Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000170 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000170
Unique NameTCONS_00000170
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1895

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000170 ID=TCONS_00000170|Name=TCONS_00000170|organism=Clytia hemisphaerica|type=transcript|length=1895bp
CTCAATCGATGAACAAACCTGTTAAACTGTCTGAAGACGATAGACAATGG
TTATCTAGGGTGACATGTTTAAGATTGGACGGTCAACATTTGAGTAAAAT
ATCCAACTTAGAAAAATTGGAGAACTTGAAATGGGCATCTTTCAATGACA
ACGATATCACGAAAATCGAGGGTCTCGACAATTGTAAAGATCTGATTGAA
CTTTCATTGGCAAATAATTGTTTATCCAAAATTGATGGTATTCACCATTT
AAAGAAATTACAATCACTGGATGTTTCCAACAACAACCTCTCATCATTGG
ATGGCATCGATTTTGCTTCGTTGAATAATCTTCGCTTCTTAGCATTCGAC
AATAATTTTGTTTTGTCGCTTAACGGTCTGCAGCATTCTACATCTTTGCT
CGAGATTTACGCCGGTAACAACAAACTTCAAGAATTAAGAGACATCTTCT
ATCTAAAGAATATACCAACACTGATTATACTGGACATGATGGGAAACCCA
CTGGTCaaagaatgtaacaattatcgACTGTTCTTGATCTATCATTTGCA
AAGTCTCAAAGCTCTTGACGGAATACCTGTTAATTTTACTGAAGGGGGTA
TGGCTAAAGATACCTTTGGTGGCAAACTGTCCACAGATTTTATCGCTGAG
AAACTTGGTCACTCAAACTTCTTGGAGCTTTGTGAGCTGGACTTACCACA
CTGCAATATTCGAACTGTTGATTTGAATTCAAGTGAGCTGTTCAAAAATC
TTCGAAGtttgaatttgGAGCAAAATAATTTGTCATGTTTTGGTGGTATT
GTCAACCTACATAACCTTAAGGTCTTGTGTTTAAACCACAATCACATTGA
GAGTATTTTCCCCAAGAAGTCTGGTACCAACAGTCCACAAGTCATATCAA
CCAATAAGAATGCTTCTTCAGATGATTCGACCAATCAATTCAAAGCAGTC
CTCGAGAATCTGGAAGTACTTCATTTAGGataCAACGGTATTGCAAATCT
AGCGGCGCTGGAGCTTGGTCGACTTGTATCATTGAAAGCACTTTTCTTAC
AAGgGAATGAGATCAATAAAGTTGACGGATTGGATGGGTTGTACGAACTT
CGTGAATTGGTCCtcgataaaaataaaatcaaggCTTTTACTGAGAATTC
ATTCCGAAATCAATGGAAACTGGCTGAATTGCATGTCGAAGAAAATAGAT
TGCGAGATCTTTCGAATTTGGAACCGCTGACCTGTTTGAACCGTTTATAT
GTTGGTTTAAATCGTTTGCAGTATGGCACAGATCTCGAGAAATTGGAATG
TCTGCCGAATCTCTTCGAATTATCAGTCATTGGAAATCCGattgcTCGTC
GGATGAGTCACCGCATGATGCTAATCTTCCGGCAACCGAACTTATTGAGT
ATTGATGGTATCCCAGTCTCCAATGAAGAACGCTCCAAAGCGGAAATCCA
CTTCTTAGAACAACAGGGTGGCATTCAAGCGTTGCAAGCTTTATCGAACA
GTTATGATAACTCGTTCCCAGGCCTTCAATCCAACAATCGAAACCCTTTG
AAGGTATCGAATTATACTTCATCTGGACCAAACGAACGGTTCTGGAATCC
CCATCATAACGAAGACAAATCACGATCAAAGAAGAACCACAGAGGCTCAA
ATAAAATACCTAACAATCGATACACCTAGCAACTGAGTACGGTTACCATG
GCAACCTATGTATTTTGTAATTACAACACCAAAATGGTATCTTCGACTGG
ATGTTCGTTCGCTTTAGAATAGGGCTCAGATTTCTTATCCTTTATTCAAT
AAACTCTCAATATCAAATGTTTTAGGGAGCTCTTTGCCGAATAATGTTAA
AAGATTTTATCCCAGGGCTTtcagatatatttttcttttttgaat
Run BLAST on NCBI

transcript from alignment at sc0000001:601427..676150-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000170 ID=TCONS_00000170|Name=TCONS_00000170|organism=Clytia hemisphaerica|type=transcript|length=74724bp|location=Sequence derived from alignment at sc0000001:601427..676150- (Clytia hemisphaerica)
CTCAATCGATGAACAAACCTGTTAAACTGTCTGAAGACGATAGACAATGG TTATCTAGGGTATATACTCCATATAAGTTTTAAGTGAATGAACTCAATAA TTACTAAGGCCTTTAGGACACTAAATTCGTCGAATACAACAGATGTTTTC ATAACTCAATCGATGAACAAACCTGTTAAACTGTCTGAAGACGATAGACA AGGGTTATCTAGGGTATATGCTCCATATAAGTTTTAAATGAATGAACTCG ATAATTACCAAGGCCTTTAGGACACTAAATTCGTCGAATACAACAGATGC TTTCATAACTCAATCGATGAACAAACCTGTTAAACTGTCTGAAGACGATA GACAATGGTTATCTAGGGTATATGCTCCATATAAGTTTTAAGTGAATGAA ATCAATAATTACTAAGGCCTTTAGGACACTAAATTCGTCGAATACAACAG ATGCTTTCATAACTCAATCGATGAACAAACCTGTTAAACTGTCTGAAGAC GATAGACAAGGGTTATCTAGGGTATATGCTCCATATAAGTTTTAAGTGAA TGAACTCGATAATTACCAAGGGCTTTAGGACACTAAATTCGTCGACTACA ACTGATGCTTTCATAACTCAATCGATGAACAAACCTGTTAAACTGTCTGA AGACGATAGACAATGGTTATCTAGGGTATGTGCTAGATGAGTAGGTTTTG TATCAGGGGGGTCAGCTTCAGAATCCGCCTGAAATTTGTCCGTTGAAATA GTTCCTCGGCCGTCAGAATAGTCATCCGGCCGTCGGAACAGTCATCCGGC CCGTGGAAAATTGGCCGACGGAAAAACTATCTGACCTGCGGAAATCGAGG CCTAGAAATTTTTCTAATAAAAAAATTCGTTCGTTCGTTCGTTCTCGGTA TTGGCTCATTATAGTTGTTCTGAATTTAGCACAATAATGCAGAATGGCAA TACCCAAAATGTAACGGAGCCCGATTTTGAAAAAAAATTTTTGGGACAAA AAGGGACTTTGTGTGAAATTGCTTTATTAGTTTTTTCTGCCTTTTTTCTT AAAAGGTCCTAAAACCGTTTTTTCTTGGAATTTTATTTTGGCCGTAAAAG TCGGTTTCCTTTATTTGGGGAAATCCCTATTGTCATTTTTAGGGAAAATG AGCATTTCTCGCGATTGGCTTGGTATTTTTTTCTGATCGATCAGTTTTTA TTTTCTATTTCGTTAGCTTTCAGGTAGGTCCATTCAGCATGTAGCTTATT GTTTTCTTCTATTTTCCAGGTGACATGTTTAAGATTGGACGGTCAACATT TGAGTAAAATATCCAACTTAGAAAAATTGGAGAACTTGAAATGGGCATCT TTCAATGACAACGATATCACGAAAATCGAGGTACTGATAAAATATTTTTA ACTTTTCGTGTAAAGTCTTCCATTTCATGTGGACCAAGCTTCCCAATCCC AGCTAAGCAAAATCTTTGATCGGAGTTTTTTGAAAAGTGGTACCCTAATG GCCGCACTACTCGATAGTGGTGTAAATGCATCGAGAGCGATAGGTCTACT TTTTCTTAAATTCTTTTGACGATGTAGCGGTGTTAGACGTTAATTTTTAA CATTGCAACGGCTTCTTCTCGGGTACCAATTCCAAAAAAGCTCCAATCAA AAATGGCGGATATTGCTTGGTCCAGGGATATATAAAGGTCAGTGATGGTG GACCAGGTAGGCCAACGAGTTTTTTTTATCAACATATTGAGCTGTTCTTT TTCTCTTCTGCTCACACTTTTCATAGATTGAATTGAATTGAATATTTTTT CGGAGCTGCTCGTTGGAGCTTTGATTGATTTGTCAAATCGAATTGGTCTA AGTGGTGGCCCTGGCTGGCCGTTTAGATTTAAGGGGGCAAATTTTTTTTT AAAAATAGTCGCCCTCCATGGTTTTGGGACCAAGAAAGTATGACACCCTT GAAACGTCATATAAAAGCTATTTAGCTTGATAAAAATAGAATTTGGCTTT AGTCTGCGAAAACAGTGAGGGGCCATGTCCCCTTTCCGGAGAGGGAGGGG GCGTGTGCTGACTAGGCACATGGCACATGGCCCTTTTTGCCACAAAGTCA CACTTGTGGTCCGAACTAAATATTGAACATGAGATAAAATTTACTTACGA GATTCTATTTTTTTTTTACGTTTAGGGTCTCGACAATTGTAAAGATCTGA TTGAACTTTCATTGGCAAATAATTGTTTATCCAAAATTGATGGTGAGTTA TACATACCATTCAAATGGTCTTGTACACTTTTTTTTATATAAGAACAATT TTATAAGAACAATTTAAGAACAATGCTGAGGCTGAAATTACTCCGATTCA AGCAATATAGTGGTTAAAGTAGTAAAATTGGGTATAACGTCTAAAATACC TCAATTAAACTTTATAAATAAGAACAGGATAAGAACAATTTGATGCTCAA AGTGCCAAAAAAAATAAGAACAACCGAGCCTCAGGAAAATTTTACTGGCT CTTATGATAAAAAAAGTGTATTTCACATTTACCCATTGATAATTGATGTT TGACTGCAAAAAATGTGCAAAGAATCCGGAAATGTTAGCCCATTAAAATG TCGTCACTCCGTAGCTTCAAATTCAAATATCTTTTGATCACAGATTAGAC AAGATTGTCACTTTCAATCTAGTTTTTTTTTGGGCAGGATAAAAAATTAG AGCGGTAGGTTTGCAGCTTTCCTCGGTCCAGACCTATCTGGTATAGGACT GTATATAAGTGGCGGCCGGATTCAGTTATTTCTTTTAAAAGGTATACAAA CGTAGCTTTAACTGAACACTTTTTTGCTCCGGCCTAGGAGCCTTAAATTC TCTCTCGTCCGACGACGACGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNTAAAATTACTACATTACAGTGAAAATT TGAAAACGATCTGAGTAGTTTTTGTGGTGTTATGTTTATGGCTGAAAATG ATCCTGTTTTGTATTCATCATTTATTATTGTTGACTGGCGACCGTTCCTT TTTGATTCTTCAAACCCGACACATATTTTTTACAAACATATCACTATGAG AATTCAATAAATGATACTAAAACACAATTCCTGTGTAAATTTGAACAAGA ATGGAGAAATTTTCACAGTTTTATGGCTGAAAATGAGCGTTTTTGGACTT TTTGTCGTAATTTCATCGCGGCTGGCGACCGTTCCTTTTGATTTTTCAAA CCCGACACAGATTTTTTACAAACATATCGCTATGAGAATTCAGTGAAGGA TACGAAAACACAATTCCTTTTTAAATTTGAACAAGATTGGAGAAATTTTC ACAGTGTTATGGCTGAAAATTATCGTTTTTGGACTTTGTCGTAATTTCAT TGCGGCTGGCGACCGTTCCTTTTGATTTTTCAAACCCGACACAGATTTTT TACAAACATGTCGCTATGAGAATTCAGTAAAGGATACGAAAACACAATTC CTTTTTAAATTTGAACAAGATTGGAGAAATTTTCGCAGTGTTATGGCTGA AATGATCGTTTTTGGACTTTTTCGTAATTTCATCACGGCTTGCGACCGTT CCTTTTGATTTTTCAAACCCGACACAGATTTTTTACAAACATATCACTAT GAGAATTCAGTAAAGTATACTAAAACACAATTCCTGTGTAAATTTGAACA AGATCGGAGAAATAGACCTTTTTTTAAAGAGGCAGCCATGTTGAATAATT ATGTACTCCAGCATAAAAACAATGATACAGCCATGCATAATTACTGCATC ATGCATANNNNNNNNNNNNNNNNNNNNNNNNNNNNATGCATATTTTAAAA ATTATGCATGGCTGTATCATTGTTTTTATGCTGGAGTACATAATTATTCA ACATGGCTGCCTCTTTAAAAAAAGGTCTATTTTCACAGTGTTATAACTGA AAATTATTTTTTGGACTTTGTCGTTATTTCATTGCGGCTGGCGACCGTTC CTTTTGATTTTTCAAACCCGACTCAGATTTTTTACAAACATATTGCTATG AGAATTCAGTAAAGTATACTAAAACACAATTCCTGTGTAAATTTGAACAA GATCGGAGAAATTTTCACAGTGTTATAACTGAAAATTATTTTTTGGACTT TGTCATACTTTAATCGTAGAAATTTTAGCGAGACTTATTTTAGCGTATAT TTAAATATTTAAATTTTAGTGATCTGGCGATTTGGTGTGTTTTAGCGAAA ATAGGGAGAACTCGCTAAAACACTAAAATTAGTCTCGCTAAAATTTCTAT GAAGAAAGTAATTTCATTGGCTGGGGCGACCATTCCTTTTGAAGATTTTT CAAACAGGAAACAGGTTTTTTCCAAATATACCACTATTTATAACATACAC ACTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNTTATCCCAACAGAAAAAATAATGCTTAGCTC AAAGCCGTGGCCTCTAATTTAGGCTATTTTTCTCCCCAAAATTTTATCCG GACCAATCAAATCAACGACGCATCATGGCTTCGCTATTGGCAAGTTTAGA AAAAAATTAATTTACAGTATAAGAACTTGGAAGTATTCACTTCTAAATGT TCATCTCCTTTAGCTCCAATTTTGAACTTTTTAGTCGAGGATGAGTGGGC GGGGGTGGGATTGGTTCTTTAGGCAAGAAAGTGCATGTGTAATCACTTAG AAGAGCTAAACTTCCAGCTGGTTTATTTATTTGTTAAGATTATTTCTCAT ACTCGCTCTGCAATAGAATTATTACTTTGCTTGCTTTCTGATCTGTTCTG ATTAGTAGTTTGTGGGCAACATTCTAACACAACTAACTCAACAAGCTCAT CTTTCACATCTTTTAATCTCTTAAGCCAGAGGTTCCAGCGCAGCTGGTTT ATTGAAAAATGAACTTAACAACTTTTTCACCGATTTCATGCCTCAATTTT TAAGATTATAATTTTAGTCTCAAGCAAATTTTTTTGGTCTTCAAGAGGTG TGTTGGATATCCAAAAAAAAAGATTATTATTCCCTTGGTCGATTATCAGA TTGCACACAACGTTGTCCCAACGTTTATCCGACGTTCACAACGTCCATAT AACGTTAGATAAACGTTGAAACAACTTCGTGTGTCATACACCCCCTTCTC ACAGACCCGGTAGGATCTTTTCAGCCAATGGGGATAAAAACTGAAACTAA CTCAATGGGGATTGATATTCCCATTTTTTTTATAGCTGGGGATTCATATT CTTTTGATTTCAAGTCAAAAAATTGGGTGAGGATGGGGAAAATAGCATAT TATTTTCCAGTGAGGATTGGTTTATTTGATTATTTTCGGCGAAGACAAAA ATTGATATATAATTTCCCACTGGGGACGATATTTCGGGCAATTTTTCCTG TGGGAAGGGGTCCGCAGCGGGTTTGTGAGAAGGGGGTGTTTATCATGATC GCCTCTTACAGTGCTCGATACATAAGTAGAGGTATGTCAGTCAGAAAGAA AAGACACTTTTTTATTCTGCTACTGGCAGTTTCATTTCATTTGTGACAAT CTTTAGGCATGAAACTGCCAGTAGCAGAATGGGCTTTTCGAGAAATAGTC CGTGCCCGTGATGTTGAGGATATCGGATATCCAGGGGGTTAATGATTTTT GTTCAAAAGTGGATATCCAGGGGGTTAATTATTTACAAGGGAGCGGATAT CCAGGGGGTAAAGTGTCTTTTCAAGTAAAAAATACGATATCCAGGGGTAA GCATCTTTATAAGAGAGGATATCCAGGGGGTTGAGCATATTTTTAAGAGT GGATATCCAGGGGGGAAAGTGTCTTTTCAAGTAAAAAATACGATATCCAG GGGTAAGCATCTTTATAAGAGAGGATATCCAGGGGGTTGAGCATATTTTT AAGAGTGGATATCCAGGGGGGGGGTTCGATACTTCGAAAAATCAATATCC TCAACAGTGGGGGTAATTTTTTTTTCTGGAAAAGCCCAATAAATATTGTC TTTTCTTTCTAACTATTTTCTCAGGTATTCACCATTTAAAGAAATTACAA TCACTGGATGTTTCCAACAACAACCTCTCATCATTGGATGGCATCGATTT TGCTTCGTTGAATAATCTTCGCTTCTTAGCATTCGACAATAATTTTGTTT TGTCGCTTAACGGTCTGCAGGTACGTACGGGATTAGACCCAGTCCTTTTT TTTCAACTTCAGTCAAGCTAGAATTTGAGAATGTCTGTGTGTGTATGTTA ATCTGGGTCTATGCATTTTTAAAGCTATTTTATCGGCCAAAACTTAGTCG GTCCTAAGTGACTAAATTTTGGCTTGGTGACTAATATTTGTGCAGACTAA AAATTTTGGCCGACTAAAATTTGGCCCGACTAAAAATTTAGAAATGGCAA AAACTTAGTTATTAGTTGGCCCTTAGTGACTAAATTTTGACGAGGTGACT AAAATTAGGGCCGACTAATAATTAAGGCGGACTAAGTTTTGACCGATAAG GTATACTGATATTTAGTGCATTGCGTTTCACGTTCTGTTCTTCATGTTCT GTAGATGTACACGCTTAAGTTTTGGCCGCTAAGGTAAAGAACCTACCCTC TTCAATATTCTGCATAGACATAATTTACCAAAATTCCAAGAACATGTGCT AATTTGCTTTGTAAAATCCATTTTACGTCTCAAAGGAAAAACCTTACTTT GCCCACTGTTCAGTAGCTTAACTATAGACTCGTAGACAAAGTTTTCTATC AGCTAAAACCGTCTGATTACTCTTATAAACATCTTTCTTTCTCTTTTGTA GCATTCTACATCTTTGCTCGAGATTTACGCCGGTAACAACAAACTTCAAG AATTAAGAGACATCTTCTATCTAAAGGTATTCAAAAATAGTGCTATTTTT TAAAGCTCTGACTTCAAAGCCGAAATTAAAAAAGAATTGACATGTCTTGT