGT GGAAAATGTTTGTGTATTTTCAAAGAAAAATGGCTGTGTAAGAATTTTTC ATTATTTCAGAGAAAAATGCCTGTGTTTTTTCTAAAGAAAAATATATGTT TTTTAAATTCATGGGAAATGATTCTGTAAAATTGCAGGATCCAGAAACTC CCGTCAGAAAAATAATTCATTTCAGAGGAAAACTTGGTTCTCTTTTTTTT GTTTCTTTTGTATTAGAACTTTACTTTACTGTTCAAGAAAATAACTTCAA AATTCCTTCCTAGCAAAATGCTTAGCGACAGATCAAGATAAATTTCAGAA AAGAGCTTCCAGAGGCATTTTCCTTAGCACCTCTACAAAGCTCAGATCTT TCCTGATTAGTTTGGCGTCATAGCCTATTGACGTAACGGCGCTTACATTA ATTTCACTTAATTATCTTTAGAAAAGATAAAAAGGTTTCGATGCCCTAAT CGAATTTTAAAGGTATTAAAGTTATAAAATGGGGTAGAGTTTAAATTATC TGTATTTTACATTTGGATCTTCAAGCATAAGAGTATCAAATTTATAAAAG TCTGAAAGACGGTTTATTATTTTGAAGACTTCAGGAAAAAATGGTCCGAC GGGAATGTACAAAACAACGAGCAATCGTGAGTATTAGAAATTTTTTAACA CCGGACACAATATTCAAATTGAGCGTTTGTACAATGTCCACAATATCTAC ACAGTAAGATGGACGCCTAACAGCAATATTTTGTGTTAGCCTGGGTTTTT TAAAACGTTTTTTGGCGTTTGTGAACCAGGGTAGAAAGATAAATAATGGT AAAAAGTAGGTCTGGAGGGTTAGAAATGCCGAATTAAGTTGGCAGTTTAA TTTCACTCTATACTTCATTGTTCAGATTTCAGAATAGTGTGTGACGTATT AACTGATCTAAATCTTCCGAACTAAACCGTTTCGAAGTTTCACTTTAGAT CTACGGCAAAAGTTGCGCTAGTAATACTTCTCAAGAACGAGTCTGGTTAT GAGACGNGTGCATCCTCCAAGTTTCACTTTAGATCTACGACAAAAGTAGC GCTAGTAATACTTCTCAAGAGCCATTTTGGTTATGAGGTAGATATAACGA AATGAGAAGTATTTGACACCCACTCTTACCCGCCCTCCTGGTTGGGAGGA GTTTAATAGCATTTTTAGACTAAAATAAGTCTTTTTAAATCTATTTTTCT ATATATAAAGTAGTGATTAGCAACCGCCAAATGTGTTTGTAGACCGACGA CATAAGCAATAACGAATTAAGATAAAGCAAGGTCTAGTCTGTAGATTGTA TGAGTAGATTGTACTCGGTAGAAGAGTTTGTGAAAACCATGTCACTGGCA TATAACGAAATTTTTGAAGGCGGTTTCCACATGCTATGGTTATTAGTTTT CATGGCTATAATAATTAACCTGCAGGGTCAGTTGACTAACTGTAGGATGG TTTTTGAATGAAATATTTCCCGATTAATCGCTAAAATGTCTGACAGAATT TATAAATAAATAAGAAAAAAGAGTTTATGGTTCGTACATCATTTGTTGTC GCGGTTTATGGTTTCAAGGGGATAGAATTACATTCTGAAATGGCCACACT TACTTGATGTTACTCTGTATATTTTAGAAATGTGTCTTTGTCGTGTGTGT GACCATTGAGTTCCACTTTCAAACAATCGATGTTTTCGAGGTTAGATGTA TCAAGTTTGGAAGGGTGTTTTGATATTCGGTTTCTTTATGAGTCTTTGAT TGATTGGGATCTAAGATGGAGTGTTTGTAACTCAAATTCGGTAGAGTGAA TTCCACAAGTTTGAAATTTGAAGCGTTTTGTTAATCCTTGAATGGGAACG ATAGTTAATGCCATTTAAAAGGGCCGTTGAGGGGCCAGGTCGTTTCTTCA TTTTCTTCTCCTTCATTTCTCCACCTTCCCCGTATTTCTTTGGGTGCAAT TTTGTTGGAACGATAATATAATGATTATATCATAGGTCGAAAGGGTGTTG GAATAGCTCGGCTCCTACGGAGAGGTTTTTGGAAATCTGATCTATGAGTG CATTTAAGAATTGACGTCTAGGAAGTATATTTTTGATGTTTGTTTTTGTT TTTTGAAGTTATGTAAGCAGGATATTTTTGTTTAGCGGTTTTTTTTTGCG CCCTGTGTATATCATTGTTGTTTTTATCAAGACAATTGTACAAAGAGGAT TAATATCGAATGGATTTCAAAGTCATGTTATGAAGCATGTGAGCTAGCCG CTCACAACTGATTTGTTTGTGATTTTCGTTCACTTTTTTTCAGGAGATTG CAAAGAAGACGAAACGGGGGAGAGATGATTTAATCTTTTTTATGCACAAT ATGTGATGCTCTTTATTGAGTCTCCACTGGAGATGTATTTGATTGAGTCG TTTCTTTTAAAGAATTTCATAGCTTCGATAAAACACTTGAAGAAGCAAAA ATTATTTTGAATTGGATATTTTTAAAGATCGGAGGCTTGGAGATTTGCAA AAATGAATTTTTTGAGTATTCAAGGAGACTAGGGATGCTTATTTTTCTAA CTGAAAATCTAAGAAAAATAAGAAAAGTACTAGTACTACATACACACCAA AGAAAACTTTCAACCATAACTGGCTTTCCCATGGTTTATTTTCTTGGTCA TGAGATGTTCTCACCAAAAATACTTTCAAGCCATTAAATCGTTAAGCCAT TAACTCTCTTAACCAAGAAAATAAACAATGGGAAAGCCAGTTTGAAATCG ATCATATCACACTTGCCTTTCTGAAGTTGTCAATATTAAGCTTTTTTTCA TGTAGTTTTTCCATTCTCATTGTTTGTTAAAGGCCATCCATAAGTTTCCT TGGATACTCAAAAGCTCGTATATTTTGGAATTTCACTCAACACCCGGGCA AACAGTACATGCTTTTTCAAAATGATTCATTCACATGAAAATGGTTTTTG TCAGATTCTTCATTATGAAGGGATTCGAAGTAGGAAGAGAATTTTCAGCA AAAAGATTTTGCATGTACTAACGCGACAACTTTTCACAATTGTATTTTGG TGAATTTTTTAATATCACTTGATTTTCGGCTTTTCCGTGAAAATCTCCGC AGAAAAAAGTCTTTCGGTACAAATACTATACAAAAGAAACTCAAAATTGC TGAAAATTCTTCATCTTTCTTCACATTGTAAAAAGCCTGTAAAAGTCAGA TACAGTATGCCTGCTATGACATGGAAGTATACAAGTCGTAAGAAGAAACG ACGGACGATTCGGATCAATAGTTTGATTAAGAAATATGTAGTTCCTGATC ATATACGATTGAAAGTTCAAGTAATTAGTGATTTTCTTCTATTTTTACTT ACATACCAACTTTCCAAGCCGACATCAGGCATCGTTTTAAAGTACCCTTT ATGAACTTTAGATGAACGAGCGTTATGGTGCTTTATACCTAGCGGGATAG GCAGGTAATAGAATATTTTGTTGACTTCACTTTGTTGACATAATGCCAGC CTTTCCATAAAATACTGTATAGTGATTGAATCTCAGGTTTGATATGATGT ATTAATATTTTCCCACCATAGTCTAAGGTATTATTAATGACTACAAAAAA AATCCCTAAGATTCGAACTAATATCTTAAGAAACTAAGTGATCAATTACA AAATCATAAGTTTTGAAAAAGCAGGATTAGGGTATCCGTCCCACACTTTA TAAAAAAGAGTGGAGTCTTTTATAAAGAAGGCGGGGATATAAACAGCCTT AATCCTCCAACGTAAACAAAGCAAGGAATAGAGGCTATGAGCTCCTTTAG TGGGGAAGGATAGATGGATCAGATGGTAAAAGGGGGAGGCGCAAAATATC ATGAGAATCAATAGGTGCTTGAAAAACGTATAGTTGAAAAAAATCAAATT AAAAACAACAAGAGCTTTATCGTTAAATACGGTATAGCTAGAAGAAGGGT TTTAGCTTTTGAACGAACCGGGAGCATACCTAGATAGCACTTTTTACGTT AGGGTGAAAGCTTTGAGGAAGTTCATAGCGAATCAAGAAAACGCGGCGCG ACTTAAAAGAACATGTTGTATAAATTAAGAAACCTTTGCACGATAAAAGA GAAATCAAGAAAATTAAGTAGTGATTATCGAACCGCGATGGCAGCTTTGG GATTAGAAGATCGTCATTACTTGCAGACCCTTGTAGAAGACACTTTGGCA GATAATTTTTTACCACGAGCGCCGGAAAAAAGGCGTCAGTCGATATGGGA GAAAGGCTCTAAAATGATTCAAGAGTCTTTTACATCAATGAAGCAAACTT ATGACGAATTAAAGTTTAGATCACCAAGAAATTTGCCTGAAAATAGTTTG GTATTAATAATATTTGTATAATTTATACAAAATTTTCATTAAGTGAGAAT TAACTGTTTTCTTCATGTTTGCACTGAACTTGTTAGTATCAAATAAACTT