TTTCCCTCTTCTTGGTTTCTCATCATCAGAGTCAACCAGCTCACTCAATA GCACAACAGCCGTGAAGTCTGCCACCGTTGCCGCCATTATGGCAAAGAAA TTGAAAATGAAAATGTTGAACGTTCACCTCAAATGACTTTTCATGCAACA TTACAAAGTTTGTGACGTCACTCGTTCTTCCAACATTTGACGCAACATTT TAACAAAAAATGTTGGTTTGAATGTTGGCTTCGTTAGCGCCGGCCTTATA AAGCCATTGACCTTTTAAATAGTTATAATGTATGTTGATTCAGCAGATTG AAATAAATAGAATCTTTTTTAATGAAAAAGAAAAATGTGGAGCAAGATTT TTTTCTTCCTTTTATTTACAAATTTGAAAGGACTCTTTTATTAAAATTTT GCTGACATCAGTTTCAGACGAGTCGGGTGTATATAACACTGTATAATTCC TTTAATTCTAACATGAGACTAAATAAATATTGTTGTAAAAAAAATGGCGT ACGAATGATTCAGGATAATTTTTCCCCAAATGGTTGAGAAAATATCCATA ATGGAATGATAAACATTATTTTATAAAAAAAAGGCGTGTATGGCTCAAGG AGTATTTATTTAGATATTGCATGGAATATCAACCTATACTCTTGTATCAG AGTTATGATACCCAATTCCCCTCACATGGCATGGGTTGACCCGAGCCAAT TGAATCATAGTGCCACGGTGGGTATCGAACTCGGGCCTACTGGACAGAAG GCAAGCACGATAACCACTATACCACTACGCCTATTGCATTCATATTAACT TGGAAAAACCCATTCAACTTCTATACACCTTTTCGACCGTAACCGCCAAT TGCCGCGCGGGCATTTTTGTGTCCGCTTTATCTCACTAAAACCGTCCCAG TCCTTTTTTCGCACCTATAGACAATAGATAAATAAATGTGTCAAAAAAGG ATTGGATCGAGTTTGGTGGGATAAAAGTGGCGCGCGCCTGACCGCGCGAC TACGGTTGAAAAGGTGTTATTTATCCAACTTTTTTGAATATTTAAAAATG GAAAGTTAGCTTCCCTTTGCTTCTTTAGATTTTCACAATGTTTCACCCCT TCCTAACACTGCCTACATCCATTAAATGATTTGTGCATATGTGCAATCTT GTGCAGGGGAGGGGTGCTTAGGCAAGGTACTGGGTATATGCGGGCGGTAT GGGTCGCCGTCTAGCGCTTCGGGCTTTAAAAATCTGTGCTTTAACCGTAA ATCTTTTTCAACTCGCCAGAATATACCAACACTGATTATACTGGACATGA TGGGAAACCCACTGGTCAAAGAATGTAACAATTATCGACTGTTCTTGATC TATCATTTGCAAAGTCTCAAAGCTCTTGACGGAATACCTGTTGTAAGTTC ATTACAAGCTATTTTTCGATTGGTTGTAAATGACGTAATGCAACAATTAT CGATTGTTTTTGATTTATCATTTGCAAAGTCTCAAAGCTCTTGACGGAAT ACCTGTTGGGTCAATATTAAGTAATTTCGGGGGGATTTTCCAAAAAAACC CTAGGAAAATGTGAAGGTTTTGGCATTTTTTCAGGAAAATTTCATAAAGT GTGGGGGTCATTATAAACTAANGCATTTTTTCAAGAAAATTTCATAAAAT GTGGAGGTCATTATAAAACTAACCCCCCTACAATTAAGCACAAAAGAGAA TGCGAGAATTTGTTGTGATGAAAAGTAACTTTCATATCGTTCGTTCGGAT GTCTTCCCTAAGTAAAATGCCGTCATCTTGAAAAACCTCAAATTTGCATG TCCAGCTTTTACACGACTGTATTGTCTTTAGTTTAAAATGACTTTATTCT TTATTCTACACCATATTTTTTTTTCATTTACAGAATTTTACTGAAGGGGG TATGGCTAAAGATACCTTTGGTGGCAAGTAAGTTTGATCTTATACAAAAC TGAATTTTTTTAGTATCCTTAAGGCTAAGAAATTTCCGTATATTTCTGTG ACAGCCTATACTCTTGAAATTATAATTCTATAGATGATATTACCATCAAT TTCGTATTAAAAAAGTCCAAATCGATGATGTACCTTTCAGTCAGTCAGTC AGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTC AGTGGATGAATGAATAAATATATGATAATTGATCTGCATGAAATTTTCCA TAATATTTTTCCTGGTATATTATTTTTGGATTGAAGTCATAGCTCTATGG TTTCGCGAGTAAATTGTCAATGGTGCCTAACAAGCGTAATGATTTCCCTA TTCTTGAAGAGACAGCTATTCTTGGATAGAGCCCATTTCTTTCATCCGCA TTCAGGGTTGATCAGGGGGAGGGATACCATTATTATCATGTGAATGCCTC AGCATTTTAATATGGATTCATGTTGAAACTCTGCTTTGTACTGTACTAAA CTGTACTTTTTTCTCAGACTGTCCACAGATTTTATCGCTGAGAAACTTGG TCACTCAAACTTCTTGGAGCTTTGTGAGCTGGACTTACCACACTGCAATA TTCGAACTGTTGATTTGAATTCAAGTGAGCTGTTCAAAAATCTTCGAAGG TATATATTGGACTTACGACTTTTATTTGAAAGATGAATTTTACCGAAGTT TATCGACTTTTCAATTTTGCTCTCTTCGATGCAACAACTTTACGGGAAGA ATTTCTTCATCTGAAGATTCTTTTTGCGATGAAGAAAATTCGCGAAATAT CTGCATTTTACAAAGATTGACTTTTTGCGGCCTGTTAATTTTTATCTGAT TTCATCCCATATTGTTTAACAAAATTTTTGTGGAGAAAAGAGTAGATAAA ACCTCATCTTATTTCACATCTATCAATTCAAAATTTCGGAAAAATCACCG AAAGTTTCTTCCCTTAGAGATATAGAACGAAGAAACTCGTTGCAAATCTT ATATTAAGTTTTCAGGTTTTTGTTATTAATTTGACATTTTTAACATATAA ACACTACAATCGGCGCCGAAATATATTGGCAAATTTGGGTATTTTAACGT ATTTCAGAATTTAAAGCTCGGACGAGAATTGCATTTTGCAATTGGATTTT TCGATTTGGGAGTGGCTAAGTGGCTTCCAGGCTATATTCTTTTAGATCTT TAGATTAGCTTTTAGATCCTGAGATCCTAAGGTCGTAAGTCTTAAGACGC TTAAGACTCATGTTAAAACTCAGAGTAAAAACCCCACTTTCCAACCGTAC TACAAAGCACTTACAAATCACTTGAGGATTTAAAGTTTTTAGGGAATTCC CCTTTTGTGCCAAATATTTCGGCGCCGATTGTAGTTTTTAAAGTTTTCTT GTTTTTATTATTGATTTGATTAACATAAACACTTAGGAAATATGGAAATC GGGGACTTTCTAAACGTCGACCAGAAATGGCGACCACGATACCGGCGACA ACGACCGGCGACCAGATAAATTTGGGTTATCGAGTTTTTTTCCCTTTCTC CAACGTAGATTGTCTCTCCTAATCATTTGAATACTATATATCATATTGAA GAGCTCACCCCTGTCTCATCTAATTAAAGTCACGTGCCAAATACGTAAAA CAACCATTTCGACGCTCTTGGAGCTTGATTATGGTGTCAATTTCTATCCT TTTGTATTATCAGCGTCAAAATAATTAGTGGCACAAAATTTTTTGAAAAT AGTTTGAGAAGCAGATTCATCAGAATGTTATTTACTGTCGAAATTAGTCA TTTTGTCAGCATAAAGACAATAGAATAATTAATTAGATTCATATCTCTAA AACTGGCCTTCCCAATTTTTTCCTACAGACAAGTTCTATCTATTCATACT AAAGACATCTCATTCAGCATAATTAAAATATTTGGTGTAACAAAGCTTAC CAAACATCATACGTAATGACCCTGTCAATATTTTTGTCAAATAGTGTCAC TTTGTCAAGAAAATGACTCGTTACTTCAAAGGTCATTTTTTAGTATTCAG AGGACTCCAAATTTATCTGGTCGCCGGTCGAGGTCGCTGGTCGTTGGTCG TGGTCGCCATTTCTGGTCGATGTTTAGAAACTTCTCTGAAAATCGGAAAT TTCAGGACCCTCCCGGCGCTCCGGAAACGTCCGAAGCAAAAAGTGCCGTT TTTTTCGTGCTCCGAAACACCGGAAGATTCCGCACGATTTTCAGCGATTG GTCTGCACCAGAACTCCGGAACTGTGTTAAAATTACTTGCTCCGGAAGTA CCAGAAGAGCTCCGGAACTTTCCTTAGAGAAAATAGTGTTTTTTAACTGC TCCGGAAACTTCAGGAGTTTTCGGGAGGGTCCTGAAATTTCATCGGTAAT GGTACGTAAAAAAAGGCTCTTCTCGTTTGAGAAACCTTCTGAAATATGAA TGGAATTTTGAGGGAGAGCGGGATTTCCTTGTACTTCTGTCCTTTCTTTT TCAGTTTGAATTTGGAGCAAAATAATTTGTCATGTTTTGGTGGTATTGTC AACCTACATAACCTTAAGGTATCAGTTCAGTTTAAAAGTTCTCAAATTTG TGCGTCAAAAATCCAGGGGGGGGGGAACACTCAAGGTAAATGACCTACCG TACGTGCGACCCTTAAGGGTATATTTTTGAAGCTTCCCAAAAGTGCACTG TAAGGGTCTATAAGGGGTATAAAATTTGGAAAATCTGACCATATTTTGCC TGAAAATGGTTTTGCTTTTAAAATGGTCAAAACATTTTCCAGAAAATGCA CCGTAATGGTCGATTTTTCGCCAAAATTAAGGGTCTGATTTCTTAGGCCT AATTTTGGGCCGCACATACGGTGAAGCCCCCCCCCCCCCGAAAAAAAAAA AAAAATCGGGGGGTTTTCTTTTAAAAAAAATTTTTTTTTTTTTTTGCCCG GGGGGGGGGGGGAACACTCAAGGTAAATGCCCTACCGTACGTGCGACCCT TAAGGGTATATTTTTGAAGCTTCCCAAAAGTGCACTGTAAGGGTCTATAA GGGGTATAAAATTTGGAAAATCTGGCCATATTTTGCCTGAAAATGGTTTT GCTTTTAAAATGGTCAAAACATTTTCCAGAAAATGCACCGTAAGGGTCGA TTTTTCGCCAAAATTAAGGGTCTGATTTCTTAGGCCTAATTTTGGGCCGC CCATACGGGGGTGCCCCCCCCCCCCCGGCAAAATAAAAAAAACACTCTGC GATATTTTCGTTAATATAAATTCTCATTTTGCCGAAATTAAAAATGATAT CATGTTTTACTGATCAATTGTCTTTTTTTTTCTATAAGCATACAAAAATT TGAAAACAGCCTCGGAGATGGTTAGGTCGAGGACTTAAAAAAAAATGCTT AAAAGGATGCTTAAATCCCAAGCAATAAGATTTTATGGAAATTCCGAAAA TCCATGAAATTTCAGCTAAATCAGGAAAATATATTTTTAGTAGGCCCAGG GTAATTATACGCCTACATCTTTGACAAATATGAGCCTAGATATGCTTATC AGTGCGATGCTTATAATATAAACACGTTAATGAGATCCAGTGAACATAAA CGCTGGGATGAGATCGCACCAAGCATGAAACATCTACCATTATATTGAAG ACCACTTTCACTTTTCCATAGAGATTTTTTATAGTTCGGTGCAATGACTG TATTCTTATTAAAGGTTGATCGTTTGACTTAGTTTGACTATATTAGAGTT CTGTAAGAAGGACGACGTTTATTGGGGACCTTAGAGCATCTTAAAAAATT TAAAGACTGGACTAATGATTCAGAAACAACGCGTACGCTGGGCTAGCGAT CTGCAGTTATTCTGTGAAGGGTGAAACCCTTCAACACTTCTTGTAGCTTC GGCTACCATTTTTAAAAAGAACGCAAAAATTTTTCGAAGCAAAAAATGTC TACCATAATATTAAAGATCACTTCCACTCCAGTTTTTTTATAGTTCGGTG CTATGACCCTATTGTCATTAAAGGTTGATCGTTTAACTTAGCTTGACTAG ATTAGAGTTCTGTGAGATTTGTCCACTTTATCTCAAAAGTATAAATGATG CCTTTTAAATTATGGGAATCAAGATTTATATTGTATTGAATTAAAACATA TTTTTACATGTGATTTTGTAAGAAAATTATCAACAAAAACTTATTGCATT CTAAATGAATATTCTCTAATTTAAAAAATAACAAAACAGTAAAAGTGGTA AAAATCTTAATTAAACTAAAGTCTGCCTCAAGATAATACGCAGTAAAGAA AAAAAAGGCTGGCTCTAACTTTTAATATGATTCAAATTAAGTGCGCAATT TTGTGCTTGTTGAAAAGATCGAGTGTCAAAAGTTCTTTTATCAGTCAACC GGCAAATGAAAAAATATAATAGTGAATCAAAAAATATTAAAATACTAAAA TTATTGTAAATACATTATATAAGATATGATAACTTATCAATATGAATTGC AGTTAAGAAAATATGACAAAATCAATTTCATGTTTCAACTATAGTAAATT TAAAACTTCAAATTATTCATATTATTCAGATTGTCTTCTTCTATTTCATT CATCATTATCAAATTTTGCAAAAGAATGAAATTGCTTTTCACGTGATACT GTTCAATGTGTCCCAAAAAAATATATAATAATCGGACAAATTTTTATATA AAGTAAAATCGTTATAATTTACAAACTGTATGTTGGTCCTTGTTTCTTAA CAATGAAAAGGTTTGTAGTACTTCATATACAAAAGTATTGTTCCCTTATG TCCCAGTTTTGCAATAAGAAGCAGTATTTGAGAATTAGTACTTCGTAACA ACATGTAAAGTCGTTTCTTTTACTTTAAGAATAAAAAGATTTGTAGCATA CAACAATTAAAAGCATCGTGCCCTTCTACTTAGGCCAAAACAAGCAATAT ATCTAATAAAATGAAAAAGTTTATTGTGCGCTTATGTCCCAGTTTTGTCA AAGAAAATTTAATTTCATGATAATATGTAAAGTCACTTTTTTATTTATTT AAACAATGAAGAGGCTTGTTATACATTGGATACAAAAGTTACAATCGTGA TAATTTCATTGTGTACCTCTGTCCCCATTCTGCAATAAGAAGCAGATTAC TTCATCATGTGATATTATTTTAGTTCCTTTGTTTAACAATGAAAAGATTT GTTGTGCAACGCATACAATAGTTACACAGGTGAATATTAGAAATTTCATA TTGGGTCAATTTTGTAAAGTTTACAATGATTGTTGGCCATTCAAAGCCAT GAGTTTTCCAATCTCCAACAGCCAATATACCACCATTTAAAAGATGTTCA TAAGGAGAAACTTGACTTGTATTCAATTTCTGTCTAACCCATTCTCCAAC AGGACATTTGACGTATTCATCATAATCAATGGAGATGTAGTAATCGATAA CTAAGATACCCTCATTTGTCAATTCTCTTGCTTTATCTAATGCTTCTTCA ATAGAGTTGGTGTAAATCGGTTGACTTCCTTGTGGAAATATTGGAGGAGG TATATTTAAGTGGCTTTTGTATGCATACGATGTTTCTTCAGCAATTCTTT TCGTTTCGAGCACAATTTCTTTTGTGTTTCTGAGGTTATTTTTCAGATGG ATTGTTGTGAAATCATTAATGTCAGTATCTTGGCAGTATGCGTCCGGTGC GATCCACATCACATCAACTAATGTTGATAAATGTTCGATTGTCTTCTTTG TTTCATCCAGCCTATAATCACATTCATCGAGGAAAAGAGCTTTTATCCCT TTTGTAGTGATTATTAATTCCAATGTTTCCTAAAATATAAAAAAATAAAT TTCATTTATAGGGATCATCTAAACGAGAAGAAGCTTTGAATACGGGTACG TTATCAAGAAAGTTTTAAAACTTTCTTGGTCTTATAATAAAAAAATTTAA ATTTAAAAATTCAATGAAGGCTAGTTTCGATATTCAATTGAAAGGGAAAG ATTTGAACAAAATGTAAAGTATGGTATAATTTACGTTGAAAGGTAACGAA GTTGAATATTACATAGTTACTTACGATATCATATAGACCGACCTTCTCTA CTATTATCCCATGAGATTGAAATTCGTGTTTTGTTTGTATGTACAGTAAA CTATTTCCTATGACCAGTTCACCAACAACGAACATCACACGACCGTTGAA TTGTGGCTCCTTACTCAACATTATTGCCCTTTGCTTGAGTATGTGACTCT TTCCAGCGCCCAGACTGCCCTTAATCAAAAGTTTTGTATACTGGGCGTGA TCTCCAATAAATGNTACATGAACAATGAACATCACACGACCGTTGAATTG TGGATCCTTACTCAACATTATTGCCCTTTGCTTGAGTATGTGTGTCTTTC CAGCGCCCGGACCACCCTTAATCAAAAGTTTCGTATATTGGGCGTGATCT CCAATAAATACTGGTAATTGTTCTTTTGAGTGAAATAAAATATTGTGGCT GGTACAAAGTGTGTCGATTGCATCGCTGATATATTTGACCCAGTTGGTTG TTGTGATTGGTGCTATTTGGTCTTTCTTCGAAATGTGTACAGCAAAAATG ATCAAACGCAAAACCTTTATGAGATGCTCGACGGATGGTAGAAATGGTAT CGGAACAGTTTGTTCAGGAAATCGTTTGAATATCGATGATAACCATAATT CTATGTCAGTGTTTATGTCAATGTAATGTTGAGTTTCGAAAGACAGGGTA TTCTTCCCGACAGAAATCACTGGGAAAAATGTCCAGTCGGGACCAAACTG ATCACCTAATCTTTCTTGGAATAGCGTGTGATATTTTTCGATTTGGTCAA AAGCGGTGTCATTGAGTTGTCTCTTTATTTCGATACCAATGACGAGTTTT CTTGGCCAAGAGAAAATGACCAGGTCAAATTCTTGATGTTTCTTTTTGCT GACGTCAGTTAAAAAACAAACCGATTGAAGGATAACTGTATCTTTTAATA AAGTCTCCTCTCTCATAGACAATAATTTATCGAAGAACATTTGTTCATAA GCCTCGCCACGATGTGATAACACCAATTCAAAAAACCATAACAAGTTTGA ATCCGTGCATGGGTTTTGTTTAATCAGTTTCTCTATTCCAGGTTTTAGAT TCTTTTTACCGTTCACATTTCTCAAAGTTTGTAGATAATTTCGTAGAGTG GCTTCAAGCTCTGCTCCTGGTTTCTTAGAAGCCAGCTCAGCTATGCAGCC TTTAATGAAGATATTTGTTTCTAAAATTGAAGGCGGTAAATTGACCTCTT TTCCATGCAATTCCTGGGCGACAAGATATGACATTTTAACGTTTAGGATC CACTTGTCGAAATCAGCAGCATTTATTTCTTTAGCATCATCAGTTGATAA TCCTTGTTGTTGGACGAAAGTTTTTAACTGTTCTGTGAACCAATAATTGG GAAATTCATTCGATAAGTTAGCCAACGTTGTCAGAAATGTTTTTTCGAAT TCGTAATCCAAAAGAGGAGCTGCAGATTTACTTGTATATTGATTTGAACA GAACACTGGAGGTATGAATACACATTCGTGTTTTGTGTTATCAACGAGAG AAGAATCGCCATATTCTCTCTGAAGTAAATAATCAGCTGCAGTTATTGGG TCGGTGAATATTTGGCCGTTGCCGAGATTAAACTGTTTAGTTTGATGCTG TAAAGTTTTTCTAGAGTATCTAAGAACTTGTTGGTGTAGTGATTTACCCA GAGTGCATTTCGATGGGTCGATCATTTTCGGTTTCATATCCATGACTTTT TTCTCCATCCTGTTGTTATTCGCTGCAGCCATTCTTTGTCCAACGGTATA GTGTTACTTTTTTACTCTGTTCTAAAATAATAAAGGTTATTTGTCAGCTA TCATTTACAAAATAAACCCAAAAATAATATAATCTCTTAGCCTTGGTATC TTGAATAGATTTTAGAAAATAAGATGTTATTATTCCGTCCATTTGAATTT TAAGTGAAAAACTTTTCTTTCTACTGTCGAATACAAAAGACATTATCCAA ATGATAGAATGTGATGTACCAAAAAAAACAGTATCCTAAACTTGAAGAAT CTTTAACATCAAAATGAAACATAAACACGCTGTAGTTTAATTGATAAACT TTGTTTTAAGTTGTCCTTTGATAAGCGACGAATGTGAATTATTGTATCAT AAATAAAAATCGTCTAAAGTTATCTGCAACAGCCCAAGACTAACCGTCAA CTCAAATTATTTAAAAGAACTAAACTGCAAACCATAAACATCAAATTAAA ATTCCTGTTTACGATCTGCAGTATATACCTTGCCTACCATTTTATTTATT TGACTCCCTGTAATGTTTTTCTTGTCTCTATTATTTATTTTCATGGTCGA TCTTTTAACTCTTGTGTAATGTATTCACTATCAACAAATCTGACATGTTT ACTTTGCTATAAATTTTTATTTTGTAAGAACACTTTTATTAAAGAGTCAA AACAGTAAACTTCCTTTATATTTTTGCAAAATATGCTGTTGTAGAAATTT CAATCAAAATTGGAATAAAAATTCACCCTCTATCTTAAACTAAATAACAC TCAAGCACTTCTTAAACCAAACATATCAGACATACATTTTCTCTTTTTTC TAAACGTCTGATATTCAACAATTAATTTGTCCAATTAGATTGCAATTTTA ATGAGGGTTTTGATGAATACTGACATACATAATAACAAGTTTTTTTGAAG ACGACTATTTTTATTTTATTTTATTGGCAATTTGACAATTTTATTCTCAA ATTGTTCTTACTTATTATGTTCTTATTGTCAACGTATTAGATAAGTTTTT AGGGCTGGAAAGGTTATTGTTCTAAAGAAAGGGAGAAATTATTCTGATAT AAATAAGGGGGCAAGATAAATCGTTTCTTATAAAAGTGAAACTGATATAT GATCTGTTTCAAATGACTCTCATGCTTGTAAAATTGCCAAAAATAAAGAG CAATTTAAGAACAATGCTGAGCTTGGAATTGCTCATTTTCAAGCAATTTA GCGGTCAGAGTAATAAAAATTGGGTATGAATTCGTTCTAAAATATCTCAA TTTCATCCCAAAAATAAAAACAGGATAAGAACAAAGTGCTAGAAAAAATA GGAACAGCTGAACCTCAGCAAAAATCTACTAGTTCTTATAAAAAGAATAG TTTACTTCACTTTGTCAATGTCAATGTTTTCTTTGCTAAGTATTTCTTTT TTTGTTGTGTAATCATTTTAGAATTGACTAATTCACGTTTTTTTATATGA CAGCACTTTCGGTAGCCATTTTTTTTCCTTTATTTTTTTGTCAAAATAAT TCTTGCAATTTTCTTAACTTTTTCAATTACAAATGTTAGAATTTTCTCCA AGCCACTAAATCATGATTCAAAATAAATAAACAACACAAAAATTTTTATT CAAACAAAGCTTTTCGAGTCGACATGAGCATTTTCGATTTCTTTGCCGAT GTCGGGATATGCCGACATGGGCACTTTCCATTCCTTTGCCGCAAAATTTA ACACTTCTACAAAGATTTTGTATTAGATGGTTTGAAATGAAAAAAGAAAA TAGTTAAAAGCTTTTATATGTTGAAAAATAACTATTCAACAAGTTCAACT CAAAATTATAGTCCTTGGCTGATACTTCATATATTATTCAGAAAATGAAG TCAAAATCGCTACCTTTTTCCCATGTCGGCATATGCCCTTCTTTTTTTCC CGTGGCAAATAGGTCGCACCTTTTTTTCCCCGTGGCAAATAGGTCGAACC TTTTTTTCCCCGTGGCAAATAGGTCGAACCTTAAAAAATACGAACGGCAG TTATAGGGTTTAACTGCTCATCATCAGGTTAAAAATGAAATTTTTAGGTT GAAAAATGTATCTACATATCATACAAAAAATTGATTCTAGAATAAAAGGC TTTTTTCTCCATCCTGTTGTTATTCGCTGCAGCCATTCTTTGTCCAACAG TATAGTGTTACTTTTTTACTCTGCTCTAAAATAATAAAGGTTATTTGTCA GCTATCATTTACAAAATAAACCCAAAAATAATATAATCTCTTAGCCTTGG TATCTTGAATAGATTTTAGAAAATAAGATGTTATTATTCCGTCCATTTGA ATTTTAAGTGAAAAACTTTTCTTTCTACTGTCGAATACAAAAGACATTAT CCAAATGATAGAATGTGATGTACCAAAAAAAACAGTATCCTAAACTTGAA GAATCTTTAACATCAAAATGAAACATAAACACGCTGTAGTTTAATTGATA AACTTTGTTTTAAGTTGTCCTTTGATAAGCGACGAATGTGAATTATTGTA TCATAAATAAAAATCGTCTAAAGTTATCTGCAACAGCCCAAGACCACTGA CCTTTATATAACCCTGGACCCTGCAATATCTGCCATCTTTGATTGTAGTT TTTTTAGAATTGGTACCCAAGGAGAAGCCATTGCAATGTTAAAAATTAAC GTCTAACGCCGCTACATCATCAAAAGAATTTGAGGAAAAGTAGACCTANN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNTGCCGACATTAGGGTACCAATTTTCAAAAAACTCCGATCAA AGATTTTGCTTGGCTGGGATTGAGAAGCTTTGTCCAGGGTTATATAAAGG TCAGTGCCCAAGACTAACCGTCAACTCAAATTATTTAAAAGAACTAAACT GCAAACCATAAACATCAAATTAAAATTCCTGTTTACGATCTGCAGTATAT ACCTTGCCTACCATTTTATTTATTTGACTCCCTGTAATGTTTTTCTTGTC TCTATTATTTATTTTCATGGTCGATCTTTTAACTCTTGTGTAATGTATTC ACTATCAACAAATCTGACATGTTTACTTTGCTATAAATTTATTTTGTAAG AACACTTTTATTAAAGAGTCAAAACAGTAAACTTCCTTTATATTTTTGCA AAATATGCTGTTGTAGAAAATTCAATCCAAATTGGAATAAAAATTCACCC TCTATCTTAAACTAAATAAACCAGCCGAGGCTGGAAGGTCAGCCAATAGA GCTTAGCTAGATAGCTTTAATAAGNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNCCCCATTTTGCTTTAAACTCCCTTTTGATTGGTCTATGAATTT GGGCGATCGCTTTACCGCCTTGACAGAATAAACACACGACCATAATAAAT AAATTCAACATGGCAGCGGAGTAGCAATTAATTCCATTCCATCATTCAGT CAAAACGTGCGCCAAGGTTAGAAAAGGTTAGAAAAACACAATCTGCGTCC GGAACGGCGTGAAAAATAGTTTGATCAATTTCAACAAGAACTGTATATAT TAATATTAATATAATTGATCAAATTCCAAAGACCATTTGTCATAATCATC TGACCGACCCTGATTTACGGTCAGCAGGTAGAGTTGTAGAGTCGGAAAGA TTTNCTGTGCAAGTTGTGACGTGAGTGTGCATGTTGTGTAACTTGACGGT ATAATTCATTAAATTCTAGAAACCATTTTTCATAACTTTCTGCAGTCCGC TTTCTGAAAGTCTGATAAGAGATATGTATAAAAAGTTATCGCCATTCATT CCATTCGACATCATTCAGTCAAAACGTGCGCCAAGGTTAGAAAAGGTCAG AAAAACACAATCTGCGTCCGGAACTGCGTGAAAAATAGTTAGATCAATTT CAACAAGAACTGTATACATTAATATTAATATAATTGATTAAATTTCAAAG ACCATTTGTCATAATTTTGCAAGTCCAATAATAGGAGATGTGATGTCATC ATTTGGTTCCCGTCATCTGACCGACCCTGATTTACAGTCNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NGTACCCAAAAAGTTAACCCGATCGGAAGAAAGTTTAGAAATCAAAGTGA GATCGATCGGGAAATCGGATTTTTTTTTTGCCGTCTTATGATGGAGGAAC TGGAAGAAAATTTTACCTATTTAAATGCTCAGCTTAGGCTGACCAATAAC AGCACTTCTTAAACCAAACATATCAGACATACATTTTCTCTTTTTTCTAA ACGTCTGATATTCAACAATTAATTTGTCCAATTAGATTGCAATTTTAATG AGGTTTTTGATGAATACTGACATACATAATAACAAGTTTTTTTGAAGACG ACTATTTTTTTTTTATTTTATTGGCAATTTGACAATTTTATTCTCAAATT GTTCTTACTTATTATGTTCTTATTGTCAACGTATTAGATAAGTTTTTAGG GCTGGAAAGGTTATTGTTCTAAAGAAAGGGAGAAATTATTCTGATATAAA TAAGGGGGCAAGATAAATCGTTTCTTATAAAAGTGAAACTGATATATGAT CTGTTTCAAATGACTCTCATGCTTGTAAAATTGCCAAAAATAAAGAGCAA TTTAAGAACAATGCTGAGCTTGGAATTGCTCATTTTCAAGCAATTTAGCG GTCAGAGTAATAAAAATTGGGTATGAGTTCGTTCTAAAATATCTCAATTT CATCCCATAAATAAGAACAGGATAGGCTCAAAGTGCTAGAAAAAAATAGG AACAGCTGAGCCTCAGCAAAAATCTACCGGTTCTTATAAAAAGAATAGTT TACTTCACTTTGTCAATGTCAATGTTTTCTTTGCTAAGTATTTCTTTTTT TGTTGTGTAATCATTTTAGAATTGACTAATTCACGTTGTTTTTTTATATG ACAGCACTTTCGGTAGCCATTTTTTTCCTTCATGTTCTTGTCAAAATAAT TTTGGAATTTTCTTAAACTTTTCCAATTACAAATGTTAGAAATCTTTTAA TTAAGGCCTCGTTGTCTCTAAAACACCACCACTTTCTAGACTGGAGTCGT TTATAATGCGTGTATATGCGTTATATGCTAATACGATTATTATTACGGGA TTTACTTTGTATAAAATTGTTTGACCAGAAATAGCGACCACGACCAGCGA CCACGACCGGCGACCAGATAAATTTGGATTATAGAGTTTATCTGCTCTCT CCACTGTAGAGAATGTTTTATAATCAAGTCTGCAGAATACTAAAAAGTGA CCTTTGAAGTAACCAATCATTTTCTTGACAAAGTGACACTATTTGACAAA AATATTGACAGAGTCATTAAGTATGATGTGTGTAAGCTTTGTTACACCAA ATATTTTGATTATCTGAATGAGATGTCTTTAGTATGAATAGATAGAACTT GTCCGTAGGAAAAAATTGGGAAGGCCAGTTTTAGAGATATGAATCTAATC AATTATTCTATTGTCTTTATGCTGACAAAATGACTAATTTCGACAGTAAA TAACAATCTGATGAATCTGCTTCTCAAACTATTTTCAAAAAATTTTGTGC CACTAATTTTGACGCTGATAATACAAAAGGATAGAAATTGACACCATAAT CAAGCTCCAAGAGCGTCGAAATGGTTATATTTTATGTATTTGGCACGTGG CTTTAAATAGATGAGACAGGGGTGAGCTTACTCTTCAATATGATATATAT TCAAATGATTAGGAGAGACAATCTACGTTGGAGAAAGGGAAAAAACTCGA TAACCCAAATTTATCTGGTCGCTGGTCGCTGGTCGTGGTCACCGGTCGTG GTCGTCATTTCATGTCGATGTTTAGCAACTCCCCTTCCCATTTCCCTCGG AAGACGTTATCAATTTGAAAGGAGCAAGAGTTCAACTTAAGAGTTATTTC AAACAACATTTTTATGCATTTTCATTAAAAAAAAAAAAAAGAAAAAAAAG AATATCAGAAGGATCGCTTATGGATTCGTTCTATAACCTTTTAGCCGAAC AGATAATGTGTTGGTCTATTTTAAGGACCAGATCAGGTTTTCAAATTAAA ATAGTTAATTAAAATAATTGGTCCTTTAAAGATTTTTGTCTGATGTAATC TATCTCACAGAAAACCAAGATGAATACACGTTCTTTTATAAGAATATACT TTATAATTAGCCAAAAAATTAAGAATATACTAAAAATATTACCATCATCA TTGGCATCTTAAAGCATTTTTAACTGGTAAATTGCCAACTGTCCCTCATC AAGGCTCAAAACTTTAAGTAAAGCGTATCTATATATAATTGGCAGTGGAA ACAAGAGTGTCTGTAACTTTTGATAGTCAAATATAATTACCAGATCAGGT TTTCAAATTAAAATAGTTAATTAAAATAATTGGTCCTTTAAAGATTTTTG TCTGATGTAATCTATCTCACAGAAAACCAAGATGAATACACGTTCTTTTT TTAGAATATACTTTATAATTAGCCAAAAAATTAAGAATATAATAAGAGTA TTTCCATCATCATTGGCATCTTAGAGCATTTTTAACTGGTAAATTGCCGA CTGTCCCTCAGCAAGGCTCAAAACTTTAACTAAAGTGTATCTATATATAA TTGGCAGTGGAAACAAGAGTGTCTGTAACTTTTGATAGTCAAATATAATT ACCAGAACAGGTTTTCAAATTAAAATAGTTAATTAAAATAATTGGTCCTT TAAAGATTTTTGTCTGATGTAATCTATCTCACAGAAAACCAAGATGAATA CACGTTCTTTTATAAGAATAGGCTTTATAATTAGCCAAAAAATTAAGAAT ATACTAAAAATATCACCATCAACATTTGCATCTTAGAGCATTTTTAACTG GTAAATTGCCGACTGTCCCTCAGCAAGGCTCAAAACTTTAAGTAAAGCGT ATCTATATATAATTGGCAGTGGAAACAAGAGTGTCTGTAACTTTTGATAG TCAAATATAATTACCAGATCAGGTTTTCAAATTAAAATAGTTAATTAAAA TAATTGGTCCTTTAAAGATTTTTGTCTGATGTAATCTATCTCACAGAAAA CCAAGATGAATACACGTTCTTTTATAAGAATAGGCTTTATAATTAGCCAA AAAATTAAGAATATACTAAGAATATCACCATCAACATTTGCATCTTAGAG CATTTTTAACTGGTAAATTGCCAACTGTCCCTCAACAAGGCTCAAAACTT TAACTAAGCAATTTTATGGTTCATGTGCGTGTATGACATGCCAAATTTAG GTTTGATTTTGATCCTAACATAAGAATACCACAATAGAATCTTTATGGAT CATTTTCCCCAAAAAATTAAGAATATCCACGATAAACACCATTCTTAAAA AAAAAAGAAAAGAGAAGAAATACCTCTCTAAAGAATTGCAATATTTGATA TGCTATAGTCGTCTAATAATATAGCAGGTAGTAAATACATAGCCTGTACC AACCTACCCCACGGGTGTTTTTTATACTTAAAAAAAACTTGCGGTGTGTC GAACTTGGCATTATCTTTTCAGTCAGCGAAGAAGAGTTTGGTACAGGCTT GTAAATACAGGGACTTCATGTTTTGTTTCTTTGCTTTAGTTCCATGTAAT TCTCACGAAAAGATATTAACGTAAATAAAACAGGCGTCGAGTGAAAGGCT CTATAAAATGTTGATAGTTTCCCTTCTACCTTATCGGGGAAAACTTCCTC GGGGAAAAGTGACGAAATTTTGGCCAAGTGACGAATATTTTTCCCCGACG AAAATTTTCCCCGGCCTTAATGCGTTTACTGACTACCAGCAAGTGACGAA TATTTTTCCCCGACGAAAATTATCTCCGACGAAGTTTTCCCCGATAAGGT AGCTCTTTTTAAAAACCTGGGTTTTCGTTAAAAAAGAATTTCTCTCTAAA AGACTAAATATAGGTATTTCTAAATATTACTGGGGTATTCACCCTTCGCA CAACTTTCCACCCAAACAAAAAATTTTTAACTTAATATTTCTGGACATGA AGTTTTGTTCACCAAATATGAATTGGCTTTGGTAAAAATGTAGGCATCCT TTGTGAATTCTTGTAGCTTCGGCTACCATTTTTAAAAAGAACGCAAAAAA TGTCTACCATAATATTAAAGATCACTTCCACTCCAGTTTCTTTATAGTTC GGTGCAATGACTGTATTCTTATTAAAGGTTGATCGTTTGACTTTAGCTTG ACTATATCAGAGTTCTGTATAAAGGACGACGTTTATTGGGGACCTTAGAG CATCTTAAAGATGACTTGACTAATAATGCAGAAATAACACAAACGTTGGG CTATAGCGATCTGCAGTTATTTTGTGAAGGGTGAAACCTTCCAACAATTC TTGTAGCTTCGGCTACCATTTTTAAAAAGAACGCAAAACATTTTCCAAGC AAAAAATGTCTACCATTATTAAAGATCACTTCCACTCCAGTTGTTAATAG TTCGGTGCTATGACCGTATTGTCATTAAAGGTTGATCGTTTAACTGCCTG ACTAGATTAGAGTTCTGTGAGATTTGTCCACTTTATCTCAAAAGTATAAA TGATGTCTTTTAAGTTATGGGAATCAAGATTTATATTGTATTCAATTAAA ACATATTTTTACATGTGATTTTATAAGAAAATTATCAACAAAGACTAATT GCATTCTAAATGAATATTGTCTTCTTCTATTTCATTATTTGCAAAAATTG CAAAAATAATGAAATTGCTTTCAACGTGATACTGTTCAATGTGTCCCAAA AAAAAAAAAAAAATGATCGGACAAATTTTTATATAAAGTAAAATCGTTAT AATTTACACACTGTATGGGGGTCCTTGTTCCTTAACAATAAAATTCACAT CAAAAAGTATTGTTCCCTTATGTTCCAGTTTAGCCATAAGAAGCAGTATT TGAGAATTACTACTTCGTAATAACATGTAAAGTCGTTTCTTTTACTTTAA GAATGAAAAGGTTTGTAGCATACAACAATTAAAACCATTGTGCCCTTCTA TTTATGCCATAACAAGCAATAATATATCTAATAAAATGAAAAAATTTAAA GCTTGAATATTTGGATGGGTCACGGCAAGAAGCAACAAAAATTTATTTAT TTATTGATAAATTTTCTTCCTACTCTATGGTAGAGCATCTTCACCTCGAA CATAACTCATAAAAAAAACCTATCATATAGCATTTTCAGACATTTGATTA