TTGTTAAATGATCAATTAGGTCCATAAAATCACAACATCGAGTTTCAAGA AATATATTTGGCCATTTGGCTGTCCCTTTACTTTTCCTGATGCTTGAAAA TGAAAGTGAAAATAAGGGGCTCAAATATGGCTTAAGTAAAAGATTGTTCT TATGCAAACAAATCTTTGCTCCTGTTTTGAAATTTGGTAACGCTCTGGTT ACGGTAAGTTGAGGGTAAGTTATATTTTTTCAAGAATTGAATACAGTAAC TTAATGACTTTTTCCTTTGCATTTTTAGGCTATGAAATTTACTGATGAAC AGATTGAAGGTAAGCTTCGAGCACTTTTTCGTTTTGCTGTTCTACTTATG TCTGTTACAAGGATTTTCGTGGCGCATTTTTCAATCTAGATGATTTCTTA GCAAATGTAGTGGAAGACAAATAAAATTTTTAGATCGGTGGAACAAATCC TATTTTTAAAAACGCTCGGTTTATGGTAGGGAGATTGCTGACAAAATCGT TAATCGTTAAGGTGGTCGTTAACAAACTTTTTGAAAATGTCAAAAAATAT TAAAATTGAAATATCTCAAAATGTATAAATGATATATTGTTGAAATTTTG TATCATGATACTTCATTATTATCAATATCTAAAAATAGAAAAAAATGTAA GAAATTTTAAAGACGGGGGTCATGACGTCATTTCTAAAAATAGATATCAA AATCTTGTGGCAGAAGAATCTCAACAACCAGATGGAGTTAGATTTTGATA TTTGGCAGTTATGTTACAATATTGACCTACTGTGTTTTGAGTGAAAAAAA TTTTTAAAAAAATCAAAAACCGGGGGTAAAAACGCAAAAAAATGTTTTTT TAAATTTTGAAATCAACAAGACATTTTTTGAAAAATCTGTTTCACTCAAA ACACCCCTTGCACTAAGAGAAAGCTGTGTACAAAATTCCAATTAAATCGG ACCAGCCAATCCTGAGATTCTTCCGCCACAAGATTGAAAACCCCCGGTTT TGCTGTTTTGCGTAAACTGGCCTTAAAATTAATATTCCTTTCGGGTAGGC GAAATATTTCGTTCTCTGGGCCAAAACATGGCCCTTGAATGTTACAGTCT AGGAAAATGCGTAGATCTTTATCTTACAAAGAATGATTTCTTCTTTATAG AGGTCAAAGAAGCATTTGCAATTTTCGATAAAAATGGTGATGGCACAATC ACGACGAAAGATTTNCATTTGCAATTTTCGATAAAAATGGTGACGGTACA ATCACGACGAAAGATTTGATTACGGTCATGAGGTCGTTAGGGAAAAACCC AACAGAAGATGAAATTGACGACATGATTAATGAAGTGGATACTGATGGTG AGACAAGATTTTGCATTGTTTCGCTATGCTTTTAATGCAATTTTGATTGC TCTAGTTCTACCCAAATACATACTTTTCCAAATTGGCTATTCCAATAATT CTACCAAGTCACTACGGTAATCCGCTTTGGAAGGTCAATCCAACATTCAT AATTGCGCTGCTTTAGCCTAAAAACCATAGACCTATAGTTCCAATTTAAT TTTTTTGTTTTCACTATAGGTAATGGAGTGATTGACTTCATTGAGTTTCT GGAGATGATGGCCAAGATGTCAACAGATGTTGATGAGACAATCAAAGAAG CTTTCTACATCTTTGACAGTGATGGTTCAGGTGAGAAATCAATTTTTAGG GGTTATCTCCTCCATTGGGGCTTTTCCAGAACTATACTGTAAACCCCCTG TTGAGGAGGTCCATTTCCGTTCCAATGGGGTATGGTTTGATATGTGGTGG TGTTCAATAAAAATAACTGGAATTACATCGACTTTGTTTCAACCATCAAA TTAATCCTAGAAAAATTCAGAATCTTAGAGGATGTTAAACCTAAATTTTC CATTTTTCTGGAAAAGCCAATTGTCGCTAAGTTTAACTGGACAGAGATAT ATACAGCGCCTTGTAAATTTAAATGCAACTCACTTAGTTCTTATTGTCTG GTTATTTGAGTTCTCGTGTAAAATCTTCCCGTTCTTAAGTCCTATTTTGA ACCCCTTTTGAAAACAAATAAGAACTAAATTTTCAAAATTTCCTCTAATA ATTTTTAGAGCAATTAAAACTTCAAGTCAACGTTCACATGAGTTTTTTAT GGGTATTTCGGTGGGGTATAGGATGGAAATATTTTTCAAGCGGGATAGCA GTATAACACGGTCTAATCGTCTTATTATTTATCAGGTGCCATTAGTTCAG AGGAGTTTCGTAAAGTGATGATGACGTTAGGTGCTCAAATGACTGACGAA GAAGTGACAGAAATTATTGAAGAGGTTGATGTGGATGGTGATGGTCAAAT TAATTTAGAAGGTGCGTTTAGTACACTTTCTCTTTTCTTAAGCAGCCATG TGCAAAGGTAGAGCATCCAGCTACGGTGCACAAGGTCGTGGGTTTAATCC CTGATTGAGTATATCTTTGTACTTAGTGCTACAATGGTGCTTGATATATC ACTCAGCTTGCTGCTCAGCACTTAAGAGAAGGATCAAGGGTAAGTGGAGC AATCCAGGGAGAAAAAGTGACGCCTTCCTCTACCTTCAGGTAGATAGCTA TCGAAAGAGGAGCCTTCGGGTCGTCTGCAACTGCGGCCACAGATTTGATT ATTTACTACTTAGCAATTCTTACTTTTTAGAATTCGTTAACATGTTGAAA GGTGGAATCTAAAGAAAACACTATAACACAACCACTACAACAAATTATAA ATGAATTTGCAACAATCAACAAAAACGAAATTAATAATTCCGACCCCGAC ATTGTGCAGTGAATAAAGGCGGCGAAAAAATGTGAGCAGAAAAACATAAC TTGCAACAGCTTTCGAGTCTTTGAATACGATTGTTTTCCGACATGATCCG TTATTGTTATTTGAGCTGGCGCATGACGTCTATTTGACGTTGTTTGGGAT GTTATGGACGCAAGATGAATGTTACTTTGACTTTGTGTACCCGCTTGAAT GCGAGTTGTTGGCGGAATTGGAGGAAAACAGAACAAAATGGAAATCTGAT GATCGTATGCAAGATTGAGAAATGAATGAATCCATTCACAGAAAAAAACG TTGAATATTATGAACAATTTTAAAATATAAGACAAAAATATTTTTAATAC ATAATATCTCTTACGTGCGTATTTCAGGAACTGAGCAGAATTTCTATGTC TTTCAATGTGCCTTTGGCGAAAGAAGAAATACTTAATTAATTGAAGTTTA ATTCAATTGGAAAAATAGTTACTTAGTTGTTTTGGCTAAAATTATGCTCA GTTTCTTTCAAAGATGAAAAATTGTAAATATAAGAACAAAAATGTACAGT TTTAGAAAATATAATTAAATTGAAGAATAATTTCTGAGATTGGCTGTAAA ATATTAACCCATTTCCCCCAAAAAACTGGTCCCNATATAATTAAATTGAA GAATAATTTCTGAGATTGGCTGTAAAATATTAACCCATTTCCCCAAAAAA ACTGGTCCATAGATGACACAAAGTATCAACCAACGAAGTATAAGCCCGAG AGCTAGAAGCCAATCTCCTTGGTAGGTTTTGAGGCCAACAAATCCTACCA AAGTTGCGCGGCCTATAGTGCAACCCGCCTATTTTTTACACAAATGTCAG ATGAAACTAAAATCTACCGCTAAATTTCGGAAAAATATATCACTCGAAAA CAAAGGAATGCCTGAGAAAGGTAACAGAAAGGGCTTTTACTTCATTGGTA TTAATCTCCCTCACAAAAGTACGATACCGAGTACCTAAACGAAAGCAAAA ACTTCGGCGCTTAAAAAGATTCTTTGAGAAATGAAGTCGATCTATTTTTC CGTCACAGTTAAAGGGAAATTTGGACCAGCGTCATATTTTCTAACTTAAA ATGACCCGTTTCCCAGCCTATCTGATAAACGACCACACCCTGACCACACC GAACACAAGTCTACTAGGTTGCCTCCAGGTCCTGAAACTATGTCCTCTTG CCGGATTGAAAAAAAATATTTGTGTTTTTGGCTAAATTTCAAGAAATAAA GTGTTTACTCCATTTCCAAGACTCACCAGAGTCTATATACCTTTTCGACC ATAGTCGCGCGGTCAGGTGCGTGCCACTTTATTATTTAATTTACCACCCT AAACTCGATCCAATCTTTTTTTACACTTTTTTCTATTGTCTTTAGGCGCA AAAAAAAAAGACTGGGACGTTTTTAGGGTGGTAAAACGGACGAAAGTACC CGCGCGGCAATTCGCGGCTACGGTCGAAAATTTGTATAGTTGAGCTTATT TGATTTTTAAAGTATCAAATATTACAAGCTTGGTTATATCGCTGCATCAC AAATTCTAAGCTACTGAAGCGATCATTCATTATTCTGTCGGAAATATGTT