AAAATTTATTGTGCGCTTCTGTCCCGGTTTTGTCAAAAAAAATTTAATTT CATGATAATATGTCAAGTCACTTTTTTTATTTATTTAAACAATGAAGAAT GTTGTACATTGGACACAAAAGTTACACTCGTGATAATTTCATTGTGTACC ACTGTCCCAATTCCACAACAAGAACGGAGTGATTCAGAAATTTCCCATCA CGTGATATTATTTTAGTTCCTTTTTTTAACAAGGAAAAGGTTTGTTGTGC AACGCATATAATAGTTACAATGGTGAAGATTATGAACTGCAGAATCTAAC GGTTTTAAAACGTTTACAATGATGGTTGGCCATTCAAAGCCATGAACTTT CCATTGACCAACAAACACTATACCACCATTTAAAAGATAATCATAAGGAG AAACCTGACTTGTATTCAATTTCTGTTTAACCCATTCTCCAACAGGACTT TTGACGTATTCATCATAATCAACGTAGACGTTGGGATCAATAACTAAGAT ACCCTCCTTTGTCAATTTTCTTGCTTTATCTAATGCTTCTTCAATAGAGT AGGTGTAAATCGGTTGACATCCTTGTGGAAATATTGGAGGAGGTATATTT AAGTGACTTTTGTATCTATACGATGTTTCTTCGGCAATTCTCTTTGTTTC GAACACAATTTCTTTTGTATTTCTGAGGTTATTTTTCAGATGGATTGTTG TAAAATCATTGATGTTTTTGTCTTGACAGTATGCGATCGGTGCGATCCAC GTCACATCAACTAATGTTGATAAATGTTCGATTGTCTTCCGTGTTTTATC CGCCGCATAATCACATTCATCGATAAAAAGAGCTTTTATCCCTTTTGTAG TGATTGTTAATTCCAATTTTTTCTAAAATATAAAAAAATAAATTTCATTT ATAGGTATAATCATCTAAAAGAGCGGAAGTGTTGAATACGGGTACGTTGT ATTCAGTTTTCTTAGTCTTATCAAGAAAGTTTTAAAACTTTCTTGGTCTT ATAATAAAAAAATTAAAATTTAAAAATTCAATGAAGGCTAGTTTCGATAT TCAATGGTCAATTGAAAGGGAAAGATTTGAACGAAATGTAAAGTATGGTA TAATTTACGTTGAAAAGTAACGAAGTTGACGATGGCGATATTACATAGTT ACTTACGAAATCATATAGAGCGATATTCTCTACAATTATCCCATGAGATT GCAATTCGTGCTTTGTTTGAAAGTACACTAAGGGATTTCCCATGAGAAAT CCATTAATGACGAACATCACACGACCGTTGAATTGTGGATCCTTGCTCAA CATTATTGCCCTTTGCTTTAATATGTGACTCTTTCCAGCGCCCAGACCGC CCTTAATCAACAGTTTCGTATATTGGGAGTGATCTCCGATAAATGCTGGT AATTGTTCTTTTGAGTGAAATAAAACATTGTGGCTGGTACAAAGTGTGTC GATTGCATCGCTGATATATTTGACCCAGTTGGTTGTTGTGATTGGTGCTA TTTGGTCTTTCTTCGAAATGTGTACAGCAAAAATGATCAAACGCAAAATC TTTATGAGATGCTCGGCGGACGGTAAAAATGGTATCGGAACAGTTTGTTC AGGAAATCGTTTGAATATCGATGATAACCATAACTTAATGTCAGTGTTTA TGTTAATGTAATGTTGAGTTTCGAAAGACAGGGTATTCTCACCGACACAA ATCACTGGGAAAAATGTCCAGTCGGCACCAAACTGATCACCTAATCTTTC TTGGAATAGCGTGTGATATTTTTCGATTTGGTTAAAAGCGGTGTCATTGA GTTGTCTCTTTATTTCGATACCAATAACGAGTTTTCTTGGCCAAGAGAAA ATGACCAGGTCAAATTCTTGATGTTTCTTTTTGTTGACGTCAGTTATAAA ACAAACCGATTGAAGGATAACTGTATCGTTTAATAAAATCTCCTCTCTCA TAGACAATAATTTATCGAAGAACATTTGTTCGTAAGCCTCGCCACGATGT GATAACACCAATTCAAAAAACCATAACAAGTTTGAATCCGTGCATGGGTT TTGTTTAATCAGTTTCTCTATTCCACGTTTGAGATTCTTTTTACCGTTCA CATTTTTCAAAGTTTGTAGATAATTTTGTAGAGTGGCTTCGAGCTCTGTT CCTGGTTTCTTAGAAACCAGCTCAGCAATGCAGCCTTTAATGAAGATATT TGTTTCTGAAATTGAAGGCGGTAAATTGACCTCTTTTCCATGCAATTCCT GGGCGACGAGATATGACATTTTAACGTTTAGGATCCACTTGTCGAAATCA GCAGCATTTATTTCTTTAGCATCATCAGTTGATAATCCTTGTTGTTGGAC GAAAGTTTTTAACTGTTCTGTGAACCAATAATTGGGAAATTCATTCGATA AGTTAGCCGACGTTGTTAGAAATCTTCTTTCAAAGTCGTAATCCAAAAGA GGAACTGCAGATTTACTTGTATATTGATTTGAACAAAACACTGGAGGAAT GAATAGACATTCGTGTTTTGTGTTATCAACGAGAGAAGAATCGCCATATT CTCTCTGAAGTAAATAATCAGCTGCAGCTATCGGGTCGGTGAATATTTGC CCGTTCCCGAGGTTAAACTGTTTTGTTTGTTGCTGTAATGTGTTATGAGA ATGCCTCAGAACTTGTTGGTGTAGTGATTTACCCAGAGTGCATTTTGATG GGTCGATAATTTTCGGTTTCATAGCCATGACTTTATTCTCCATACTGTTA TTATTCACTGTAGCCATTTTCCTTTCAACGGTATTGTTACTTTTTTACTA TGCTTTAAAAAAATAAAAGTTGTCAGCTATCATTTACAAAATAAACCCAA TCTTGAACAGATTTTAGAAAATAAGATGTTATTATTCCGTCCATTTGAAT TTTAAGTGAAAAACTTTTCTTTCTACTGTTAAAAAATTAAGAAATAAAGT GATTTCAAAAAGACATTATCCAAATGATAGAATGTGATGTACCAAAAAAC AGTATCCTAAACTTGAAGCATCTTTAACATTAAAATTTGACATAAACAAG TTGTAGTTTAATTGATAAACTTTGTTTTAAATTGCCCTTTGAAAAGCTTA CGACCACAGAAATAAAGTGTTTTCAAAAAGACATTATCCAAATGATAGAA TGTGATGTACCAAAAAACAGTATCCTAAACTTGAAGCACCTTTAACATTG AAATGAAACATAAACATGTTGTAGTTTAATTGATAAACTTTGTTTTAAGT GGCCCTTTGAAAAGCTTACGACCACAGAAATAAAGTGTTTTCAAAAAGAC ATTAATCATGTGATATGATGTACCAAAAAAACAGTATCCTAAACTTGAAG CATTTTTAACATTAAAATGAAACATAAACATGTTGTAGTTTAATTGATAA ACTTTGTTTTAAGTGGCCCTTTGAAAAGCTTACGACCACAGAAATAAAGT GTTTTCAAAAAGACATTAATCATGTGATATGATGTATCAAAAAAACAGTA TCCTAAACTTGAAGCATTTTTAACATTANCATTATCCAAATGATAGTATG TGATGTATCAAAGTCACAATACCCCAAACTTGAAGCATTTTTAACATCAA AATGAAACATAAACATGTTGTAGTTTAATTGATAAACTTTATTTTAAGCG GCCCTTTAAAAAGCTTACGACCACAGAAATAAAGTGTTTTCAAAAAGACA TTATCCAAATGATAGAATGTGATGTACCAAAAAAAAACAGTATCCTAAAC TTGAAGCATCTTTACCATCAAAATGAAACATAAACAAGGTGTAGTTTAAT TGATAAACTTTGTTTTAAGTGGCCCTTTGAAAAGCTTACGACCACAGAAA TAAAGTGTTTTCAAAAAGACATTATCCAAATGATAGGATGTGATGTACCA AAAAAACAGTATCCTAAACTTGAAGCATCTTTAACATTAAAATGAAACAT AAACATGTTGTAGTTTAATTGATAAACTTTGTTTTAAGTGGCCCTTTGAA AAGCTTACGACCACAGAAATAAAGTGTTTTCAAAAAGACATTATCCAAAT GATAGGATGTGATGTACCAAAAAAACAGTATCCTAAACTTGAAGCATCTT TAACATTAAAATGAAACATAAACATGTTGTAGTTTAATTGATAAACTTTG TTTTAAGTGGCCCTTTGATAAGCTTACGACCACAGAAATAAAGTAGTTTC AAAAAGACATTATTCAAAATGATAGAATGTGATGTACCAAAAAACAGTAT CCTAAACTTGAAGCACCTTTAACATCAAAATGAAACATAAACATGTTGTA GTTTAATTGATAAACTTTGTTTTAAGTGGCCCTTTGATAAGCTTACGACC ACAGAAATAAAGTGTTTTCAAAAAGACATTATTCAAATGATAGAATGTGA TGTACCAAAAAACAGTATCCTAAACTTGAAGCATCTTTAACATCAAAATG AAACATAAACATGTTGTAGTTTAATTGATAAACTTTGTTTTAAGTGGCCC TTTGAAAAGCTTACGACCACAGAAATAAAGTGTTTTCAAAAAGACATTAT CCAAATGATAGAATGTGATGTACCAAAAAAACAGTATTCTAAACTTGAAG CACCTTTAACATCAAAATGAAACATAAACATGTTGTAGTTTAATTGATAA ACTTTGTTTTAAGGGGCCCTTTGAAAAGCTTACGACCACAGAAATAAAGT GTTTTCAAAAAGACATTATCCAAATGATAGTATGTGATGTATCAAAAAAC AGTATTCTAAACTTGAAGCATCTTCATCAAAATGAAACATAAACATGTTG TAGTTTAATTGATAAACTTTGTTTTAAGTGGCCCTTTAAAAAGCTTACGA CCACAGAAATAAAGTGTTTTCAAAAAGACATTATCCAAATGATAGGATAG GATGTACCAAAAAACAGTATCCTAAACTTGAAGCATCTTTAACATCAAAA TGAAACATAAACATGTTGTAGTTTAATTGATAAACTTTGTTTTAAGTGGC CCTTTGAAAAGCTTACGACCACAGAAATAAAGTGTTTTCAAAAAGACATT ATCCAAATGATAGAATGTANNAAAAGCTTACAACCACAGAAATAAAGTGT TTTCAAAAAAACATTAATCATGTGATATGATGTACCAAAACAACAGTATC CTAGACTTGAAGAATCTTTCATCTAAATGAAACATAAACATGTTGTAGTT TAATTGATAAACTTTGTTTTAAGTGGCCCTTTAAAAAGCTTACGACCACA GAAATAAAGTGTTTTCAAAAAAACATTATCCAAATGATAGTATGTGATGT ACCACAAAACAGTGTCCTAAACTTGAAGCATTTTTAACATCAAAATGAAA CATAAACATGTTGTAGTTTAATTGATAAACTTTGTTTTAAGTGGCCCTTT AAAAAGCTCACGACCACAGAAATAAAGTGTTTTCAAAAAGACATTATCCA AATGATAGAATGTGATGTACCAAAAAAACAGTATCCTAAACTTTGAAGCA CCTTCATCGAAATGAAACATAAACAAGTTGTAGTTTAATTGATAAACTTT GTTTTAAGTGGCCCTTAAAAAGCTTACGACCACAGAAATAAAGTGTTTTC AAAAAAACATTATCCAAATGATAGGATGTGATGTACCAAAAAAACAGTGT CCTAAACTTGAAGCACCTTTAACATCAAAATGAGACATAAACAAGTTGTA GTTTAATTGATAAACTTTGTTTTAAGTGGCCCTTTGAAAAGCGACGAATA TGAATTATTGTATCATAAACAAAAATCGTCTAAAGTTATCTGCAACAGCC CAAGACTAACCGTCAACTCAAATTATTTATAAAAACCAAACTGTAAACCA TAAACCATAAACATCAAATTAAAGTTTGAGTATGAAATTAACTTAAATCG TTTTCTTTACTCAAACTAGTATAAAGCTCTGTTATCATTAACATTGAACA CTGTTATTGGTTTTGGCTTACACAAATCATAAACATCAAATTAAAATTCC TGTTTACGATCTGCAGTATATACCTTGCCTACCATTTTATTTATTTGACT CCCTGTAATGTTTTTCTTGTCTCGATTATTTATCTTCATGGTCGATATTT TAACTCTTGTGTAATGTATCCACTATCAAAAAATCAACAAATCTGACATG TTTACTTTGCTATAAACTTTTATTTTATAAGAAAACAAATGTTGAAATAG TGCTCGATACACTGGGTAGAGCTTTGATACATATATTTTCATTTGTTAAA ATTTAAAATCCATATATTACTGTCAGTTTCACGCCTTGTGCGATCATCAG ATATACTATACTACAAATTAAATTTTTGGACCTACCCCGGTGGGGTAGAG GTCCTATAAATTAACCGATGTCCGTCTGTTCGTCCGTTCGTCCGTCTGTT ACCAGCTTTTCTCAGGATTGGCTCATTAGTTTTTTCTGATTTTTGGCACA ATGATGCAAAATGGCAATGCCCAGAATGTGACGGAGCCCGATTTCGGAAA AAAAATTTCTTTCCGGCCGAAAAAGCCGGAAATATGCCGGAAAAACTGTT TTTTGGGCATTTTCTCGAGATTTTATCATTAGTTTTTTATGATTTTTTGC TCAAAGATGCGTATTAACAATGCCCAAAACATAGCCGAGTCTGATTTTTG AGAAAAAAATCTTTCCGGCGAAAAATGCCTGAAATATGCCGGAAACGCCG TTTTTCTAGATTTTCATTGGACTTTCCTTACAATTGGTTGTTTTTTCATT CAAAAACATTATTAATAGCAATGCCCACCATCAAGTATGTTTAAATTTTC AAGAAAATTGATTTTGAAGCCGGAACTATTTTAAAAGTCGCCGGAACAAC CTATTTTCGCCGGAAAAACGGTATCTCTTGAATTTCTCGAGCTGTACTTA ATATATTTTTATGAAATTTTGCACACTGATGCAATATGACAATACCTAAA ATGTGACGGAGCCCGATTTTCGAAAACAATTTTTTTCCGGCAGAAAATGC CGGAAATATGCCGGAAAAACCGGTTTTTTGACTTTTTCTCGAATTTTCAT TTTTAGTTTTTTCTGATTTTCTGCAGAAAGATGCGTATTCGCAATGCTCA AAAAATGGCCGAGTTCGATTTTTGAGGAAAAATTTTTTCCGGTTGAAATG CTGGAAATCGCCGTTTTGCAGATTTTCATTGGATTTTTTCCTTATATTTA TATGTTTTTCACACAAAAACATTATTGATAACAATGCTCACCATCAAGCA TGATTCAATTGTCAATAAAACTGATTTTTGCAACCAGAACTTCCTATTTA TTTTTTCCCTACAACCCTTCTCTCTCCCCATCAACAATCAATGATGAATT TATTGTGTTGTGTATTTTCGCTAAACGCTATATTTTCTGACTGATTTTTT TCATTTTTCTTTTCGCATTGCTATCTAACTTTCATCATCAGGTAGGTCCA TTCAGCATGTTGCTTGTTTCTCATAAGACGTATACACTATGCTAGAAATT GCAAACCGTTACGAATGAATAAAATTTAATAAAATGCTCATGGGAAAAAA ATTGATACTAAAAACAATTAGTGTGGGTTCAGTCCTATACCTTGCCTACC ATTTTATTTATTTGACTCCCTGTAATGTTTTTCTTGTCTTTATTATTTAT CTTGATGGTCCTTGAACATTGGTTAATATTCTAACTCTTATGTAATGTAT TCACTATCAACAAATCTGACATGTTTACTTTGCTATAAATTTGTATTTTG TAACAACACTTTTATTAAAGAGTCAAAACAGTATAAACTCCCTTTATATT TTCGCAAGATACATAGGCGAAGGGAGATACCCTGCAAAATTTATGAGGGA GTTCAGACGTTTATGACATATTCATTATGTTTTGGATAAAACAAAGACAA TAATTACAGTGTCGTAAAAACCGCTCTCAGCCATAAATTTTGCACGGTAT CTCGCTACGCATTTGCATGAAACCTTTTAAAAAATACATTATAATAATAA AAAATAATAATAACAATGATATGAAGGAAATTTAAATAATCTTGAAATTA TACATCTGTTGTAGAAATTTTAATCCAAATTGGAATAAAAATATACCCTC TATCTTAAACTAAATAACACTCAAACACTTCTTAAACTAAGCACATCAGA CATACATTTTCTCTCTTTTTTTAAACGTCTGATATTCAAAAATTAATTCG TCCAATTAGATTGCAATTTTAATGAGGTTTTTGATGAATACTGACTTATA TAATAACCTTGTTATAAGAACAAGTTTTTTGAACTCAACTATTTTTATTT TATTTTATTGGCAATTTGACAATTTTATCCTCAAATTGTTCTTATTATGT TCTAATTGTCAACGTATTGGATAAGTTTTTCGGGCTGGAAAAGTTATTGT TCTAGAGAAATGGAGAAATTATTCTGATACAAAAAAGGGGGCAATGTAAA TCGTTTCTTATAATAGTGAAACTGATATATGATCTGTTTCAAATGACTCG CATGCTTGTAAAATCGTCAAAAATAAAGACCAATTTAAGAACAATGCTGA GCTTGGAATTACTCATTCTCAAACAATTTAGTGGTCAGAGTATTAAAGAT TGGGTATGAATTCTTAGATACCTCAATTTCATCCCATAAATAAGAACAGA ATAAGAACAAAATGCAAGAAAAAATAGGAACAGCAAAAACCTCAGCAAAA ATCTACCGGTTCTTATAAAAAGAATAGTTTACTTCACTTTGTCAATGTCA ATGTTTTCTTTGCTAAGTATTTCTTTTTTTGTTGTGTAATCATTTTCGTA TTGACTAATTCACGTTTTTTTTATATGACAGCACTTTCGGTAGCCATGTT TTTTTTCCTTTATTTTTTTGTCAAGAAAATTCTTAGAATTTTCTTAACTT TTTCAATCTATTAATTTTTGCTTCATTGTCTCTAAAACACCACCACTTTC TAGACTGGAGTCGTTGTATAGGCGTTATATGATAATACGATTATTGTTAC GGGATTTAATTTGTATAAAATTGTTCCCTCCATTACTTTTTGCTTTATTT CTACTATGTCTGAATTAGTCGTCTAGCTTGCTAGGCTACCACTTTCTTAA GAAATTGCGCACAAAAAATACTTACAAAATGGTAAATTTAAGTAATAGTT ATCGCACGGTACCGAGTACAATATGCAATCATGGACAAAAGATTTGTAGA CTTCTGCAATATTTTCAGAAAACTTCAATAATCGATCAAAAACAAGTTCC CAAGAGGCTCTGGGTGCTTTCCAAACCCATATAAAGCCTTTGAAAGTCAC CCACTACAGTCTAACCACAAGGGCAAACCACAACGGCTTGATTAACTGGC TTACACCAGTATCAAAACGCTGATTGTTTGCTTGTGGTTCCCTCAAAAGC AATTCAAAAGCAATGCAACGACTTCGAAAGTGTTTTTCTTAACTTCCCTT CTTTTTCAGACACATTGAAGAGTCATTTTGCTCTATTTCTCATCATTTTT CACTGAAATTTCATTTGTCTACAAGCTTTTGTCCATGATTGTGGGGTGTA TTTTTTGAGTTCACATTTTTCGTTATATTTCAAAATAAGTTACGTTATAT GATATATAACGATTATTGCTACGAGATTTAGTTTGTGTACTAAAATTTTT TCCTCCATTACTTTTTGCTTTATTTCTACTATGTCTGAATTAGTCGTCTA GCTCTGCTAGACTAGGTAAACAATATGATGGAATACAGCATTTATGTGCA CGTTTTTAGTCAAGCTCAACGATAAAAATATTTTAAAAACACTTTTACAC ACAATGATTTTTCATTGTAATAATTTTGGATGTTAAAAATACCCATAAAA TGTAAAAAAGAGCCATAATCTGGATATCCAGACTGTAAATTTTTTTATTT TACTGATGTTTCTAGTTTACCGCCTGGTCTTCCTGAAGCGATTTGCATTC AAATATCAGAAGGCAGCGCACGCGTTTATTTGATATTTCGAAGGCGTATT GGCGGCCACTCAAAAGCTCTTCAGGAGCGGGCAAATTTCCCATCAGAGAG GAATGATACATGCTATTTTTCATATAAGAAGTTTCTTTTCAAAACAAATC AACAATTTTTCATTTTTGCATTTCTTTAACAGGTCTTGTGTTTAAACCAC AATCACATTGAGAGTATTTTCCCCAAGAAGTCTGGTACCAACAGTCCACA AGTCATATCAACCAATAAGAATGCTTCTTCAGATGATTCGACCAATCAAT TCAAAGCAGTCCTCGAGAATCTGGAAGTACTTCATTTAGGGTATGTTTCC ATTATCATTCTTTTTAAATTCGAATCACATAAAGAATATTCAAAACTTTT GAAGCATTCCGATGTTCTTAACTTTTTGAGTTTTAAGCCGTGAAGTGCTC TCGACATGTTCTTATTTTTACAAATTTGTGAGCGTTTTTATCAATTCTCC TTAGAAAGTAGGTGTTTTATGGTCCGCAAAGCCTTAAAATGTTCTTAGCT TGTTCTTAATAGTTTGTTCATCGACGCCTCATGTTCTTATATAGTTTGTT CTCATACAACGAAAACGTGCAATGAAATGAACGAATTGAAGTTCATTACA AACTGATAATATCCCGTAACGATTATCGTATTATCATATAATACCCTGTT ATTTTTTACCGCATTTTTTCTTTTCTCAGACTTTTTTTGAAAAAGGTTAA TTTCGAATTAAAAAGCGGTTTTGTGCTTGTTGGGTAGATAATCAGAAGTA AGCAATATTATCAAAAGGAGAAATTTTTTTTTAAATCGAGAAATGAAGAT GAAAAAATTAAAAAATTTTCTAATAAACTTCTTAAAGAACTGTGCTATGA TAATGACAATGATTATAGAGCAAAATTACTGTATAATGAAATCTTTCAAA AATATCTATTCAATTGTAATTTATGGACCGAATTTAGGGTCTTAACTAGA CAGGTTGTGTATAGTCATTACAATTTTGCCCCAAAGGCGACTCCGGAGGC TTCTTATTTGATAGCTACTGTATTGCTATTTACCCGAATGTAGGGAAGGG TACCACCCTTTTTTCCTGGATTGCTCCACCCACCCTTGATCACTCCTTTG ATTGCTGAGCGTCAAGTCGAGTACCATTTTTGTACTAAGTACTGTAAGGT GTATAACCCGACCAGGGATTGAACCCACGACTTTGCACTGTAGCTGAATG CTCTACACGTATTTTCTCATAAGAACATCCAAAATAATTGAAGCCTTCAT ATGTTCTCAACTTTTTGAGTTTTAAGCACAAAAATATTCTTAACATGTTC TTATTTTCATCATTTTTCGAGCATTTTTGCCCATTTTCCTAAGAAATTGG GTATTAGAGTCTACAAAGCCTTAAACTATTCTTAACTTTTGGCCATCGAA GCCTTATGTTCTTATATAGTTTGCTCTTATAAAAAAAGTGTACCTTTACA AGACAGTCACTAAAATACTATAATAGCAAAATGATATTTGACTACTTAAA TCAAAATGAATGTCATGTCATTTTTGACGTGTGTCACGTTCAAAGTGATA TGACAAAAAAAATGTTCATATAAGAATGCAAAACATTTATTGTAGCTTAG TAACTAAAGACGTAAATTCTCGTGATCCAAAGCACGATAAATGTTCAAAG TTTGGAGAGTTGATGTTTCACATAAAAGTGCTACCAAGAGGTATTTCGGG TCCCATATCTTCCGAAGGACTTTTCCGTTTGCTTTGAAATTTGACAACCT TCTTAACCTAAGGTTGAACTACAACTGGTGTAAAAATGAAGGTTATAACA TAAGTTGAAAATAAGCTTAATTTTTGTAATCGCAAATTTAACCGCTAAAA ATCGCGAATTTCTCAACCAAAAATACACTCAAATATAGCATTCTTGTTTC CACTGCCAATTATATATGGATAGACTTTAATCATGTTTTGACAGAATGGT ACAGTAGATTGTGTAATAAAGAAAGTTGACACTATTTTTCAACAAATAAG AAAAAAACCAATACCAATGGTCTGATATAATATTTACTAACAAATAAAGG ATTAAAACCTTCCCACTCTCTGTACACGCTTTTTTTATAAGAATGGTGTA AATCCATTTCATCATGGATATTCTTAACTTTTTTGGAAAATCATCCTTTA ATATTCTGACAGCATTCTTAGGTTAGGATCCTAATTCAGATTAGATTTAA CATTTAGTACATACGTTTCAAACATTAAATGACATTTTTGTGAAAGGAGT GAGCCTTTTGGGTAATTGATAATTTATAATTGAAAATGCTCTAAAAATTG CATTCTTGGCTTGAGTAGAAAAATTCCATGATGGTTATATTCTTGGCATT ATTCTTATTTTTTAGGCCATTTTCATTATGGACATTCTTATAAAGTGTAT TCTTATAAAAAGGCGGGAGTGAGGATATAGGTGGGGCGAGATGGAGTTTT TTACAAGCTCCTATTTGATTTGATTGGTCGTAAACCAGCAATAAAACAAT TTTTATTACTTCAAATGACCAAGTATCTTTCTTATAAAAACTCCATCTCA TCTGGATTAGGTTTGCAAGATTACCAACACGTTCGAATCAAAGCTCTACT TTTGTCGAACTTTTAAAAATAAAATGACCTTTTGAGGAATTTTAGTTACG AATTTAGTATTTTTGGAATCTCTTACAGAGATTGGATTACTTTTTCATGG GTTTTGAGTTTTTGTACTCCTTTAAGGGATTTTCTGAAAGTCGTGATAAA TGGACACATTTCGCCTCAACTCGCCCCGACGCCATTTTTCCGTAAATTTA CAACACAACATCCTCCAACTCCTCGGAATATTTCACATAAATCGTTCGGG ATGCTATAATATGATAGATATATTTTCGATGTTTCTCCGTGGAGAGTATG TTGAAAATTATTCTTAGGAGGATTCTTATAGGATCCATTTGAAACCCGAA TCTACCATTCTGACAGCTTTTTCTTCCCCACTTTCCGTTAAAAAATTGTG CAATAACACGAAAATAAAAAATATATAGTGTTTCCGGAATGCGGGTCAAG GAAAAAAGCTCTCATGCGGCCGGCCGGAAAAAAACCTTTTTTGCTATTTT TGATAACTTAAGATCATTGAAATAGAACTTTAAAGATAACTTTTATGTAC AAACAGTATGAAGTAAGCCCTGAATACTAATGTATCAACTACTAACGAAG TCTGCGGCCGGGTCACAAAATTGTTATTTTTCACCCGGCCGGTTTCTGGA AACACTACATTTTTTTTTTCGCCTAACACGAAAAATTTCGATCAATTTTT TGCTACGTTCCATTTTCCGAAATAAAAAAAGTCCAGTTTGGACGTCGAAG TTTTGTTTCTCCCACGGACGATAACGAGAACATTCTAGTCCTCTACTAGG TAGGGTTTTGCTCATCCTCTAACGATCAAGTTTACAATCATGGATTAAAT ATATTGAATATTTTGTATATTTTAACGTTTTTTCAGAATCATAAGTTTGG GCGAGAATTTCGATTTTAGCACTTTCCAATTTATTCCATTTGATTTTACG ATTTTTGAGGGGCTCCAGTGGCTTCAAGGCTATATTCCCAGCCTTATAGG AAGAATTTGGGGTGTTTGATTCCCGAGATACTAAGGTCTTAGTATATGTC TCATATTGAAACTTAGAGTTTAAGCTCTATATTCCAGAAGTAGCTTAGAG CACAAGTCTTTTGTGGTGTTTAAGATTTTGTAGGGAATTTCCCTNCCAGA AGTAGCTTAGAGCACACAAGTCATTTGTGGTGTTTAAGATTTTGCAGGGA ATTTCCCTTTTCTCAAATATTTTATCCATGATGGCAGGAAGTATATATCT ATAGAGGTCTGTGATTCAGACTAGCCCTCTACAGATATGAATTTTTAAAA TTATTAGAGCGACGTCATAATGTTCATTCGGTCTGGTGTGGACATGATAT TACTTACACGTTTTTTATAAGAGAAAACTATATAATAAGCAACAAAGTTC GAATATAAGCATCTTTCTGATCTTTTTATATAAATTCGAGAAAGAAACAA GATGTTGTGTAAACAGAATATAAGTTCAAGAATAAGTCCAAGAACATAAG AAACAAGAACACGTTAAGAACATTTCAAGACCTCGCAGACTCGAAAACGG CAATTTTTTTAAGAAAATGGACAAAAATGCTCACAAAATGGTGAAAATAA GAACATGCTAAGAACATTATTAGGCTTAAAGCTCAAAAGTTAAGAACATC CTGAGGCTTCAAAAAGTTTGGATGTTCTTATAAAAAACATGCATTCTCAA CGAGCATAAAATCGTTCTATAATTCGAATCCTATCAACAACAAAAAATAT AACCTTTTTTTGTCAACGCTTCCAATAATTCTGGAACAGACTTTATTTGT ACGTTTTTTTTTTCATTTAGATACAACGGTATTGCAAATCTAGCGGCGCT GGAGCTTGGTCGACTTGTATCATTGAAAGCACTTTTCTTACAAGGTGGGT TTAGTTTAAACGTGTAATTTTCAGAAGCAGCCAACTAGCCCATTTCCCCG AAATATCTGTTTCCCTTTTCCAGGAGAGAGCTTTTTTGAAAAATGAGGAA ACAGATCCGATTTTCTAGGAAAGAACTTTTCCTTACAGCTATCTGTATCC CCGCTCCAGCTGATGACGTCATCAGAGAGAAACAGAAAATTTCCAGGAGA GGGAAACGGATATCCTATTCCTTATAAACTTGGGAGAACAGATCAAAATT TTAATTCTGAAAATTGTGGAAACAGACCAATTTTCTAGGGAAGATACTTT GAGATTAAAAATTTAGGTTTTGAGGAGAAACAGATCTTTATTTCTTGGAA TAATTAAACTTTTGGCTAATAAATCAAATTTCCCAGGAAGGTTATGTCAG GGAAACAGATGTTTAAAAAACGGTCCTCGCTGGATGCTTTCGAATTTTTA AATGAGCCTGAAACAGTTCTCATTGTTTTTTTAACAATTTGCAACTTTCA TGCTTTTAAGCTTATTATCAAAATTAGTCAATGACTCTATGTTTTTAAGT AAAAAAATGGGTACATAGTCTCCACATAAAAAATATTCCTGTTTTTAAAA AAAACTTTTAAAACAAACCATTGACAAGCATTCTATTTACAAAGGTATTT TTTAATCAAATATTTGATGATTTGAAGGGCACTTATCGTAGTGACTTCAC AACGTTTAGAAATTTCCTTAATGTTTAGTTTCCATTAGGTCAGCTAAATG GGTATGTCGCAACATACATGAAAAGGTTTAAACACCGCAAAAAAAATTAA ATATTGCAAAATAAGAGGCGCCAACTTCTATCTTTTCGTCTCTATCGAGC GACTCTCTCTAATTCGATCTTAAAGGTTTTATTTTTACATATAAAGTGTT CCCGTTTCATATCAGACACATATTGGGCTATTCCAAAAAAAAAAATTATA CAGGGGTATTGACGAACTTTTTTTTCACTAACCTCCCTGGAAATTTTGAA TAACAAATTACCCCCTGGAAATTATGGGGAAGGCTCCTCTGGAAAGTGAA ATTTTGGGAAAAAGGGGCTGGAAAACAACTATTGATATCAGTTTATGAAG AGAGAACCCCCTGGAAACCTTCAATAACCNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTTTT TTTTTAAATAATAGTTTTTAACCTAGGGAAAAGTGGCCCCCCCCCCCCCC CCTGGAAAAGTTCGTCAATACCCCTGTATGGTTTAAAAATGGAATAGCCC TTCATATCAGGACGTGTCTGCCTATTGTTATATTATGCTGATAGAAGCAA AAAAATGTTTTTCTTTCCCTCTTTTTGACCAATCTTGCTCCACATCTGTA TCGATCCAATGTGAAAAAAGCTTGTGAATCAAAATTGATGAGTAAGCAAA CAAAATCACTCTTATTTTAAAAACAAAACCTTTACAGAGACCAGGCATAT GTAATAGCGGAGCTGGATAACGCACATTTGAAAAAGCCTTTTTCTAACTC TGTACCCTAACATTGAAATTTGATATAAAATTTAACTTTTTTAATTACAA ACTCGTGAAATTTGGATTTCCTTTTAGCCAATGGTTCTGCTGCTGCATTT ATCCTTCACGATTAAAAACTTATTATTATCAAGAGGGTCTGTAAAACATT GGCAAATGACAATTTAAAAAAATGAGAAACATTGTTTTCATTGTAAAGTT ATAAGAAATTTCTTCTGTAAGATTATGAATAGCACTTTTTCATTTGAAAT ACCGCGCTACACCGCGGGGTGCCTCACTTTCTAACTGATATTTTCAGATA GCGAGTCGGTATGTCTGGTTATGGAAAAAATCAATATATTTTTCAAAATA TTAACATCCGGAAAAGAGGAACCATGAAAGCTTCTCAAATTTATAACACA CGCTGATAGAATTAGATTTCATTTACAAGGAAGCTTTTGGGGTATCTTCT GCAAATAATATTTTGATGAAAAGCGGGAACATCATAGCAAAATATGTGCA GACGTACTGCATGACTAATTTGTCTGCTTCATTTTTCTTATAAAAACAAA ATACTGGCTCTATAAAATTTAATCGTCTATATCTTTAAAATCAAAGAGTG GTGCAAGCATGAATTTAGTGCAAGTTACTATGGGGACAAGATTTAAAATA AAGGTCTGTAAATCAGACTACAAAATATTTGATACAAAGTGAAGAATCCC AGCTGACACGCAACGTTGTTTCAACGTTCATATAACGTTATATGGACGTT GTGAATATTAGAAAAACGTTGAAACGACGTTGTGTGCCAGCTGGAATGAA GAGCTTTAAACTCTGAGTTTTAACATTAGACTTAAACCTTAAGATCTCAG GATTCAAAAGCTCATATGGATAAAGGCTGGGAATATAGCCTAAAATCCGC GTCCTCGAAAATCGAAATATTCAATGAAATAAAGTGGACTTTCTAAAGAT TGCTATTCTCTCCCGAACTCTAAATTTTGGAAAACGTTAAAATACACAAA AGTGTCAATTTCAACCAGGGTTGTAGTTAGTAAGATTGCAACCGTTAGTC GAGGGCGACCAGAAGGCCCTCATTTCTATAGCTGTCTACCTGAAGGCACG CAAGAGGGCGGCACTCTATTCCCTGGATTACTCCACTTACCCTTGACCCA ACTATTTAGTTGCTAAACTTCAAGCAGAAAGAGGCATTAAATACCATTTT GAAATCTTTTGATATGACCCCGACTGACCATGGAACCTACAATCTTGTGC ATACGGGCTGGATATTCTACCACCACGCAAACACCGCTGAATCGGCCGTG AATCAGACGTTACAACAGTAGAGTCTTCATAACTCGAGCCTCTATAATTC AAATGTTTCCTTAACTCGAACAAGTTTTATGGTCCCTTCGTCAGTTCAAA TGTTTCCTTAACTGGAACAAATTTGCGTTCCCACGCGTGTTCGAATTATG GAGACTCCATTCCCGAATAGTAGGGGGTCCGAAAAAAGGGGTCCGAAATT TTCCCCCCCCCCCCAAAAAAAAAAATAAATAAATAAAAAGTTAGTTATAT GCTACAAACAGGTTAATTTGAGCAATATTTTCAAAAATGAATAAACGTGG GGTCCTAATAAGAAGGGGGGGGGGCGAAAATTCTTCAAAAATTAAAAAAA CCGGGTGGGGACGTTTATTCGGGTCTTTAAAGTAATACTTTTAAACTTCA TTTTTCTTTATTCAGGGAATGAGATCAATAAAGTTGACGGATTGGATGGG TTGTACGAACTTCGTGAATTGGTCCTCGATAAAAATAAAATCAAGGTATC TAAATAACAAAATAAAACAAAACAATACACGTTTTTTTTATAAGAATGTC TTCTATAAGAATATCAGGGTGAAAATTGGCCAAATCGTAAGAATACCCTA AGAATACCCTCTAGGGTGAATTTCACAGAATTTGATAAGAATACAGACCT TTCGTATTTGGTTAACAGAAAAAACTGCTTCCTTTGATAGAGATAAATTG AAGCTTTGAGGAAGAAATGTAATTTTAATCCAAATGTTCACTCAAAAGTC CAAAACTCTCAAATTGATCATTACTCATGTTTGTAAAAAAGTCAAGTCTA AAAAAGTAAGAACATGTTAAGAATATTTCACTCTCAATTTTGACACTTTC CGAAGAATACTTGACCCTCATCCAAAGTACACTATTCTTACAAAAGAAAA CAATACTTATTTTACACTTGATTTAGTGAGGCTTGTTTTTCTGTTTGGAC ACCATTTGGGCACCAACTGTATGTAGTGTCATTGCAATGACTTCTTTAAG GGTACCACTTTCAAAAAAATCCAATCAAAAAATGGCAGATATAGCTTTGT CCAGGAATATATAAAAGTTTGAGTTTTTACAAACGTTCGAATTTCAAAAC ATACGAATCGAGTGCTGTTGGCGACTAGAATTTAAAAAAAAGATGGCTCT AAAACTGGACACGCTTACTTTTATATGGGAAGCCCGATCCAGTCAAGTAG TTCAAGATCAGTGGTTGACGTTTTCTACATGAATATTCTTAAGGGCTACT CAGACTATTATATTGACTAATACGGTATATTGACAAGCAATATTTGACAA TATAGTTTGTGGACCGTAATGCACGGAGTAAATAATAGGTGCTCTATTAT AAAAAGGAAATTTCTTTCTGTAAACAATCTCCCTATATATTGTTGAAATA TTGCAAATCGAGCTGACAATTTATTGCGTACACCTTTTCAATATATTGCC GGCACTCAGCAACATATCGTCAATATATTGCCTGACATACACTTATGTAG CCCTTTTCGAAGAAAAAGTCTTTTATTTAGTCATTTTTTTATTTAGGCTT TTACTGAGAATTCATTCCGAAATCAATGGAAACTGGCTGAATTGCATGTC GAAGAAAATAGGTAAAATATATTATTTTACACTGATTTCAAAATACTTGT ATCGACCTTTAAAGTCGTTGAGTTCAAAGCCCAGAAGGGGCTAGAGACGA ATCTTTAACCTTTCTCAAGCAAGAAAAAGTGAAGGCTTAAGATTTGCGCC