TTCATTTCATCAATAAACTTCGAGTAAAAAATAAGTATAATCGCCTTCAG GACCAAAACATTGTTGTGATTCATTGGTGAATGTCATTTTTAAACCATCA TTACCTATATAAATATCTTTGAAAGGTCATTTTTCTGTCAGAAATATGTT TTCATTTCATCATTGAACTTCGAGTAAATAATAATTATAATCGCCTTCAG GACCAAAACATTGTCGCGATTCATTGTTGAAAGGTCATTTTTAAACCATC ATTACCTATATAAATATCTTTAAAAGGCCATTTTTCTGTCACAAATATGT TTTCATTTCATCAATAAACTTCGAGTACAAAATAATTATAATCACCTTCA GGAACAAAACATTGTCGCGATTCATTGGTGAAAGGTCATTTTTAAACAAT CATTACCTATATAAATATCTTTAAAAGGTCATTTTTCTGTCAGGAATATG TTTCCATTTCATAAATAAACTTCGAGTACAAAATAATTATAATCGCCTTC AGGACCAAAACATTGTCGCGATTCATTGGTGAATGTCATTTTTAACCATC ATTACCTATATAAATATCTTTGAAAGGTCATTTTTCTGTCAGGAATATGT TTCCATTTCATCAATAAACTTCGAGTACAAAATAATTATAATCGCCTTCA GGACCAAAACATTGTCGCGATTCATTGGTGAATGTCATTTTTAACCATCA TTACCTATATAAATATCTTTGAAAGGTCATTTTTCTGTCAGGAATATGTT TCCATTTCATCAATAAACTTCGAGTACAAAATAATTATAATCGCCTTCAG GACCAAAACATTGTCGCGATTCATTGGTGAATGTCATTTTTAACCATCAT TACCTATATAAATATCTTTGAAAGGTCATTTTTCTGTCAGGAATATGTTT CCATTTCATCAATAAACTTCGAGTACAAAATAATTATAATCGCCTTCAGG ACCAAAACATTGTCGCGATTCATTGTTGAAAGGTCATTTTTAAACCATCA TTACCTATATAAATATCTTTGAAACGTCATTTTTCTGTCAGAAATATGTT TTGTCTCATCAATAAACTTCGAGTACATAATTATTATAATCGCCTTCAGG ACCAAAACATTGTTGCGATTCATTGGTGAATGTCATTTTTAAACCATCAT TACCTATATAAATATCTTTGAAAGGTCGATATTCTTTCTCAACATTGTCA GCAGATAACAGGTCATCGACTGCATCAATTGGGTAATTGTTCGGCACCCC ATTCAGATTGGATCTCCAATAAGCTGTTCTCTCCACAGGTCGGCTATCAC TTTCTCCTGAGAAATATCGTATAACATTGAAATCGGTAGCAGAAGATTGT CTTTTGTTGCCCAGTATAACTAAATCTGTTGTGTTTCGAACACATTTCAT ACGTATGGTTTCAAAGTTCATTAGTATTTTAGCCATGCGTAGAAAGGACG CATGCGCGCGATAATTATTCTCAAGCACAAGACCATCTTCCATTGACGCA GCTGTTAGTTCCTTCACTGGAGTTTGGATTGTTGTGTCCATTTGGGTAAA TCTCATAGTTCTTCCTTATTTCAGAAAAGAAAAAGAAAATACATCAGCTA GTTTAAAAGTTTCAGAAAAGTATAGATTTACAGTCAACTCGTTCTAATTC AAATTCTTATCATTCGAGTTTTCCTGAAATTACTCTCTGTAATTCGAATC AAATTTTTAGTTCCTTAAAAGGTGGGAGTCTACCGTAAAATAAAAAATCA TCGAAAAGATTTTCGAATTCTGGTTTTTGGATGTTTTGAGATCCTAAGGT CTTTCTGAACATCTCCTGAAAATTTCAGAGCTTTATCTTTATCATTCAGG CCGCAGTGAGCATTTTTATCCTGCTGGGTACTTGAAAAAATCGCCCTAGC AACGGAAAAAATCCCGTTGCTAAGGACTTATTTCTTCAATCTTGGCCGAA ACATAGCAATGTCATACGCCAAAAGAAAGCTCTTTTTACGCCTTTTTCAA GCGTCAAAATATTATTTTCCGTGGTATTAAGTAATCCTTAAAATTAAAAA TGGTAGCTTCAGTAGTGGAACACATCAAATCATGCTGAAAAGCAAGCTGT ATAAAGCATCATTCTGCAGATTTCTTAGCAAGTTTTAGATCAAAACTTAA TCTCTGTGATGGAAATGATTTATTTAAATGAAGAATGGACTCTACAGAAG CTATAAAGTTGCTGCACATTGGTTATGTTGCTGGATTTCTGCAAAAAACT TTCAAGTTGTCGGCATTTTGTTTTGAGCATAGACAGTGTGCTTTTGGTGG CTCACATAAACTTTTGTAGTGGATTTAAATGTAACTGAGATATTTCGAAG CACAGCATGATGTAACAGAGATAGAAATGTGCATTATAATGAACTGGACC AAACTTCTGGAGACACACATTCTCATCTGACACCCGCCATTCATAACCGC CTAGCCTAGGCGGTAACCGAAGGCGCCTTTGGTCAAGCCAGTTCATTGTC AATTCAAGTCTATGTGAATAAAAATATGAATTAGAAAAGTTTCCATGCCT ACAGAGAGTCATGCTGGACTTTCAATGAACCACTGATGTGTCTGTTTTCA CCCAAATTTAATGTTATCGCAAGATTACTGCAAAGTTTGCTATGTTTACA TAACTTTAGCTCAACATTTTTTGTTGATTTTTGGATAATTTATCAATTGT GAAATGTTTTAACTTATGAAACCTGACTGGTTTGATAAGTATTCAGTGAA AAAATTTTTTGAAAAGAGCTTTCCAGCTTAAAATGATACCCATTTTGTCT TTTTCTTTGATTTTCTCAAAAACGCGTTTCCGGGGGTTTGCAAACACCTT GTCAGAAAAATCTCAGGATTGGAAAGTGCTAGAGACTTGAAATTTTCGGG GAAGTTGCCTGGTACGATTGCATGGAATGAGTTAATTGAAAAGTTTCAAA ATTGGTTTCCTGATTTTTTATTCCAAAAAAATCAGCTTTTTCAGTTTCTT AACCCTGGAAAAAATTTTTTTTCACTCATTCTGTAATTTATTCCATATAC TGAACTTTAAAAAAAAAAAATAACTTTGTAGGTCAACTCAGTGTTTCAGA AGCAAAGCACAAGCACGAAGCACAAGCAAAATATAGTATTTGACCCCCTG ACTGATTTCACCCCCTCCGTGGTTATTTTAATTTTTTTTCTAATTTTAGA ATTCTTAATAGTTGATTATCATTTCCTGAAAATTTCATCAAAAAATATTA AGCGGTTGTTGAGTTATTGCAAAATATGTAATTTTTTGTCTTTTTAAATC TTTGGGTAGACTCTCACCCTAAAGATCAATTTATAGAGAGCCAACTGCAA ATCTATCCAATGAAATAATACTTAAATAAACTAAAATTTCGCGAAATAGC TTTCTACATTTTTCGCGGAAAAAATAGCGAGTCTACCTATAATTTAAGAA AATTGGAAGAAAATTCTTCCTTCAAAGTAAATGAAATTATCTTCCGAACC TGAACATCGTATATGAATTTTTCGTTGGTCTCTCCATGGATATATTGTGT ATCGTTGCAAACCGTTTGGTATATTGAAATGTTCTTTCAAAGCAATACAG GAAGCGTTTTTACCAAGTAAAATGTCTAAAAAATAGATGATTGATTTGGT AAATGAATTTTGTTAAATCATCCCGCCTACTGTCAATTGGATAATAGTTA GAACGACTTTTGAAAACGTTTGTAAAAAAAAAACGTTATGCAGATTGTAC ATGGTGTCTGGAAAAAAGCATCAAGTTTGAACATATCATTGCGGGGAAAA GTTTGTGCGTGGATCATCGCCGAAATATGAGAAAGCATAGTCTTATTATA TAGAAAAGTTTGTTTTTTAAAAGGTATTAATCGATAACCTTTTTTATTAA TCCTTTGTTGCACAAAATATACATATTTAAAAAAGGAGGAGGACCTTAAA GGCTTTGGGACACCATCCCACCAACCTGAAACGCTTTTTCGTGTCTCAAC CCCATTTTTATTTCTTTCTTGTCTCTGGGACAATGGAGCAAAATTGATTC GAATATTCTTTTTGGGACAAAATCAGCGTGTCTTTTGGGTATTTCCCTCA CTTTTTGTCCCATGAACAAAAAAAGAAACCATGGGACACACACTTTTTTC TTGTGTTGGTGGGATGGAGCATGTTGCATTGCACCAACGGAAAAAAAAAT TCTCGTGTCCCCAAGGCTTAAGATACAACTTTGTGAAAATACACATCAAT ATTTATTTCTCATAGTTGTGTTTCATGCATAAAAACCCCCACAAAGACCT TCCCTTTTCACAAGGTAACCTTTAACACTACATTTTGAAAAATAGACAAC ATTTACCAATAGACGTCTAGCAGAATAATACACGATGAAACAAATCAAAA TACAGAGATTAGCATTAAATTAGTGAGGGCCAGGGCCAGGGCCAATTGTT