GCAATTAGAATGACAGATAAAATTTAGCACTTTCTTTGTTTTCACGCAGC ATATTTTTCGAAATCCTGGCGATATGTTTTACTTTCAATCTAGCGTTTGA GTGAAAACCACGCGTTTAGGATGGGGAATACCTTATCGGGGAAAAGTGAC GAAATTTTGGCCAAGTGACGAATATTTTTCCCCGACGAAATTTTTCCCGA TAAGGTAAGTTGCTTCATTTCCCATCCAGGAGTCCCTTCAGACTTGAAAG TCAATGTTTAAATTGTGAGGAGCATTGGTTCGAGGAATGACGTTAGATTG GCGAAAGTCGTTTACACGCTTTTTTTATAAGAACAATTTCATAAGAATAA AGGGCTGAAAAGTGGCTGAAACCTAAGAACAAATATTAAGAACGATCTGA GCCTCAGATTTCAGAAATTACCTTTAAAAGTACTGATTTTAACAGGTTTC AACACCATTGGGGAATGGGACCTACTCCTTGCGAAGTAGGAATTCTTCCT TTTTTCAAGTTTGGACGATTAGCGCTGTCCAGACACCGCTGGTTTTGTGC ACGCGAAACACAGATGCTATGATGCATGATGCATACATAGTGATGACACT CAAACTACGCGTTTATAGCTTGTCGCAGGCGTGGAACAGGATGAGTGACA CCACACACTACAATGTCTGGAATATCATCCACACTCTTGTATCAGAGTAG TGGCACCCCATTCCCCTTCACATGGCATGGGATGACCCAGACGAAGGTGT GCCAAGTGAACCGTAGTGGGAATCGAACTCGGACCTCCCAGATGGAAGTC AAGAGCGAAGACCACCGTACCACAACGCCATTCTTATTTGTTTATGAGGA ATTCCTACTTCATAAGGAGTAGGACCCATTTCCCAGTGGGGAGGGCTCAT ATCATATTCTGTTATTATTTAGATTGCGAGATCTTTCGAATTTGGAACCG CTGACCTGTTTGAACCGTTTATATGTTGGTTTAAATCGTTTGCAGGTATG ATGTTTCCTTCAATGGCGTTCTCTTTCTAAATATGTTAGATAGATAGATA TAGTCGATATTTATGTGAATAGCCCAGTAATCTAGGACTCTTAGGCAGTC TTTCGATTGTTTTGACGGGATTCACGGCCAGCCGGCTCTGCTATCTATAA ACTGAACGGAACATTGGAAGGAGCGGGGATTCGATCCTAGTTTGAGATGC TGACGCCTCCCTGACGCCTTTGACCACTTGGCCATCGCTCCTGTTATTTT TTAACACCCCCTTTCTCACAGGCCCGATGGGACCCTTTCACACTGGAAGA GTTGGCCAAAATATCGTCCCCAGTTGAAAATTATACTCCAATTTTTTTCA CCGCCGAAAATAATCAAGCAAACAAATCGTCATTGCAAAATATTGTGTCA TTTTTTTCCATCGGAATTAAAATTTACAATCGAATGTTTTGATTATAAGA TAGAAAAGGTTCTATTTATTATAAACATAAAAAACATTCGAAAGAGTATC AGTAAAAGTTCCTTTGTTTGAGGAATGCTTTTTTATTCAATGTATTTTCA TTTTTTCAAAGCCTTTTTCTAATCTAGTCGCACTTGTTTTTACTACATCA ACATCGTCAGAACTTTCAACCAAACCAAAACCCCATCCTGGGGGATACTA GGGCAAAATAGGTTACGGGGATGCGCTGTTGGTCAGGGTACCTTTTTTAA CATTCACGAGTCCCAGGTAGGGTCGCAAAAACACCAAAATAGAAAAATCA GTCTCTCATAGTGTGCTTTTTTTGGAAAATTTGAGAACATTTTGGGATTT CAGTCCCATTCAGGGTCACTTTTTTCGCAAATTTCGGCTAAATTTTTGAA AAAAGGAGTCCCACGTAGGGTCCATTTTCGAACCTCAGCGGAGCACCCCC GTCGGTCGGCAAGGATAGTACCCAGGGGGGGGGGCACGCAGTTACTACAA GACAGTATGACACTTACTACTGTGGTGGTACTGTATTCAGAAGTTANNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNCACCCCCCCCCCCCCCCGGGCATATTAATACGGGTTATTG GCAAATCGGTAAGAGTCTCAACGTTTCCTGTCTTACGCGATTGTTCTCCT CTAATTTCAGTATGGCACAGATCTCGAGAAATTGGAATGTCTGCCGAATC TCTTCGAATTATCAGTCATTGGAAATCCGGTAAGTTTAAATTTTGAAGGA TTTTATTCTTGATATGTCAAGATAACGTCATACTTGTTCGAAAAAAGATT TTCGTGTTTTTGAAATATGCTCAAAGAGAGCGTTATTTTGGTATATTGGA ACATGGGGTAAAAATGAAGACTTTCAAAAGGTCGGTGGGATCCGGTCGGT GTACGGTGCAAAGGGTTAATGAATTCTGTCAAGTGGAATGCAGTAAAATT AGCAACAAATTGTCGAATCTCTCCCTCTCTCTAATTCGATTTTCAAGGGA CAAAGAATTCTCTTCGGATTAGAGAAAATTTACTCCATTCCAAATGGGGG ATTAATATCTTTAGTTCGAATTACAGATACTTTCAAATAATAGAGGTTCG AATTAGAGAGAGTTGTGTGTAGATTAAAGGAGCTTTGGGGTTAAGTCGTT TTTTTTGTTGTTGTATCGTGACTTTTTAACCAGGAGTTCTTTTGTGAATA TCTCTGAGAAAAATTTTTAAACGACCAGGAACTTTCTGACTTTTAACAAA ATCTTAATAAGAGTACTTGTGCAAAATTTTAGGGTCATAGGTTGTCCAGA TCAGGTTTTATGACTTTATTGTGAAACATGACATAAAACCCAGCTATAAT CGCTTGAAACTCAAAATTTAAAAGTGCTGATAACTTCTGAACTATTTATT CAATCATTTTCAAATTTTGACACGTGATAGGCATTGACAATATAAATTTG AAAAATTAAATAAAAAGTTTTGAAAATGATGACGTCATCATTTATGACGT CATCAAATTTTGAAAATGTTACTCATCTTCAGCATAGATTTTAAGGAAGA ATCTTTATGGAGATTCAAAAACCGGCAATTATGTTAAAGAACAGCCTTTT ATCTTTCAGAATCTTTAAACAGAATCTAAATATCTTTATTGGTTCGACTG TAATAGACATTTTTGTAAACCATATATTTGGGCTTTTTTCCGACAGGTGG TTTTTGAATGACGTCATCAATTCTTTTTTTCTTCCTGGAAATTTGTGTCG TGATGGAGAACATCTGTACCAAATTTCATGATCATAGCTCTTCTAGATCG AAAATAATCGAGGGTGGTAGATTCTACTCCCCCCTGGGGATACTAAAGTC AAAAAAGCTTGGGGCTAATAGGGTTAATCCATGAGCAATTTATACATTTT GCTAAAAGAACAAACTATATAGGGTTCGATTACCATAAAAAGTTAAGACA TTTTAAGAATGTAAAGTATATCGCGAAACAAGTTTTTTTTTATAAGAACA CTCAAATGAAGCCTCTGGATGTTCTTAACTCTCTCAGTTTCAAGCCTGAA AATGTTCTTGACATGTTCTTATTTTCACCGTTTTGTCAGTATTTTTGCCC ATTTTCCTATGAAATCGGGTGTGTGCAAAGCCTTAAAATGTTCTTAACTT GTTCTTGATATTTTGGCCATCGAAGCCTAATGTTCTTATATAGTTTGTTC TTATAAAAAAACGTGGAGTGAGTTTCATACGATTTCAACTCTGCAGCCCT TTCCCTAGATACAATACACTCTTTTTTATAAGAATGTACTCTGTTTCTCT AGTGTCAAAAAATGAACCTATTAATAAATATACAAGTAAGTAAGTAAGTT TGCGACCGCAGTCTAGGGCGACGCGAAGGCTCTCTTTTCGTATAGCTGTC TACCCGAAGATAGGGGAGGGCGCCACTCCTTTCCCTGGATTTCTCCACTT ACCCTTGATCCGTCTCTTTAATTGCTGAGCATCAAGCAGAGAGGCATCAA GTACCAATTTGGGAATCTTTGGTATGACCCGGCTGGGGATCGAACCCACA ACCTTGCGCACCGTAGCTGGATGCTCTACCTTCATGCTACGGTCGCTAAA TATACAATGGAGTCTCCATAACTCGAACACGCACGGAAACACAAGTTTTT ACGTTAACTGAAGGGACTGGTAAACTTGTTCGAGTTATAGAGACATTCCA ATTATAGAGGTTCGAGATAAAGAGACACCACTGCACAAAAATAACAATAT TCTTTCGAATGAAATTTTTATTTCTCATCTTTATGAAATTATTAATTGTC CCTGGCTGAAGCAAAATTATTCACCACTTTGCAAAGTACACTCATAGATT TATAAAGCCCGAACTGCTAGATATGGAGTGCTTTAAACTCTTCCAAACAA AAAAAGTGAATATCGCAAAAAATATTGCTGCTATTGTTTTCGAAAAACCG CGAAGCTTCTCATAGGCGTAGCGAGATACCCTGCAAAATTTATGGATGAG AGCGGTTTTTACGACACTGTAATTATTGTCTTTGTTTTATCAAAAGATAT GAATATGTCATAAACGTCTGCACTCCCTCGTAAATTTCTCGCTAAGCCTA TGCTTGGTCAAGTGCTGAAATTCTATTGTAATGTCACGTGACTTAAGTAG GATTTCCACCTAACCTCGGCACACTTTTCAGCAAAAGCACGATATCTAAC CGTTCGGGCTTTTACAAATCTATGAGTAGACCACAGCTATGTACCGGCAA TTTGATCAATCAAGACCATTCTTTCTTCTCCTCGTTTCCCGCCATATCAG TTGTTTATTAATATCGGACAAATTGCCGGTACCGAACTGTAGTCTACTTA AGTAGCAAAGATTTGTTCTGCTTCAACTGCCTTGGTTAAAGAAAGGGTAG GGTAGCTCTAAGTTTGGCGAATTTGGCGAGTTTAGACAAAATTCGCCAAA ATTATTAAATATCTTACTCACTCCCCAAAATAAGCTCTCACCAAAAATTA ATTTTAATAGCATTTTATTTGCCAAAAATAACCCCTATAATCCATCAAAA TTGGTCAAAATAAGGAAAAATAGGATAGCCTTTCATTCGCCAAAATATGT TCTCGACAATATTAAAGATTGCTCAAGATTTTTTCTGCTCGCCAAAATTA GTTCTCGTCCCTGTTTTTTATTTAATGTTTAAGTTGTGGTTTTACCCTTT CTCGTGGGAAGTACAGAAATGAGGGTAATTTGGTTTTACGTATATCCGTA GTCATTGTAAAAACACTGGTCTGGAAGGCTTGTGTCTCTGTTTATTGTTA AAAGATGGAGCTTACGTACCAAAATTGATTCATTTTGCAAACTTTTTGAT CATGTGATTAGAAAATAAACCAATCCCAAGAGGATATTTTGGTAATGTGA TCAAAAAGTATACAAATCGCAACTTGTCTTTTGTTTAAGTATAAAATAAA ATTGAACAAAAAGCTAAAACCATACATTGGGCTTTTCCAGAAATTTTTTT CACCTCAACAGTGGGGTTGAGGATATTGATTTTTCGAAGTATCGAAGCCC CTGGATATTCTACTTTATTAGTAAAGACCCTCTGGATATCCATTCTTAAA AATATGCTCAACCCCCTGGATATCCTCTCTTATAAAGATGCTTACCCCTG AATATCGTATTTTTTACTTGAAAAGACACTTTACCTCCTGGATATCCGCT CCCTTGTAGATATTTAACCCCCTGGATATCCACTTTGGAACAGAAATCTT TAACCCCCTGGCTATCTGATATCCTCAACAGGGGGCACGGACTATTTCTG GAAAAGCCCATTGCCAGACCGGGGTTTTTTATAATGACTATGGTATATCC TTCTGTGAGTCTTCCATTCTGTTTATCTACTCATGAACTGACAGTACTCC TCTGAAACTTTGTGCAATCCAATCAACTTCTTCGACCGAATGAAATCTAC TTCTTTGCGGAGCTTGACCTGTATGGCGGCCTCCAATTCTGCCACGTGTG TTTTCATATGATCAGATGGAGTTTTGTTTTTGGCGTTACGGGCGTTTGCA TCGGCGCCCTCGCGTCTTAATAGCAAACACATCATTGGGTGGCCTCCAAG GGCGGCAAAATGTAACGCTGTGTCTCTGTTTACATTTCTTGTTTTGACGT TGGCATGGTGTTTGATTAGAAGCGAGGCGATTTCAAAATGCCCACCCCAA CATGCAAACATGAGCGGGGTGTAGCCATGTTTAGATTGGTGGTTGACGTT AGCGCCGCTTTTGATTAAGAGGACGGTAGTTTGGAAATGACCGTGGTGAC ATGCGTAGATAAGAGGTGTGTTCCGTTCTTCGTCTAAAGCATCAACCTGG GGGGAGAACGAGAAAAAAAACAAAATTGCAGACTTTGAACTATAGTTTTC GTTTGGAATAGGACGGCTTAAAATCTTTAGTAACTTAGTTTTGAAGATCC CTGTAAACTATATTATCTCTACGGTGCCAAAAACTTTTCAAATTTTTGTT TTCTAAATTAATAAAAGAAAGTCAAATGAATCAATGGAGGTTCTCTATGT GGGAAAAGGAGGACCAAGTTTTTTCTGTTTAGGTTCTTACCATTAAATAC CTCACGAACAATAGTTGCCTCCATTGATCCACTGATCATTCTTTATTGAA TACCTTATCGGCCCTTTTTACACCGGCTCTCATTGGCGTTATTTTTAGGC TCGTGGCGTAATAAAGGCCGGCGTTAAAAGGGCTGGCGTAAAAAGGGCCA AGATTTTTCAATTTTAACCTAAAAGCGGTGTTAATTTTTTATCATTATTT CTCAATTTAAAGGATTTTAGGTATGATTCGAAGACGAAAATTATCCATTG TTTTACTCCATATTTAAAACTTCNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNTTTTTTTTTTTTTTAATAGTAATTAAATATTAAATTAAA ACGTTACAATATATAAATTGCTTAAAATACGTAGAGCTAGGAAATTCAAA GTTAAATAAATTTTTACAAATTTTGGCGTTATTAACGGGCCTATAAATTG ACGTAAGCTCGAAATTAGACTGTGACGTAATAAGGGCCGGCGTAAAAGGG GCCAGCGTTATATATTCAAAAGTCGTAAGTTGTTTAGGCTGCTGGCATCC ACTAACGGAGGATTCGTGCTCCTTATAGAGGATGCTTAATAAGNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAT TTGGATTTTGAAAAAAAAGTAGGCGGAAGGAAGTTTGCTTGTTTTTCTTC CTCCTTTCTTGTTTAATGTGGAGATTTTGTAAAAGATGAAAAATTAGATT TATTGAATTTAACTGCCTTGATGTATCTTCTGTGTGCACCAACAAAATTT TGCTTCATAAAACTACATTTTGATGCTTTAATTTGGACTTGCATGAGTGT ATAATTTTTTACCACACTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNGCTCCAGATAATTGTTTTGTCAGTTCTAC AGATATGTTGCAGATTATTTCAAGGTATTCTAGTTATGTATATACAGTAC ATTTTGGGGGTCGTATTGAATATTTCTGACGTTACTTCTTTATGATGCTA CAAAAGGGAATGTAGCCTAAAGGGAGTGTTGTTGTTCCTTCAACAAGGGC CTTTAAATGTTAAAACAAACAAAGAACTTTTCTTCAGCTTTGGCATTTCA CTTTTTAATACTGTGTGGCCTTTGTATCTTTTCAGGTACTTAGCTCCAAT TTTTTGAAGAGATTGGAGTGTTTCTGGTTGTTTTCTTTCACTTTTGTGTG CATATTTGTATTTTTTGAGCTTCGACCGAAGAGCTGATGGAAAAGTTTTG ATAAATTTACAGACCAGATATCTTATAAAAGCAAAAGTCAAAAATAAATC TACAGACTGTACATAATGCGCGCATCAGATTGTTTTTTATCTTTTTTCTG TTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCGCCAAGAT TTCCTTTGCGAACCGGAAAGCGGTTGGTAGATCATTAAGCAGACCTATAC TACCTGTGGTTTTGTAGAGGTCTGCGATTCAGACTATAAGTTGTTATGCA CGTTTTTTAATAAGAACGAGCAAATTCTGGTTTGATTTTTTTTTAGAATA TTTGAACCTTCTGATTGCAAATCTGTGTTACAGTGATGTAACTTTTTTCT TATAAAAGTATAAAAAGACTGAACACACTTATTTGAAATCAGCAAGGTTT AAATTTTCTAAATACGATAAAATAGCTTGATGTCATGATTTTTGAACCAG TAGAAAAAATCTTCATTTTTCTTCTTCATGTTTCAATTTTTACTCTTTAG ATTGTTCTCCTTGGAAATATCTTTCCAACGGTGTATAACTTTTAAACATA GCATGAATGGGTGCTAAGAAAATACTCAAAATTTAAAACGTCCACATACT TTTAAGAAAGACGTGAGCGAAAGACCTGTAAATGGTGTTTTCTTTGTCTT AAAAAAAGTTTTTCTACCATACCCACTGATCTTGAACTACTTGACTGGGT CGGGATACCCATATATAAGTAAGCGTGTCCAGTTTTAGAGCCTTTTTTTT AATTCTGGTCGCCAACAGCAGTTTAGAAATTCGAATAGTTCGTAAAACAA AAAACAACACGATGGAATAGATAGTCGACTTCAAAACTGGACACACTTCC ACGGGAAATCTATGAGCAGTTACCCCATCTAGTGTGTAAAAGAATATATC TGTTTGCTACGGTGGTTTAATTCTGCCTCAACAACGTCAAGATATTTGCC ACCCAGTTATTTGCTTAAATAAGATAAGATTAACTCTACATTTAATTGGA GAAATATATGGTCTAAATTTCTGCTTGTAACATGTTTGAATCTTTCATTC AGATTTTAAGTGAATAGAAAAAGTTCGACCCTCTAACTCGACATCTATGT GGGACTTTTTTTTCTTGACATTTTTGCAATTTTTTTTGTCAGATTTTTAT TTTTTTTGCAAACATGTTATCGATCAAATTTATCTTGGGGTTTGCGTGGC AGAAATGGGCTATTCCAGAAAAAATTTGTACCCCCTATGTTGAGGAGGTT TTTTTCAGGAAAGGTGACACCCTGGATTTTTACACTCAAAAAACCGGACC ACCCTGGACTTTTTACACTCAACACTCAAAAAACCGGACCACCCTGGATT TTTTACACTCAAAAAAACAGACCACCCTGGATTTTTTACACTCAAAAAAC CAGACCACCCTGGATTTTCAAAAAACCAGACCACCCTGGATTTTTTACAC TCAAAAAACCAGACCACCCTGGATTTTCAAAAAACCAGACCACCCTGGAT TTCTGCACTCAAAAAACCAGACCACCCTGGATTTTTACACTCAAAAAACC GGACCACCCTGGATTTTTACACTCAAAAAACCAGACCACCCTGGATTTTT GCACTCAAAAAAACCGGACCAGTTTGCATACCTGAAATCCATTTTGTAAC