TACTTTTAGTGGGATTATGAAATATTAGGTTGTGAGTATCCCTCGTTCAA ATGATGAAATTTTTTTAAGTTTAGGAACGTAGAATAATTTCCCCCATTTC TTCAATACATGACGGATATTTTCTTTCGTTAAACAACCCCCTAAAAGCCC GAAAGATCTCTATTTTCCTCGAAGTAACGAAATTGTCGCACCCTTTTTGC CACCGCAGGAAGCCTAAAGCTTCCGAGGATGGCATTCATAGCTTCACTCG TGAGGGAAAGTTGGGAAAACATCTCATAANNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTATCTCTA TAAGAAGATATCTATGAGATGGACACAACTTGCTAATATTTGTAGACTAA ATTTTGCTTCAGATGAGATGCCATTCTAACAAAAGTAACGGCTATTAGTA ACATTTCTTTCCAAATTCAACAACTTATTTGATCGTTCTTCTGCGGTGGC ACTTTAATGAAAATTATGGCTAGTTTTATCTTACCTTGCGAAATCGTCGA GGGTGTCAATGGACCTTAAAAAAAGAAAAGATAAAAAAAGGATTTTAACC AGCATTGCTACAGTCTACACAAGAGATAACTTCAACTTTCTGGCCTTTGA GGTTTTATGCTTAAAACGAAGGATGGTAATATGTAGCCCAGCATTGGTTA AATCTTAAATTGTAATTAATTTAGTCAGAGAAACCGACGTTTTCAATTCC ACGGGATAAAACCCCGGGGGGGCTCAAGGTAAATGAGTGGAGCCAATCTT TACTGTGAAAGCACAGGCTGAAATCATACATCGCCCGGTGCCGACCAATC CAGATTCTATTCAGCGCGCAATTAAGGCAGAGAAAAGTAACCATGACGAC CATCCAAGATCTTAGATTAAGTTCAAAGTTAATATTTTTTTTCGCGTCAT TGAAAACACAACTTAAAAATGTCATCAACACCTTTTATAAAGAGTCAAGA ATCATAACATGAAGATTTGTCAATTATTTCGATTCCATTAAAGTAACATT ACCAATTAAAAGTTAGTAATTACTGTTTGTTATACATTTGGGAATCATGT AGAAGATTTTTTTGAAAGAAACCCATTTCAATTACATTTGGAGATTTCTG AGGAATTTGTCAATACAGGGTGTCCCTAATTAAAGTATCGAGTTTGAACA TGCGATTGAGTAGAAAAGTTTTTCTTTCTACTCATAGTTGTGTTTCGACT CGATACTTTAATTAGGGACACCCTGTATATCTTTATTACCTTCATGGGTT AACTGTGTCCAAAATAATGTGAATTTTTACTACAGGGTGTCCCTAATTAA AGTATCGAGTCACACAACTATGAGTAGAAAGTTTTATGTGCGTGTTCACA AAATTGTATTTTAAGCTCTCCCTCTTTTTTCTTTGTCATTACGATTAATT TATACGTTGTAACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNT GATGGAGAACGTTCTTATATTTTAGCGATAACACACACACAAACTTTTCT ACTCAATCGCATGTTCAAACTCGATACTTTAATTAGGGACACCATGTAGT GGCTGCGTTTAGACCAGCCTGGCATTTATAATTGCTTGCAGTATTCTTTT GAATTCTATTGTTCCGCGCAATTGTTCGGTTTGTCAAATGCCTAAAGATG CCAGCGTGTTGGCATTTCGTTGGCATTTGAAATGCCATTTTGAGCAAAGG AATCCCCTTTTCTTGCATTTCAAATCAAACAAAGGAACCAAAACAAAGAG AAAAAATGACATTTTTGATTTTTTAAAGTATTTGCACGTTTTTTATTCAG TTCTTTCTATAGATGATAAAATTTGCAAGATTTGCCATAGCTTAGCCCTA CGGCAAAAAGTTTCAGTCTTTAATGACTGCAGTTTTTCAGAAATTCCATG CTTTTCATTGTTTGATCTGTCAAAGTTGAACTTGAGGGAATCACCTTTTC AGTAATGACTCTAAAAAGACGATTCCTTAAATGCCATGACAGAAAATACA ATGGAAAAGCTATTAAAATCGAATCCCTCAAATGCCAGTTGGTCTAAACG CAGCCAATATGGTAACATTTGCTCTTCATCTTTGATTATTTCTTCGCAGA CTCCTATTTTAGATTCCGGGGGTTTACCTTCACTTAATCCACGTTGCCAC CACCAGATACCCTTCGTGAAATTAAACTTTCGAACTATATTCCCTCCAGC CTATAAACGCAAGATTTGGGACTTTTCTCGTGCTGATGAGAGGGGAATCG TGCTTGCCCTGAATGCCATTGATTGGGAAACCTCCTTTCTGAGACTCGAC GTAGAAGATTGTGTTGCTCTTCTTTCTGAATATATACTTAATATTTTTTC TAAGTTTGTTCCAAATAAAACTATCACTATCAGAGAGAAAGATGCGTTAT GGTTGGCTCCTGAGATAAAGCAGATGATTTTGGATAAGGCTAAGATATAT CGTCGTTGGAGAAAATGGGGAAATCCTTTAGATGGTCAGGCACTTGATGA CTTAGTTGACAGGTGCAGATTGGCCATCAAGACTGCCAAGGACAAACTAT TTGTCTTGGCAACTCTTTAAATGATCCAAACATAGGAAGTAAAAAATACT GGTCTACTCTGAAGCAGTTTCTGAACGTACGTAAAACCCCGAAAATTCCA CCTATTCGAAATGACAGAAACATCCTTGTGATGTTTCTGAGAAGGCCAAT ATTTTCAACTCTTTTTTCTCAAACCAATGCTTGATTATCGATACTGGCAG TGTTTTGCCACCTGAACAATTTCTTACTAACTCTATACTCGATAATCTTG TATTTGAAGAAGAAAAAATCGAGTCTATTATTAANNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNAACAAGGCCCATGGGTGGGATAATATTTCTACT CGTATGATCAGAATCTGTGGTAAGTCTCTAGTAAAACCTTTGCTTAGTAT ATTCAATCTTTCTATCAACTTTGGCATCTTCCCATCACAGTGGAAGAAAG GTAACGTGGTTCCTGTCTATAAAAAGGGAGGCAGGAGCATAGCCAAAAAC TACAGACCAGTGTCTCCTGTGTTTGGAAAAATATATGAAAAGTGTATTCA TGATACACTTTACAGGTATTTTGAAAATAACAACTTATTTTCTCCTTGCC AGTCTGGTTTTCGGGAGGGGGATTCCTGCATTTCTCAGTTGTTGTCCATA ACACATGATATTTATACAGGGTTTGACAAAGATCCTTCTCTAGATACCAG GGGTTGTTTTTAGATATTTCAAAGGCATTCGATCGGGTGTGGCACGATGG CTTACTCTTTAAACTCAAATCTTATGGGGTGACTGGACCGTTGCTTTCCT TAATTCGCAGCTTTCTTGACGATAGGTACCAGAGAGTTGTCTTGAATGGG AAAACATCTGAGTGGAAGCGAATCAATGCTTGGGTACCTCAAGGCTCGAT TCTTGGTCCATTGTTTTTCTTAATTTATATTAAATGATCTTCCAAAAAAC CTTGAGTCAAAACCCAAGATCTTTGCTGACGATACCTCTTTATTCTCTCT TGTGATTGATCATCTCTTGAGCCTTGAGGTACTTAACAGAGATCTCTCCA GGATAACTAATTGCGCTCATCAATGGAAGATGTCCTTTAACCCCGACCCA TCTAAGCAAGCTGTTGAAGTCTATTTTACCTGTAGACTCACTCCTCCTAA TGCTCCAGTAATCTCCTTTAATAATTCAAATATCGCGACCAGTGAGTACC AAAAACATCTTGGTCTAATCTTAGATTCTAAACCTTCTTTTGATCACCAT CTAGATGAGAAGATACAAAAGGCCAATAAAGGAATTGGTCTTATTAACCG ACTTCGCAAGCATGTGCCTAGGAGATCTCTACTAACCATTTATAAAATTT TCATTAGGCCTCATCTTGATTATTATGATATCGTATATGCCCGCCCAGGA AATGCTACCTTTGTGCAGAACCTTGAATCTATTCAATATAATGCCTGTTT AGCTATAAAAGGCTGTTTTCGTGGAACGTCTCAAGAAAAACTATATTCAG AAAGTCTTGAAAGTCTTGCTGACAGGCACTTTGCTAGAAGAATGACATTC TTCTATGGAATTATTAACAATTTAGCCCCTTTGTATTTACATAACTACCT GCCAGTAAGACTTACAGCACCGGGTGGCCTTAGAACAAGAAATCCTATTT ATCCACTTAACATACGAACTGAGCGTTTCCGTAACATTTTTTTTCCTTAC TGCATATCTGAGTGGAATGTTCTGGGAGGTAATATACGAGATCTACCTTC AATAAAAACTTTCAAAAAAGCAATCTATGAATTCTTAAGACCCAAGCAAT CTCATGTTTTTGATGTTGCTGACATTCAAGGAGTGATCTTTCTTAATCGA CTTCGGGTCGGTTTCAGCCATCTCAACGAGCACAAATTTAGACATGGCTT CCGCGACACTTTAGACCCTTTCTGTGGTTGCCGAACTAACTCTGTTGAAA ACACTCNNNNNNATATATTCCCATGCAAGACAATCTTTGTTCGACAAACT TCAGACCCTAGGCATTGTTTTTCATCCACTTAACCCTCCTTTTTTCTGTC GGCTTTTATTATATTGGGATGAAAGTTTGACTTCAAATCTAAATAAATCT ATTCTTTATTCTGTTATTGAATTTCTTAACGAAACTGGAAGGTTCAGCGG TGCTTTATTTTAGGCTTTTACCTAGCAATTGTAGCTTCCTTCTCCAAAAC TTTTTTTTTTTTTTATTTACTTATTTATTTTATTTNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNTCATGCGTTATGGATAACAACTGAGAAATGC AGGAATCCCCCTCCCGAAAACCAGACTGACAAGGAGAAAATAAGTTGTTA TTTTCAAAATATCTGTAAAGACTGTTTTTTCAAGCAAAATCCAGATGAAA AATTGATGAAAAACCACTATTTTGAAGATTTCGAGACAAAGAAGCATTTA CAAAAATTTTCCGCAAAAATTTTTATTGTTCGGTAAAAGATACACCATCT ACTGCGAAAAATTTTTCAAAATCTTTTTTCTTTGCCGAAACTAAGCTCTT CAAAGTTGAAATACTCTTCACCGCAAAAGTCTTCATTTTCTTCTTCATCA AATTCTTTCAATGCAATTTTTGAATTTTCAGATTCAAGAATAGTTTGTCT AACAGAAAATGTATAATATGTCATAGTTTTGTTGGTTACATCAGTCAGAA AACACATTTTAAACACGGCAATTATGAAAAATTCACTATGATCAGAGCCT TTAAGTAATGTTTTGTAATATATGTTCGTAGTGTACACGTGTCTTTGCTT TAATAGCATACCGTCGCGAATCTAAATATAGACATTGATTTTTATTTTTG TCTGAAATTCAATCCCATCACCCTTTGCGTTTATTACGCTTGCACGCAAA TTACACTCAATTACAACGAACAAGTAATAACTTTTACGACTTTTGAATTA AGATGTAAAGGATTGTGGGATTGAATTTCGGTCAAATGAGAGAAGTAATA ATCATGACGTTTGCACGACGAAGCGCTATAAAGAAAAAAAAATTATTTCT ACAGTGATTGATTGACACATGCGCGATAGAATTTATGAAAAACGAAGTAA TCTTGGCTTACGCATACCAAGAATAATAATTACCAGTTTCGTTGCAATGT NACACTCAGGGGTAAAATTCCAGTGTTTTCGATATGAAAAACGACGTAAT CTTGGCTTACGCATATCAATAATAATAATTACCAGTTTCATTGCAATGTT TGCCAGTGTATGGAGGGAAACAATGGAGACATTGATATGTTTTAGTCAAG CGGTTCGGTGAGCAAATACTTCCATGTTCACATAACAATGCATTCTCCGT ACAGGGATTCTGAAATTAAAAAATTCCATAATAGACCTTTTCATAAATTA CGTCACGAACATCACTTGCCTTGTATTCAAATAATTACCATGGTGATCAC ATCCCTTGAGACACTAAATGGTTTTTTATGAAAGGAATAAGTAGCTGTAT TAAAATCCACTGGGATAGTTAATCACCATGGCAATAATTTCAAAACGTGC CGTAATTTGTAAAAGGTCTATCTAACTTTCTATCCTCATATTTACCTCTT TTTTCTGGGCAAACTTCGTCGCTTGATCGACAGAATTTCACAAATGACCT TATCTGGGGCATCACGTGCCAAATTTCAGTTATTTTCATGGTCTCGTAGT CGAACGCTAGCGCATCGGACTACAGCACAAGGAAACTTTCTGTTTGACCC TTCTGGGTCAAAATTATTGAAAATTTCAAAATTCGTTCAAAATCACTAAA TTTACTCACAAACATCAATGAAAGTCTCCATGGTTAGAAATCGAAAACAA ATCAGCGAGGAGTAGTGGAGTGGGAGACATTACAGGAGTTAGCCCGAAGT CATAATATATCCATATATCATATATATTTGCTTAACCCTTTAAGTGCCGA TGTCGTATATATACGACATGGGCTATATAGGAGGGCGAAGCCCTCCTGTA ATGCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTCCTTCTAGAT CAGGAGATATAAGCCCTTAAAGTTTGAACTAGCGATTTTTTAAAAAAAAC TTAGAAAAAAGGACCCTGGCACTCAAAGGGTTAAATGGTAAATTTTAAAA TTATAAATATAAACTTACCCAAATTTCATAAGCATCAAATTGGTTCTCGT GTAAGATATAAGTAGGAGAAACACGGAAAACTTTGGCAGAACAGCGACAT AACCCATGATTTTCTCGCCAGGTCCAGGTGACACACATTGGTTTCCTCAT ACAAGCATCAGCACATTCCGTTTTAGAGGAGCCACCGAAATAACAATCGA TATTTCTACCGAGTGTAGCCCATACATTATATCCACGAGTTAATTTCTTG AATTGCATATACTGTGTATGTGTTTGTTGTCTGGTGATGTTTGTCGATTG CCACATATGTGTTTGGTTTGATGCAAAGGTGTGAGCAAATGTTTGTATTA ACTGTAAAACCGTAATAGCGTGTAGGTTGAATGTTAGATACAACACCATT GTCCAATGATATTTAGCCTGTACCAGATGTCTACACTTTATGTCCTTTAT GTATTATGAATATTCTTCTAAGGCCTTTACATCACTTCATAGCTTTTAAA GTAAAGTAAAGTAAAGAAAATGAATAATGATTAACCCGCTAAGTTTAGAA GTTAAGTTTAGAATAATAAAATTTCGAAAAAAAACAAAAACGAAGCAATT AAAGATTTTTTCGTAAAAGCTGCAGCGGAAACAAAACCCATAACAGCAGG TCTAACCTCGCGGACAAGTATTAGTTGAATAATAATAAAAATAATAATAA AGCTTTACAGGTTTGTAGGCCACCGTGAAGACACATGGGCCTCTATAAAC CGCTCGTACTTTTTACAATGATCTTTTTGAGTTTCTTTCGCGGGCTCCCC CGGACTTTCCATTTTGTGTTGTCTCCTTTGATTTTAGCATTCATTTTTTC GGCTTCCTTACACCATTCATATCATACAGAATTTTTGCTTCCTTTAGCTT TCCGAGTTTTTTTTTTCTTACAAAAAACACCAGCTTAAATCTATTGATCC CATACCAACCAAAATCAAAGACATAACCATCCATTACCAACTAGAAAAAC CTTAACCTTAAAATGAATAATCAACAAACAANNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNATTGGTCGGTATCTCGCTTTATCTTCTCTTTCTTT CGTAAATTTCCCGATCCGCTGCGTCTCGGTAGTCTTTATATTCCTCAGAT GGAGCCGCCAACCAATAATTTTCTCATGGATAAATTCTTCGTCCTTCATT TTCGTTTCTTCTTCAGATTCATCTGTCGATTCATCTATCCCATGAAAAAT TGGGTTGCGTGTTGTCGATCGAATCAGCTGCTCCTCCTGCTTTTCTTTTC GAACTGCATCTCCAATATTTTTCTCGATGTGTTTGGATGTGATTTTAGCT TAGCTCATTGGTGGTCTTTCCTCTTCTTTCTTTTCGATGATGTTTTCAAT CTTCTTTTCAAGCGTGGTTATTCTGGTGTCGATAGTTTCTTTCATTTCGT TGACCATAACATGGACGTCCTGTTTTTTCAAATGGTTTATTTCTTCGTCC TGCCTTTTCATTATATTCTCACAGGCTTTGATTTCGTTTTTGAATCCTTC AATTTTTGATGTTTCATTTGAATTATACCTTTCCATTACCTGTGGTGCGA TTTTGGTACAGTTTTGACACTGGAAAGTTCTTGATTTGTATGACAAGCAT ATCTGGATTTGGTAAAGTGGCAGTTCTGTACAAAGATAATGGACTAAACG GTGGCACTTCCTGCATTGTAGGGTATCTTTTGGTGCGTTTTCTTCATTTA TGATGCACTTTGACCGGCTGCAAAAGTCGTTTATTGATGGTGATTTTTGA TTATTTTCCTGTTTTTTTTCCGCCATCTTTGTGCAAGTTGTGTAGTTGAC CCCCTGGACACTCAAAATCACCCTAAAATAGAGCAAAACTACTCCAAAAT AGAGCTGGTTTACCCCTCGGACAGAGCAAATTTTGTAGATTTTTCACTGT TCCCCGGACACTATATCCCCCCCCCCCCCCCCCGTACGAATGTACAAACA TTTTCTGGAAGAGCCCAATGACGGTTTCACGAATCTCATAGAGAAATTCC