ATGCGTTTGACTTGATTAAATTTCCCATCACCTGCCATTTGATGGATGTC TTTTGAATGTAATTTGGACGTTGTGGATGTAGGAAGAATGTAAGGCTGAG AAGTATTTCGTACTTTCTCCTCGTTCGTTGAAACCTGTGCCAAAGAAAAA AATCATGGAATTGGGTTGTTTTTTTAAAGAAATTTTAATGTGAGATGTGT TGTTGAGGTTATCTGATGTTCCTATGGTCCTATTTCTTAGGAGAATGGGA CAAAAATATTCCCAAAATGGGGAAAATTATAAAAGAAACGTGTAACATAC AGGCCCGTAGCAACCGGGGGGGGGGGGGCAAAAAAAATTTGCCCAAACCC CCCCCCCCCAAAAAAAAAGTTGAAAGCTTAGAAAAATCTTGTATTAATGG CTTCATTTTGAACATAATCCTTTAACTAGATGCGTTTTCCAGCGATCAAG ACACCCTAAATTGCGAAGTTTTTCCCTCGGGCCAAATCGGTTGGCCCTCG GTTTATATTTCTCACTTTGCCCCCTCAAAAAGAAAATGCTTCCTACGGGC CTAAACATGGACGTACCACGCTCAGCCTTATAGGTATGTGGCATGGGGTT ATCTAAATCTGGTCAAAACCTTATTCAATATTCATCCCAAATCTGAATTC AAAGCGCTCTGCTAACCTGGGCAGATTCTCTTACAGACCATGACCTTTAC GTGTCATACGTGGAGTAATTAGGACCTGCTTGAAGATCATAAGACGTCGA ATTAAGTGTAACCAATGAAGTACTACTTTCTTTAAGAATCCGATCAAAGA TGGTGGTTTCAATGTGGGTCAGTTTTTTTACCTCAGCTTCAACAGTGGTG CATTTCTTAGACAATTCTTTGTAGACTTTTTGGTTTCAATGTGGGTCAGT TTTCTTACCTCAGCTTCAACAGTGGTACATTTTTTCGACAATTCTTTGTA GACTTTTTCTTGTTTTCCTTTCAATAATTTCTTGACTGGTTCTTCTTTGA CTTTCTCTTTCTTCTTTTCAATGAAATCAAAATCATCAGGTTTCATGGAA GGTGTAAACATACTCATAAAACGGAATTTGATACGCGTTTTGATTCGTTG TGCCATGGTGTTTTATTCTTTTGTAATCCTCTTTTTTTTATAAGAACAAA CTATATAAGAACATAAAGCTTTGATAGCCACAATATTAAGAACAACAATC TTTGACAGAATATAATGTCAAAAGCCTTACTCTGACCATAGTGAATTTTT CATAATTGCCGTGTTTAAAATGTGTTTTCTGACTGATGTTACCAACAAAA CTATGGCATGTTATACATTTTCTGTTAGACAAACTATTCCTGAATCTGAA AATTCAAAAATTACATTGAAAAAATTTAATGATGAAGAAAATGAAGACTT TTGCGAGGAAGAGTATTTCAACTTTGAAGAGCTTAGTTTCGGCGAAGAAA AAACATTTTGAAAAAATTTTCGCAGTAGATGGTGTATCTTTTACCGAACA ATAAAAATGTTTGCGGAAAATTTTTATAAATGCTTCTTTGTCTCGAAATC TTCAAAATAGTGGTTTTTCTTCAATTTTCATCTGGATTTTGCTTAAAAAA CAGACATAACTTTTGACACATCTTTTTAGAAAAATTTTCCGCAAAATTTA AAATAGTTTAATTCTTTGCGGACAGTGTAAAGAAATTTTGAAACAAAAAA ATTTATTACCCATTAAAACTAAGCACTTTTTGTAAAAGAGGGCGATGCAA CATATTATTAACATCTTTTTAAAGTTCATAACGTCATTTTTGCAATTAGA GATTCTTAATTACTCTTAAGGGATTTGATTAAAAAGCAATTTATAAAGGC AAAAGTGTTAAGGAACCTGAAATATAACTTTTATGTTCAAATACCAAAAT CAATTTTTGGACTATGGTCAGAGCCCTTAAAAGAGTGTATTTTACCCCTC CCCAATATCAATATTGAATTGGAGGCCTTCTTGGCCCTGGTCAACATTGA TACTTGGGGGAGGGGTTTCCTAGGGTCAAAAACTGTGAAAAAAACAATTT GTGACAAATATTTTGTCTAAGATTGTAGTTGAGAACATTTTAAAGCTTCA TGGGCTCTAAAACACCCGTTATGTTAAAAAATTATACAAAAATACTAACA AATATGATGAAATTGGGAACAGTTTAATATTTTCGAGCTTGACACTCAAA AAGTTAAGATCAAATTTTGGATGTTCTTTTACTTTAATGAGATAAGAATT CGCAGGGGTTAAATTTAACAGAATTCGAGGATTTGGGTGTCATCCGCGAA GAGTCCTAATGGAATTTGGAAAGGCCTTTTCCGCAAAAATTTTTAAACAA ACCTCAAAAAACGTCAAATAACTACTTTTTGAATGTTTACTGGCATCAAA AGAAGCGCTAATAATGCGTATTTTAACAACCAACATGCATGATTTGGCAG TAAAACGCACACAATTGTAAAAAAATCGTCTCACAATAGTTCCATTCGCG AAATTAAGTCCTCACGAAATCTTGAAATTATGTGGATGAGCTCAACCGCG AAATTTAATCCCCGCGAAAATTTATCCCATTTAAGTAACAAAACCGTGTA TTTTTATATGAAAGTTGCAACCTACGACGTTCAACACAAATGACATAAGT TTACCCGTTGAAGGACTTTCTTCGACCTTTAATTTTCAACCTTTCAAGCT AAGGAAAAGCAAAAACTTTTGCACCGCTTATAGAATTCTGGATTGAAGCT AGTGACTTCCTTGTTTTCCTGCAGCAGTTTCCCATTTAAGAGTTTCAACA TCAAATTCAATGATTCTGCCAGTATTCTTATATTGGACTGTCTGTCTCTG TGACGTTTTATTTATCGTGCCCTCCAGATGACTGTAGAATTAAGTTTCAG CCCAAAAAATCATCATTAAATTTCTTTTCTTTGAAAATATTTGAATATTT CTTACTAATAATCATTCTATTTCTCTCTCTGGACCCTCGATATGAAGTTT TTTCTAGGAATAATAATAATCTAAATTCGAAATTATTTTATATAACGTTA GATGAACGCTGAAACAACGTTGTGTATCAGCTGGGTAAAGTTCCACGAAA ACAGAATCTTTATGCTAATTTCGTGATATTCATGACCTAATATTTTATAG GGAAATACCCTAAAATCCGAATGCCTGGTCACAAGCTTTGAATTTAAACA ACAAAACTATTGGTAATCACCCGGGGTATTAGTTGGCAAACGCCCGGGAT ATTTTAGGTGCTTACGTATAAAACACCGTGATCTTTTTTATTAAAATAAC GATGATGAAAGTTTTAAACCAATCAAAATTCTTTCTCTCGAGTTCATTCA AACCGTCATTTTTCTTGTGGAAAGTTTACCAATAAATGATATTTCATGCC GATCACGTTTTTTATAAAAACAAACTATACAAGAACAATGTATTGACTGT AAAGTGTCGAATAAGAATTGGAATGAATTGAAGATGAGAAAAAAACTGTT TTTGCAGAATAAGCAAACAGACTCATGAATAGATCTACTGGCTTTAAACG TTTCCGTAACTTGCTTTCCATTTTCTGTATGAAAAATAACAGAATAGAAA CATTCAACCAAATGGAAAACTTCGACATCAGAAAATCACCGCAAAACAAT TTCCATCGTGTGTTTCGTCAAAATGGATTGTCATTTTGCGTTTGTCTTCC TCTTTTCTTGCTCAAAAACTTGTATTTTTCTTTTCCTTGTACCCCCTGAT TTTATCTAAATCCTCCCTCTTTTCTACGATGATAATGCTTTTTCCCAGGG GGTCGTGTGCGGGTGTTAAATTTTTAACAGTTAGGTATTAACCTTCGATG TCATTTAATGCTCCTAAAATTCAATTTCAACTTGTTTTTATTTTCACCTT TTTACAAAATCTAACCTTTACCTTTAAACAGAACTTTTTGATTGACTTTT TGGGTGAACTCATATGATGAAAAATCTGCAGGCCCGGTGGAAAAACCTTA ATAGTGGGGAGGCTAAAGACTCAAGGCTCAAAATGACATACAATTCGCTA GGATTTGAGAAAAAAATCTTATTTGCCCAAAAGTCCCCCCCCCCCCCGCT TCCGCCGGGCCTGATCTGTGATCTATTGAAAGATTGTATCTTTTCAGCGT GATTTTAACCAAACATTGCCGAAGACATTTTTTAATTACCTAATTGGTAC CAAAGTTTCTGAGTCATGACCGTTTTAAAGAATGTAGTTTATATCGTTTG TAATTTATAACAAACAGTAACTGCAGAGTTTAAACCCCTTAGAAATCGGA TTAGAATGTATGATTCAAAATGTACGTCAGCCATTTATATTTATTTTGAT AGCGCTTTTAAAAAGGTCGAATTTTGACAACGCTCGTTTATGACTTTTAA CCTCGTAATTTTTTGTCTTGACCAATTCGATCCAATTATAAGTGTGCGAA ATTCTTTGGAGATTCTCTGATCATTTTGATCAATTTACGCAGGGCGGGGT TCATGGTACCCGACAAGCCCTTTGAATTGAAAGAGGTCAAAATTTCTCGA GCTGTACTTTATATTTTTTCATGAAATTTTGCACACTGATGCAAAATGGC AATACCTAAAATGTGACGGAGCCTGATATTTGAAAAAAAATATTTCGGCC AAAAATGCCGATAATATGCCGTCAAAACCGGTTTGTTGCCAATTTGTCGA GATTTCATTAATCGTTTTTCCCGATTTTTTCACAAAGATGTGTATCAGCA TTGCCCAAAATGTAGTCGATTCGGATTTTTGAGAATCATGTTTTTCCGGC CGAAAATGCCGGGTATTCATCAGGTAGGTCCATTCAGCATGTTGCTTGTT TTTACTTTCCTTGTTTTTTTCAAAAGTAGAGAAAGACCTTCTAAGACCCT ATTTTTTTAATTACGAGACTTTCATCAAACGTTTCCAGACCATCTTAAAA GAACGACAAATAACTAATAAAAAGCGACAAAAAGAGGTAAACTATATATT CAGTAAAATCAAGAAAGCTAACTCTANNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAAAGA ATGGGAGAAAAAACTTTATAAAATGTAAAATCATAAGTTCTGTTTCATAG AGGTCAATAGACCTGCGAAATATATTGCTATAAAATAAAAAAAATAAACC CTAACCCTAACTATCACCAGGAGGATATTTTTCGTAAATGGCCGAACAAT CCTGTGCTGGTTGAAAACTTAGAAACAGATCATGTGAAAGTACCTATTGC CTCATATTGAGTTACTACTTCTATCCATCTTGACTCCTATTGAGCTATGT TCTTCCATCAGCTATTTTTAGATCATTAGTTTTTTTTATTTTGATGGATC TCGATTTTATTATATTCCTTCCATCATTTCTTGACAAACCTGATAGCCTT TTTGTGGATATTCATTCTCTGGCTATTTGTTTTGATTTGTCTTGTATGTC CTTTTGTTTTGTGGGTTTTGTTTCCATTTTGAATAGTTTCATAGTTCATA GGTTTCATACTTCTAGACTACCGTTTATCTAGCAATTCGATTTGGCCAGC CAGGGTGTAGTATGCAGTGTGCATGGGCCCCGGCGAGCCATTTTGAGTAG GGGCCAATATTTTGGAAACAAACGTCGCGCACCATTGTTGGGCGACGAAG AAAATCTGTCAGTTTTTACACCCTCAAAACACCTTAAAACGTTATCTAAT TGGGGAGAATAATAGTTTTTATGGCTTAAAATAGTAACTTTTAAGAAAGT ATGACATGGTCTGCAAAAAAGTGAAGTGGGCTACGGGGCCCATAGTGTGC TGATGAGTCCCAATAAGGACAAGATGCATGCACCTGCTCTGCTATCCAAA TCTCCTGAAAGAAGATAGTTAGACAGCCTTTTTATGAATTTCTTTAAATA CATATATAGTGAAGATATGTAATATCTGTCATTTTAGAAAAAGAAAAGTA TTGATATATAAATAACTCAAACTGATAAAAACGAAAAAAGTGAAGAATAT TTTTGTTAATTATGTATATATAATCGATTGGCTTTGAATTTTCAGATTGC TCGTCGGATGAGTCACCGCATGATGCTAATCTTCCGGCAACCGAACTTAT TGAGTATTGATGGTATCCCAGTCTCCAATGAAGAACGCTCCAAAGCGGAA ATCCACTTCTTAGAACAACAGGTAATACGGATAACTTTTTGCTTTTGTTC TATAAATTGCTCCAGTCTGGTTTTGATAATGGATGACGAAAAATTAGGAA AATGTATAATTTTACCATATAAAAAGACAATTGGCAAGAGTCCTCAAATT TGACTAGTTTATAAAATGATTTATATCAAAGCTGGTTGACGTTTAAAAGT CTGAAGACCCCGGGGGAGGCACTTAGGTAAAATTAGGGACGGGGGCGGGC TGCTTGTCAGTGTCCCTTTCTTCGGCTCTGAAGATACCTGACAGGTTCCC AAATTTAGTAAATTTTCAAAAAGTGTATTTGACAGGGTCGACTATTATTC ATTTTGGTCAGTTTTTTGGGTGGAAATTAGATTTTTTTGACACTTTTTCC ACTTTTGCCACTTTTCAGGGTAATAATTAAAAATTTTTCCCATTTCATTC GGACAGGGTCCCAAATTCAACAAATTTACCATACACTCACTCTGCAGTGC CCCCTCCCCCCCGGGCTGAATACCTATGTGTAAAAGTATCCCAATATGTT CATCTGTAGGCTGTGGATTGAGTCCAGTAAATTGTGACTGGGGAGCGAAC ATTTTGGGGGGCGTGTATGTGTATGTGACATCCCGGGATTTGATTGCATA GCTTCAAAGACGAAACTAAAACTCCTTTCTTTCAACAAAAAAAAGTAAAT TTAATAGTACAGTCAATTCTCATTAATTTGAACCACTATTATTCAAATCT CTCAGTAAATCGAACTAAATCATTGGCCACCTTAGCTGGAAAGTTGTGTA CAATTTTTTAATTTGAAGGAAAGTCTCAGTCCTTTGAAGATCGAATTAGA GAGAGGCAACTGTAATATTTCGTTATCTCCTGTTCTTGTTCTGTTCATAG TTGCCCTTTGTGGAAACAATTCTCCTGTTGTCTTAAAGCTCTTATAATTT CATCCCCCCTATGTTTAGGGGGGTCTTCAAACTCCCAGACAACCCTGTAA GCCCCCCCCCCCTTTTTTTCGAAAAAGTGTTCGTTATACATAGGGGTTTC AAACTTTTTAACCAAATAAGTTTATTATATTTATGTGTTTTTTTTTTGTT TTCTTCTTTTGTTTCTACAATCGGCGCCGAAATATTTGGTACAAAAGTGG AATTCCCTCAAAAATTTAAAACCGCAAGTGATTTTTAAGTGCTTTGAAGT ACAGTTTGGAAGTAGAGTTTTAACATTAGACTTAACACCTTAGAATCTCA GGATTTAAAAGTTCAAAAATGTTCCAATATGGCTGAGAAGCCACTTAACC CTTCCCAAATCGAAATATTCAATGAAACAAAGTGCTGAAATTGCAATTCT CGCCCGAGCTTTAAATTCAAAAAAACGTTAAAATACCCAAATTTGCTAAT ATATTTCGGCACTGATTGCAGCGATTTGTTCTTGAGAAATTCATATATAG GGGGTTTGGCCTTTAGGGGGGGGGGGTGAATCACCCAAAAAACTATGGCT CTAGAATTTTCCGAACCGAGCCCCTTAAAACTTTTGATAGTATTATTGAT ATTCGTTAGTCAAGATTACGTCATTTTTCATATCGGAAACACCCAGAAAA AAATTGGAATGTGTTGCTATTTTTAGCAACACTCATGGGTCAAATTCCGG TGTTTTCGTAAAATGGCGTAATCTTTACTTTGAAAAGAATATCAAGAGTT ATTAAGATTATATTTTATACACACAGCATATACATTATATAACACTTTTC TTGTAAAAAGAACCAATATTTTTGGAGATCAAGAAATAATAATGTTAAAA AAAATAATAATAATGATAGATAATACTACCAAGGGGGGGTCGGTACTAAA ATCCAAGACATATATGAGTACTACAAGGTTTTTTGACGATTTTTGACAAA CCCCCACCTAATTTTTGAAAAAGGAATTTTAGTACACATGTACTAAATTT TATTTTGACATTTTAGCATAGTGACCACCTAAATAAGGCTCATTTTGGAA TTCAGTTCGAAGAATGCGGGTCTTTGGACTTTCAACAAAATGCCAACTCT GGTTATTTAAGCTGTCAATGAACCTGATCTATCTCTCTCTATTCTAAATA AAGACTCAGAAACAGTCAAGACACTTTTGCTCTGATTCTCTACTTATTGC AAAGATTGATTGGTCACCTCTAATTTACAGCTTGCTATTTCTTTTCTATC CAGTTATCCACGGTTCTTTACAAAAAAGAAAGCATTCAACTTCGAAAACA TTTTTTATTCCATATTATATAAAAGCAGAACAATTTTTTAAATTGAAACA TTGGTGTTTCACAGCCACAGAGGCAGCCAGAGAAACCTTTTTCCTCAGTT GAGATAAAATTTCCTATTGAAATGCTAATGGGGATAGAAATTCTATTGTT CCAAGGTTAAAAACCCAGTGGGGATATGGTTTTGGAGTGCAATTTTTACA CATGGAATTTTCAGTGGGGATGAAATCAAAGTTAATTTCCCAGTGGGGCT GAAATTCAAGGGTATTTTACCACCGGGGACAAAATCTTTGCTTAATTTGT GACACAGGGACATTTAAATCTTATATAGAGAGTTTTTATTTTTTCATTTT GCCTAAAATGCTCAGTCAAAAGTTATTAAATTTCCTAAAATTTGGTGGTT TTTAGTACTCATGTACTAAAATTTTTCTTAAATTTCTTGAAGACCCCACC TAATTTGGGATTTTAGTACACATGGTACTAAAATGCTTTTAGGCTTTTTT TGTAATACCACCACGTCACTAAAAGTCATGATGTCTGAAATTTTAGTACC GACACCCCCTGTACTACCTTATATTTGGATAAATGAATTCCTTTCTTTTC ATAGGGTGGCATTCAAGCGTTGCAAGCTTTATCGAACAGTTATGATAACT CGTTCCCAGGCCTTCAATCCAACAATCGAAACCCTTTGAAGGTTTGTATT TGTCGAATTAATAACACGCAATTTATTCTTTGTTATTATTCGTAATTTAT TATTATTTAAAATGTAATGTTTTCTTCTGAGAACCCCCAGCCGGGTCATA CAAAAGATTCCAAAATGATACTTGATGCCTCTCTGCTTGATGCTCAGCAA TTAAGAGAAGGATCAAGGGTAGGTGGAGAACGAGTGGTGCCCTCCCCTAT CTTTGGGTGAATAACTATCGAAAGAGGAGCCGAGCTTCTAACTCCTTCTA GATCTAGATATAAATAAACCTTTGAACTAGCGATTGTCTTAAAAAAAGGA CCGTGGCACTGAAAGGGTTAACCAGGCATTCTCCCATCCCCCCTTACTAA AATACTGGGTGAGTATTCAAGCCTGAGCAATTTATCAATATTGAAGTTAG