AATTTTTTGTCTGTTTGCAATATATCTAGTGGAGTATTTTTCTTTCTCTT AGTGTAATATCAAAGACCTGAAAGATGAAGATGAATGATGAAGAAGAAAC AGAAAAATAAATTTCATTTCATGTGTAATTATGCTACAACCATTTGAACT TATGTAATTGTAATCTTGAAAATGGTAATCATAGCACAAAACACAAGTTG ATTTTGTCTTCTTCATTTTTAATCTTCCTTTTCAACTCTTTTTTTTTTTT TTTACTTTAAAGGTTTTGTTTTTACATAAGTGTTTCCGTTATATTTCATA TTAGGACAGTGTCTTGCTATTATTATATTGTACTGATGTAAGCAAAAAAA AATTTTCTTTTCCTCTTTCTGACAAATTTTACTCCACATCCGTATCAATT CAATGTGAAAAAGCTTGTAAATTGAAATTGATAAGTAAGCAAACGATATC ACTCTTATTTAAAAACAAAACCTTTAAATAATATTTCAGTCATGATTATT TTTGACGAGCAGAAAACCATTAATTAATTTACCAATTTTAAATAAAACGC TAAAAATGTACGTTAAATTTCCCTCCAATCCCAACTGAACCTGCGAGTGA TCAATTTTGTTTTAAATAAGAAAAATATTAATGAAGGTGACAGAAAATAT TTTCATGTGAAAGTTCTTGACCTTGATCGATTCAACTTAAAACATATGAT TGTGAAACTTTATATAATTTTATGATTCAATCTTTCAATTGCCATTCAAT ATTGAACTATTTTTATTTTGTGTTGAAAGTGACATAGTAACACTGAATGA ATTGTCAAGGAGGTTCGATTTTTGAGTGTGGGGGTGGCCCAGTGAAAAAG ATACAGGATGTCTCCACGGAAAAGAAAAAACATAGAAATTATATTGATTT AAATCAAAAAAATATAATTCTGATTCATTTCAACAAGTAGTGAATTGACC ATTGCCAACTAACTCATTGAGATCTAACGTCCTGTGATTCGGTATTGTAC CGCGTGAAGCATTTTTGCATTTTTACAGAATTTAATTTTGCACTTTTTTG ACAAATCCGTGCTATTAAATTCTGCGAAAGCCGATTATTTTTCAGGATTT AAAACACCTACTATAAAATAGTCTTTTTATGGCAAAATATGTCATTTTAT AAACAAAAAGTTCTCTCAACAGCGAAATTAAGGGCTCTGGACNTCATTTT ATAAACAAAAAGTTCTCTCAACAGTGAAATTAAGGGCTCAATTTTGAGAT TTTACACCAACTTAAATGGCAATTTCTGCATTATAACTTTTAAACCTGTT AAACATGTCCTGTTAAACCAAAGACGTAGAAAAGAAAGACGTCGCAGCGC ATAATTATGCAAAATTATCTCTTTGTTCGGAGAAAAGAAATTTTTCCCCT TTGATCTAACGTTAGTTTCCGACAAGATCCAAAAAAATGGCCGCCAAAAA TCGAAGGCTACCAAATTTAGAACTACTCGTCCCCCGGACTCGTCCATGTA ATTATGGTCTAATTATCATGAAGTATGTCAACAAATTGGATTGGTTGTCT TATAAAATAATTATTCTTTCCATTTCTACTGTTTGAACCTTGAACTTTGG CCAGAAGGAAGGAATTTTGCAAAAACAAGATGGCTGGCTGGTTTCTGTGT ATTTACTAAAATGACCTAAAGAATGGCTCTGAAGTACTATGTTAGAGAAT TTTTTTATGATTGAAAATAATTTTTTAGTATTGTTATAGGACCAAACTTT CAAATTAAGGTTTTCTGTTAGTTTACCTTGCTTCAAGTTTGTTTAGATGA AAAGTATTCCATTTAATTTCAACCATGGATTCATTTGATTTTGATATAAT GTTTTTTATTTATTTAGATGCAAAATACCTATATAAAAAAGCTCAAACAT TCTTTATTTCAAAAACAGATGGCGCCGACTACAAGGATAACTTCTCTTTT AACTAGGATATCTTCAACAGACATGATGAAATGTGATCAGAAGACTGCTC AATTTGTCACTGTTGGATTGATTTTTGGGATATCTTGATATATATTGTGG CTTGGCTGGAGCCTTGGTAGATTGGATAATTATCAATAGCGATAGCAATG ATACTTACTAAAAAGATTGCTATTAACACTAACAATATTTGGAATAATCC TAAAATTTGGATAATGTATTGTTCACACTGTCGCCAGAAACAGAGCTCAA CAGGCTGCAAACTGAAATTGTGAGGATTATTGCATCGGTATTTGAAAATA TTTTGATGCATTTGGTAAAATTGTGATTATGTCATTTGCAGAAGAGAGTG GGCTAAAATACACATATTGATTATGCCTGGGTCATTGACTAAATAAGCGC CATCTGCTATCTCATGGACAGAATCTGAGATTTACAAAATTATGTACGTT TGATTGACTAAAAATTTGGAAAGAATATAAAAAGCTTGAAAATTATTTTA GAAACAGTGTGCCAAATTTTTAATTCAGCTAGACTGGTTTCTTGCAAATG AGAAAATGATTGCCTAGATAATTTTGAACAAATTAGATGTCCTTTGGCTA AATAAATTTAACAAATTAGCAAACTATACTTCTAAAGTCATTGCATTATC TTTCAAGGAACTGACGTCACTTTAATAAAAAACAAAAGACGTAAAACGCA ACCTCGTCCCCGTGTATCCTAGCCTTTATTTACGTTACTGATTGACGCCG GAGAATATTATCTACCGCTATCAGTAAGCATAAAAAAGCTGATAATACGC GGGGGAACGAGGTTGCGTAAAACATAATAGACCAGCTTCGCGTTGCGGGA TAGGAAAAGGCTATGCTAGGCTGTAGGACGTGCCAGGTACTGCAATTACG TAGAATATGACACTCTAAGCTTACGTTAGCTTCACGCTCAGTATGTTCGT TGTTTCGTTGTTTTAGCATATCCAAACTAATCTCACGGCTTTTTCTAGAT TATTATTCCTCACTGTTTGGACTTATTTCCCCGATTTTTGAGTACGAAAA ACAACTGTTTTGGTGTTGGAAAAACCGGTTCCGGCCTAACAAAGATAAAC ATGCGAGACCTTTCTTTTGAGTAATAGAAATTCACCTACCACCAAACAAA CAATGAAAGGAAAAGCCACCAGCCCGTCATGAAGATTTGGTTGATCATGC GATAGGTGAATGAAACATATATTGGTAACGGGATGAGCTGAAACCTAGAA AAAAGTAGATCAAACAATAAATGAGAAAAGACAATGACGAAAGACCGTCT ACAGCAATGAGTTTTAAAATTAGCTGTAGTTTGTGTACAGACAAAGTGAA AACGTGCCGTGCGTGGAGTATCAGAATCTGCCCGGAGATTACTGAGATGT TTGCATGTGAACATTATTCAAAAGTAAACGAGAAAAGGGAAATCCCCACT TGGTGTTTTATTATTCAAACAATTTCTAAAACAACTGAATGAGAAGTGGG GAAAACTAAATGGTCTGAAAAAAGCTTAACATCTATTATAAGATAAAATA ACGGTATTTCCCCTCAGACGACTTTAAACCACAAGCAGAATACATATTAA AAGTGTTTCAAGCAATAGAATTGAATTAACAACCCTGAACCGTGGTCCGT TCGGGATTGGTTATCCGGAATTTCTCTCGTCAGAACGCTAGCGACCTTGG TCAGTCGTGATGGCTCGGTGACGCCTAAAGTCACTGCCCGATCCTAAGCC CTCTGGGATTGACCGCACCTTTTCCAAATATATATTTCTAAATAATCTAT ATCTATCAGCTTGTAAAGGCCATGCACATTACGAAATCACCTTTTTCTAC ATAGCACTTCAAATCAAACAAAATTTGCTGTAATCTCCAAGTTGACAAAA AAAACTGTTATGGACGGCTATGTATATGTAGAAGATTTAAACTAATTTTG TTGAACCCCGGGGAGGGGGTACTAGGGCAAAATGCGTCGCTGGTCAGGGT ACCTTGCTTTTTTAGCCTCCACGAGTCCAAGGTAGGGTCGCAAAAACATC AAAATAGAAAAATCAGTTCCTCGTAGGGTGCCTTTTTAGGAAAATTTGGG GATAGAGTAGAAAATTTGAGAAAAATTTGGAACTTCAGTCCCATTCATAG TCTAGCAAGCTAAACGACTAATTTATACATAGTAGAAATGAAGCAAAAAG TAATGAATGGAACAATTTTAGTCGTCTAGAAACCTTTGTGCACTAACTCA AAACAAAGGAAAGGGTCAATATTGCAATTATAATTTTTTCCTGCTCAAAA TAATTCTTGAGAAAAAAAATATGCGTGGATTTGTGTTTTGAAAGTTTTTC ATTTGAGTTGATTTCGTTTTGAGAGTTTGTTGTTGCTTGATAAATTGTTT TCTCGCTACGCAAGTTTCTGCGTAGCTAGCCCCTGTNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAAGGAATGCC ATTGTGGTTCATTCAGACGTACAGTCGAGAAAAGTTAAAATGCGCCTAAA TTTCTTTTCAAGTGCATAGTCCTTTTTCATGATGCAATATTTTCTTCAAG CTGATCGCAGCGCAGACAATGAAGAGACGTGCCTTCAGGAAGCTAGACTT TTTGAGTTTATAGCTAGCGATATACTTTCCCTTTATGGTGTTTCTGTATG ACTGTCTGTGTACCGTGAGATTGGGTAACTTGCATCAGTGGAGGCTAACA TGCATAGCCCTCAAATGAAAGACCTGGCTGGTCACCAAAATACAACTACA CAGCTCCTCTCGCAGCTCTAGTCTACCATTTTTGTTTTGACTTAACTTTG TATCTTAATGACCAGCTAGGTCTTTCATTTGAGGGCTATGCATGTTAGCC TCCACTGATGCAAGTTACCCAATCTCACGGTACCTAGTCTAACCACCGTC AAATGCCTTCGGGAAGGTCTCTCCTAACTTAGAAAGCCAGAATTTGGAGC TATTTCACCAAACCACTGGAGCGTAAGTTATTTAGGCTATATCACAACNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNAACTGCATGAAAAAGTTTAACGTGCGCATGTAA AGTTTAACGAGTAAACAAACTTTTTTCAGGTTTTTGAAAAAGATTTACCA CACTGAAAAGACGTAAAAACACTCAAAGTGAGGTAAATTATTTTGAAGAC CAAAAGAAAAACTCAACCACGTCTGGATTAAACTTTACATATGCGTACAT TCATCTTTTTTGTACTTTGCCGGTTGTTTTACTAAGTTAAGAAGGACTTT CTCGAGTTACGACCTATAAACAATAAAGGTAGTTATCAATAAAATGACAG ACAAAAACTAGCCGTATTGTATAATGGTTGCGAAGCGATCCAGACTTCAC CTCAATTCGCAAGTTGCTAGCAAAATAGGAGACACTCTAAAAATCCCTCT AAGGAATAATAAAGCCGCTATAGAGACAGGGTTGTAAGAGCCTTTAATAC CCCAAATACACCAAATAATCCAAGGCGGCACAACACCCGCCGCCGCCCGC CGCCGCGCATTGCTCTTTTTTTCCTTCTAGTTATTCTAGTGTAAATGGTG CCTTAAATAAAATCGAACGATATTCGTCGAACGATCGAACATTTTAATTC GAATCACGATGAATCGTCTGTCGACGAAATCATCAAAACAAAAATAAAAT GTACAAAGATGGCTTGTTGGTTCTTTGGCAGTTTTGATTTATTTCTTGAC AAATTCAACAAATTTGATTACCTCCGTACTTCTTTATCATAGAATATCCA CTTGGTTTTGCAAGGTAAGTTTCGTTCATTAAAAGAGCACTCCTATCCTA CCGCCCGCCCGCCTGCGACTTGCAAAAACCTCTCATTAATTGTTGACCTA TTTGAAACTTGATACTTGCTGTTAAAAGTCAAGGGATGATGAAGATCCTT TCTGTCAACATTCAAACTAATTTTTTTCCATTTAACAGCAAAATAAACAT TTAAAACCGAAGAACAACTGCTTAGATTGATGCTTGGATGCGCGTGCCGT TCGCGCGGCAATTTGATCAACTTCAGATGCTAAGTTCGTGTTTCGGCTTC CGGTAATTTTGTTGCTGTTCACTGTTAGGGTACACCATTTTAAAACGGCA TTTTTCGCAGTCCTAGCTACCAAACCGAGAAAGTTTTCNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTATAACA CTCGCTTCAGCTTTTCAAAGCTAAATCAAAACTAAAATTGTAATATGTAA TAATGATAATACCATATAACGTAATATGAAAATATGTATACTATTACCGT CCCGGAAAAAAACCGAACATTTACGGAAGAGACTAACTACGGATATGCTT ACGCGACAACAACAACAAACAACAAAACAATTCGCAAAATTTTGAGATTC CAGTCCAATATCTATGCGTGAAACTATGAGTGCCTCCTCGTCGCTACGCT CCTGCGGGGGCAAGTATTACACGCATTATAAACGACTCCAGTCTATCCCA TTCAGTCAGTACCATTCAGGGTCACTTTTTTTTCCCAAATTTCGGCAATT TTTGAAAGAACGGAAGAAAAGTAGGGTCCATTTTTCGAACCTCAGCAGAG CAGCGCCGTCGGTCGGCAAGGGTAGTACCCCCCTCCCGCGGGTGTTGTAC CCTTATACATGGGCCCCGGCGAGCGTATGACATTATCTACCAAAAAGTGG GGGGTGGCATGGACCCCCCCCCGGCCCCCCGTTGACGGGGCCCATTGTTT TATAAAAAAAGCGTGTTACTTTCACTGAGTAATGACGTCATTATCAATTT TATAATTCGAATCAAAAATGCGAAGGAACAAACAATAACTCAGAAATACT CGGGTGAGTTATGGCATGTCTTGAAATTACCATAATTTTTAGATCGCATT AGCCGACAGAAAACGTGAAGGGTACTCTGTATGATGTAGTTTCTAACCTG ATGTGTAACCTAATTATTTTTTCGCTGATTTTCCGCGAAAAACTGTAAAA ACTGATTATTACGTAAATCGATGACGTTATCCAATTGTCTTCAAACTTTC ACCAAAGATGTATTCTACTAAAGTTGATAATTTGAAAGAATTTTTTTTCG AAAATCTGATTAAATCAGCAAAAAACAGGTTTTTTCGTTTTTTACTAATA ATAAATAATTTTTTGTGTAGACGGCTATTTGTGGAAATTTTAGAATCTGC CATACAAAGATAGTGTTTTAAGCGGTATATTTTATTTGAACTTTATTTTA TTTTATTTTTTTTTTTTTTAATTNTCATTATCAATTTTATAATTCGAATC AAAAATGCGAAGGAACAAACAATAACTCAGAAATACTCGGGTAAGTTATG GCATGTCTTGAAACTACCATAATTTTTAGATCGCATTAGCCGACAGAAAA CTTCTTTTTTTCTTTTTTCTCTTGAAACTTCTGAGATACTTAATTACTTA TTCTGTGCACATAGGGATAGCCATCCTTGTAGTTTTGTTCCTATTTTTTT TCGATTCACAGTTTATATCTATTATGGGCCTCTGATCCATTCTTAGTTTA TAGAGTTTCATATCTTTATGGGGTTCACTTTAGGTCGTTTGGAGGCAAGG CCGCTTCTTTATCTCTGGTAGTCCCTGATGATATCGCGGTCTCTCCTCCA TAACGAAGTGACCAAGGGTATTTTTAATATCGGGTGCCGTTATTTATGCA TTTCTTTTCCAATACAAACGAGAACATGTACATTTTATTTTAAACATAGT TTTTATTTAGTTGTAAATTTTTAGGATGTAAGTATTACGGTGGCCCACAA CTGCCACGTCAAAAAAGAAAAGCCACGGTGAATAGAAAGATGTTCACGGC AAATAGAAAAGTTCACGGCAAAAAGAAAAAACGTTCACGGCAAAAGAAAA ATGTTTGCGGCAAATAGAAAAGTTCACGGCAAAAAGAAAAAACGTTCACG GCAAAAGAAAAATGTTTGCGGCAAATAGAAAAGTTCACGGCAAAAAAGGA AAACTTTCACGGCAAAAAAAAAAGTTTGCAGCAAAAAATAAAAGTATAAG AAGAATCTTACTAAAAGAATCTTACTAAAAAGTACACTCAAATAAAAATA AAAGAAATTTAGAAAAAGCTTGATTTCTTTTTTTATTGCTATGGNTTCTT TTTTGCCGTGAAAGTTTTCTTTTTGCCGTGAGAGTTTTCTTATTTGCCGT AAAGATTTTCTTTTTGCCGCGAGTGTTTTCTTTTTTGCCGTGGATTTTCT TTTTATTGACGTCGCAGTTGTGGGACACAGTAAAGTATTATACCAAATCT AATGGTGATAAAAGAGATTTAAATAAAAAAAAAAATATTGTCTTGTTGAA TAGTTCATGAATGAATACATGTGAACAAGGTTTTCTAACTGATTCAATCA AAACCACAATATGTTTATTATGTAATTCGAATTGATCGAGACAAATCAGG AAGCTTTTTACATCGCATGCGTGCATTTTTTTCATACAAAAACAACAAGT TATTATTTAGCATAAGCATAACTCATCAAGAAGTGAATTTCCTGTGTTCA ACATTACAGATAAGAAATACTCATTCCATTTAGTCACTGAGTATAAGGTA TGTATCAGGCTTATGCTACTATCGAACTTTCAACTCGCTTTTATCTCGAA ACTTTGGTTGGGTGGTTGGGAAATTTTCATCAATAAAATTGTAATATGTT TATGACAAACCTCATGTCACTGAAATTTTACNTATCACGCTACAGTGTTT GCAATGTAGGAGACAAAGTTTATTCCATTCCAACGACCATATTCTTGGCT TGTTTCCGGTGTTGGTCAGGAATGATGAAGCCTTAAAAAAGCAGTAAGTT TTTTAATATTTTAGATTACAGCCTTTTTATTCCAATTAAAACTTTTCTCT AATTGGAACTCGTTTGGGAAAAATCACTCAATTTGTGTTTTAAATTCGGC ATAATAGGCCATTTACTTCTTTTGAAGAAGTTAATGAAAACTACCAGAGA GTTTATTTGGCAATGGTTTGTTTTCAATTTGACTTATATCTATTGAGACA AGGTGAAGCGTGATGCTGTAGATCGAATCTGTGNTGAATATCATGAGTAA GTTATAAGAACATTTAAAGGCTTTGTCGACTCTAAGACACCTACTTTGTT ATTGAAGATACACAAAAATACAGTGGTTTTGAAAAATTCTAAACATGTCC AAAGACAAATTTTTGTCCATACGGAGTCAATTTGATGCTTATCCAAGGGT AGAATATACATAATCCGATTCTTTCTTTTCTCTGGTTCAAGTTATCCACC AGTATACTCTTCTATAGATCTGTTCACAAAATTTATCCACCATGTTATCA AAATTAATATCTGAATATATATTTTTGTCGCCATTATTATTTTTCAGAAT TCGTTAACATGTTGAAAGGTGGAATCTAAAGAAAACACTCTAACACAACA ACAACAAACAAATTATATGAATTTGCAACAATCAANAAGAACATTTAAAG GCTTTGTCGACTCTAAGACACCTACTTTGTTATTGAAGATACACAAAAAT ACAGTGGTTTTGAAAAATTCTAAACATGTCCAAAGACAAATTTTTGTCCA TACGGAGTCAATTTGATGCTTATCCAAGGGTAGAATATACATTATCCGAT TCTTTCTTTTCTCTGGTTCAAGTTATCCACCAGTATACTCTTCTATAGAT CTGTTCACAAAATTTATCCACCATGTTATCAAAATTAATATCTGAATATA TATTTTTGTCGCCATTATTATTTTTCAGAATTCGTTAACATGTTGAAAGG TGGAATCTAAAGAAAACACTCTAACACAACAAC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000112XLOC_000112Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000200-exon-sc0000001-1575043694:1224669..1224866TCONS_00000200-exon-sc0000001-1575043694:1224669..1224866Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1575043694:1205608..1205638TCONS_00000200-exon-sc0000001-1575043694:1205608..1205638Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1575043694:1204570..1204766TCONS_00000200-exon-sc0000001-1575043694:1204570..1204766Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1575043694:1204237..1204347TCONS_00000200-exon-sc0000001-1575043694:1204237..1204347Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1575043694:1203556..1203681TCONS_00000200-exon-sc0000001-1575043694:1203556..1203681Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1575043694:1171384..1171438TCONS_00000200-exon-sc0000001-1575043694:1171384..1171438Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1510915933:1224669..1224866TCONS_00000200-exon-sc0000001-1510915933:1224669..1224866Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1510915933:1205608..1205638TCONS_00000200-exon-sc0000001-1510915933:1205608..1205638Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1510915933:1204570..1204766TCONS_00000200-exon-sc0000001-1510915933:1204570..1204766Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1510915933:1204237..1204347TCONS_00000200-exon-sc0000001-1510915933:1204237..1204347Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1510915933:1203556..1203681TCONS_00000200-exon-sc0000001-1510915933:1203556..1203681Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1510915933:1171384..1171438TCONS_00000200-exon-sc0000001-1510915933:1171384..1171438Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1491911889:1224669..1224866TCONS_00000200-exon-sc0000001-1491911889:1224669..1224866Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1491911889:1205608..1205638TCONS_00000200-exon-sc0000001-1491911889:1205608..1205638Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1491911889:1204570..1204766TCONS_00000200-exon-sc0000001-1491911889:1204570..1204766Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1491911889:1204237..1204347TCONS_00000200-exon-sc0000001-1491911889:1204237..1204347Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1491911889:1203556..1203681TCONS_00000200-exon-sc0000001-1491911889:1203556..1203681Clytia hemisphaericaexon
TCONS_00000200-exon-sc0000001-1491911889:1171384..1171438TCONS_00000200-exon-sc0000001-1491911889:1171384..1171438Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1171384..1224866 -
Expression
No biomaterial libraries express this feature.
Blast
BLAST of TCONS_00000200 vs. Swiss-Prot (Human)
Match: CALM3 (Calmodulin-3 OS=Homo sapiens GN=CALM3 PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.243e-40
Identity = 85/130 (65.38%), Postives = 103/130 (79.23%), Query Frame = 3
Query:  297 FAIFDKNGDGTITTKDLITVMRSLGKNPTEDEIDDMINEVDTDGNGVIDFIEFLEMMAK--MSTDVDETIKEAFYIFDSDGSGAISSEEFRKVMMTLGAQMXXXXXXXXXXXXXXXXXXQINLEEFVNML 680
            F++FDK+GDGTITTK+L TVMRSLG+NPTE E+ DMINEVD DGNG IDF EFL MMA+    TD +E I+EAF +FD DG+G IS+ E R VM  LG ++TDEEV E+I E D+DGDGQ+N EEFV M+
Sbjct:   17 FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMM 146          
The following BLAST results are available for this feature:
BLAST of TCONS_00000200 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CALM35.243e-4065.38Calmodulin-3 OS=Homo sapiens GN=CALM3 PE=1 SV=1[more]
back to top