GGGGAAGGGGGGAGCTTGTTTTGCAGTCGTACTAAATCGAAACTACCTCA AGGGAATACATTTTCGCGGAATTTAATTTCGTGGTTGAGAGAATTTTTTT CTTTACCATATGTCCTATTTTTCCCTAAAAAGTTAAATCCTGAAAATTTT CGGGGATTTTTCAGAAAACCGGGGAATTAAATTCCGCGAAAACTTTTTCC CTTAAGGTATCAAAATATTGCACGGTATTGTAACAACATTCCAAATCTTG TACCACCTGCCCTTCATTCCACAAGCCTAGTACCCAGGGTGTTTGAGCCA TTCACTTTGGTTTCGAATATTTAACCATCAGATCCATCATTGCAATGTAT AAGTTGAACGAGTAGAAAGAATGAGAAAATCTTTCCTTCTCAAGAGGAAT CTAATTCATAGTGTACCTACATGTTTTTTATAAGAACAAACTATATAAAA ACATCAAGCTTCGATGGCCCAAAATATTAAGAACAAGTTTATATTAAGAA AAAGTCCATTTTAAGGCTTTGTGGACTCTAAAACACTCAATTTCTAAGGA AATTGCATAAAAACACTCACAAAATTTAAGATTGTTTTAAGAAGGCTTAA AACCCAAAAAGTCAATAATATATCCGACGGCTTATAAAGAATTTTTTCAT TTTGTACTTTATAGGTATCGAATTATACTTCATCTGGACCAAACGAACGG TTCTGGAATCCCCATCATAACGAAGACAAATGTAAGAACAAATAATGGGT CATACTTTAGGCGTACAAACTTTGGCGAGTAAAAACTTTTGCGATGACGA AAAATCGAAAAATTCATGACATTTACTTTTGCGAATTTAACGGAAAAATA TTTTTCGCGAGCATAAACTTTCGCAAATCAAATTGAGAATTTTCACATGA AAAAGTGGCTTAGAGGGATAAATACTTCTTGGATTGGCTTGAAACATTTT TCCTTTGACTTATTTAGTCTTTTAGCAGGCTAGAAAGTGCCATAAAAGTT ACATTTTATTCAAAGTTTGAAGTTTTACAGATTTTCTATTTTGTCAACAA TTTTTCGCGATCATAAACTTTCGCGAAAAGGGCCAAAATTCGCGAAAATC GCCAAAATTCGCGAAAATCGCGAAGTTTCTGCCCGCGAAAGTTTGTACGC CTAAACAGGGGGGGGGGTCATGTAGTTATTATATAAACACTATGACAATT ACTACCGTGGTGGTATATAAACCAAAATTTGGGAAAACAGTTACTCCACC AGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNAGTACACTATGGAATAACTGCAAGGGTGGTGGTGTCTGTAGAAAATG TCCAAAATTGCAGTTACTCCACATAGTGTCAAGGAGTAACTGCAAGACCC CCCCCCTGGCCTAAAGTATATTTATTCACGATATGCAATGCTTCAACACA ACCTTACCGAAAATATGTAACTGGACTGTTTGTTTTTTCTACCCAGTACG TCACTTCCAACCAATCAGGTGTTCTAAAAGTGATGTAATGTCAGTATAAA ACACGTAAGACATTGTAATGGTGCATATCATGAAATCAACCATAGAATTT GAATTTTGCTCAAATATTTAGGGCTCGAGTGATATTTTTCAGATAAAACA CTTCTCATATTTTGGGAAATCCGAATTGCCTAGAGTCCATTTTCGGACCA CCTCGGAGGTCCTATTCATAATATGCACCACTGCGATGACTTCACTAAAC TATGCAACTTTTCTGTTTTTGTTCCACCCAATACGTCACTTTTTCTATTG TTTAAGTGACGTATTGGGTGGAACATTTTAAAAGTTTTCAGAAGACTCTC CATTGGTGCATATCATGAATAAATCAACCCATGTCCGTCCGTCTGTTACA AGCTTTTCTCATTGGCTCGTTAGTTTTCTCTGATTTTTTTACAATAAGGC AAAATGGCAATACACAAAATGTGACAGAACCCGATTGTTTTTAGAAAATT TTTTAAAATGTCTTAAAATTTAAACTTTCGAACAAAACTGCTGTATTATT TTTCTCGGATTTCTGTCAGAAAGATAGCGGGCAAGGTTTTCAATAAAGTT GCCAAAGTCCTTTTTTCCGAAACTGCTTTTGGTTTTTGGCCGTAAAAATC GGATTTTGTTATTTGGGGAAATTCCCTTTTGTCATTTTTTGGGAAAATGA GTTTTTTTTCTTCGCGATTGCCTTGGTATTTCTATCTAATTGTTTGCGCA ATGATGTAAAATGGTATTGTTGAAAAGCTGATGGAGCCGATTTTCGAAAA AACGAATTTTTAGACAAATTTGGGCCAAAAAGGGTTTTTGGACTTGTCGT GAAATTGATCTGTAGTAATAAATAGTAATATTTTAGCAAAACTTTTGGTA AGGCAAACTTTATTGAGTAGGGACATAGAATGCCCCTTCCCCTGAGCTTA GGGGGAGGATAAATCTTTTTTCTTGTTTGGGTGCAATTTTTTTCTCTCTT AATGCTACGGGCTATGTTTTTATTAATTTTATCAAACTTCTAGTTTATGC CCATAACATTTGCATTCGTTATGAGTTTTTATGTCCTGCCTTCCGCAACA CTTGGGTTTTTGTAACTTTCAAGCAGAGAAGATGGGGCCGGGGGGGGGCA CTCGATTTCGAATCGACGGTATGTGCCTCGCAAAATCTGCTTTTCAAAAT CGTACCCTTACAGTGCAGTTCAATATGGCTGAAAAGGTACCCTTTCAGTG CATTTTCTCTTGATTTACCCAACCCTTATAGTGCACTATATTTCTCAGCT GTAAATCTGCGTGAAAGAAAAAGCTTGGGGAATTTTCTGTTTCAAAGAAA AACTAAGAAAATTATTCTTGTCAGCTGTAATTATCAGACAATAGAAACTT TTTCAAACAGACGAGAAGTAAAAACCTTTCTTATTAACAATTATTTTGAA TTTGTTTTAAAAATCGACCATTGCCGTGCAATCTCACAGAAACACACCCT TACAGTGCATTTTGGGATGCTGAAAAACCCCACCCTTAAGCGCGGCACAT GACGTAGGCCAGATCATATCCCCCCGGGTGGGGCTATATTCTTAAAATTT AGCTAGGATCTATTTTCATTAACCCCTCTCCCTGAAAATTGCTGAGCTGG ACCCTTTGTCTATGTGGGACTTTGGTGACAATTTTGTGTCCTTTTTTTTT AGTAAATTCTGAATTTACATTATAATAGTCTGGGGCCATTTGAAATAAAT TTCATCAAAATGAAACATAAACATAAACAAAATGCAGTTTAATTAATTAA TAAATTTTCAAGTAGCCCACCCGCCTCAGAAGAAATCACAACAAAAACAA TTTTTGTCATTTAACTTTTCATTTGCCTATGACCTAAACTAGGGGTAGAA ACCCCTCAAGTAGTCAGACGGCTTAGAAGTAGGTGTGAGTCGTTAGATAT AAGTTTGGCATGAATTTATGGCTAATCCTCGAATAAGAAGTTTTGGGGAA AATTTGTCCCGATAACTACAATATTAGTATAAATAAGTGAGGATCGCCTA CAACCATAACTGCAGGGAGGGAGGGAGGTAAATTATTTCATCCTGTCAGC TTTCAGTTAGAGCATCGACTTGAACAGGGAGATATAATGGCCATTTTGAA CATGACGTCACATGGCTATTAGCAAAGTAGACTCAGTTGGCGGAGGGCGG CCACCCAGCCATTCAAATCCTGTATATGGCGCTTATCAAATAAAAGTTAA ACCGCAATTTAACCTGTGTTAAATCCAAACTGTCACATAACTGCAATGAA AACTTTCAAAAGTTTTCTACTTTTATGATGATTTTTTTGAAACATTTTTT GTTTCAGAAACTGATTTTTATATGTTTTCTTTCCGTGGTTTCAGGTGGGA CCACTTTATGCGTGTTTCAGTTTTCAAATGTATCTATTTGGTGAAAAATG TTTCAAGTGGCCCAAGACCTTCGAAAGCCTCCCAGCGAGGACCTTTTTTT AAACATATGTTTCCCAGGCATAGCCTTCCTGGAAAATATGATCTGTTGGC CAAAAGTTTCAAAAATCTTATTCCTAGAAATGAAGATCTGTTTCTCCTCG ATACCTATATCATCTCCTAGAAATATTAATCTGTTTCTCTCTGATGACGT CATCAGCTACAGCGGCGAAACAGATTTATTAAGGAAAAGGTCTTCGGATA AGGAAAATCGGATCTGTTTCCTCATTTTTCAAAAAAAGCTATCTCCTGGA AAAGGGAAACAGTTATTTCGGGGAAATGGGCTCGTTGGCTGCTTCTGAAC CTTAAACATCTGAACCGTATTTTTACTAATTTTTCTGCTCTTATTGCAGC ACGATCAAAGAAGAACCACAGAGGCTCAAATAAAATACCTAACAATCGAT ACACCTAGCAACTGAGTACGGTTACCATGGCAACCTATGTATTTTGTAAT TACAACACCAAAATGGTATCTTCGACTGGATGTTCGTTCGCTTTAGAATA GGGCTCAGATTTCTTATCCTTTATTCAATAAACTCTCAATATCAAATGTT TTAGGGAGCTCTTTGCCGAATAATGTTAAAAGATTTTATCCCAGGGCTTT CAGATATATTTTTCTTTTTTGAAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000099XLOC_000099Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000170-exon-sc0000001-1575043694:676092..676150TCONS_00000170-exon-sc0000001-1575043694:676092..676150Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:674771..674881TCONS_00000170-exon-sc0000001-1575043694:674771..674881Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:673909..673975TCONS_00000170-exon-sc0000001-1575043694:673909..673975Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:668781..668926TCONS_00000170-exon-sc0000001-1575043694:668781..668926Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:668075..668149TCONS_00000170-exon-sc0000001-1575043694:668075..668149Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:666609..666731TCONS_00000170-exon-sc0000001-1575043694:666609..666731Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:666074..666117TCONS_00000170-exon-sc0000001-1575043694:666074..666117Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:665352..665483TCONS_00000170-exon-sc0000001-1575043694:665352..665483Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:663433..663496TCONS_00000170-exon-sc0000001-1575043694:663433..663496Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:636011..636168TCONS_00000170-exon-sc0000001-1575043694:636011..636168Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:631807..631880TCONS_00000170-exon-sc0000001-1575043694:631807..631880Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:628356..628435TCONS_00000170-exon-sc0000001-1575043694:628356..628435Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:627240..627304TCONS_00000170-exon-sc0000001-1575043694:627240..627304Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:626106..626178TCONS_00000170-exon-sc0000001-1575043694:626106..626178Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:624872..624940TCONS_00000170-exon-sc0000001-1575043694:624872..624940Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:609780..609905TCONS_00000170-exon-sc0000001-1575043694:609780..609905Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:606860..606946TCONS_00000170-exon-sc0000001-1575043694:606860..606946Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:605720..605786TCONS_00000170-exon-sc0000001-1575043694:605720..605786Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1575043694:601427..601701TCONS_00000170-exon-sc0000001-1575043694:601427..601701Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:676092..676150TCONS_00000170-exon-sc0000001-1510915933:676092..676150Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:674771..674881TCONS_00000170-exon-sc0000001-1510915933:674771..674881Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:673909..673975TCONS_00000170-exon-sc0000001-1510915933:673909..673975Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:668781..668926TCONS_00000170-exon-sc0000001-1510915933:668781..668926Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:668075..668149TCONS_00000170-exon-sc0000001-1510915933:668075..668149Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:666609..666731TCONS_00000170-exon-sc0000001-1510915933:666609..666731Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:666074..666117TCONS_00000170-exon-sc0000001-1510915933:666074..666117Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:665352..665483TCONS_00000170-exon-sc0000001-1510915933:665352..665483Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:663433..663496TCONS_00000170-exon-sc0000001-1510915933:663433..663496Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:636011..636168TCONS_00000170-exon-sc0000001-1510915933:636011..636168Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:631807..631880TCONS_00000170-exon-sc0000001-1510915933:631807..631880Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:628356..628435TCONS_00000170-exon-sc0000001-1510915933:628356..628435Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:627240..627304TCONS_00000170-exon-sc0000001-1510915933:627240..627304Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:626106..626178TCONS_00000170-exon-sc0000001-1510915933:626106..626178Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:624872..624940TCONS_00000170-exon-sc0000001-1510915933:624872..624940Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:609780..609905TCONS_00000170-exon-sc0000001-1510915933:609780..609905Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:606860..606946TCONS_00000170-exon-sc0000001-1510915933:606860..606946Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:605720..605786TCONS_00000170-exon-sc0000001-1510915933:605720..605786Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1510915933:601427..601701TCONS_00000170-exon-sc0000001-1510915933:601427..601701Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:676092..676150TCONS_00000170-exon-sc0000001-1491911889:676092..676150Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:674771..674881TCONS_00000170-exon-sc0000001-1491911889:674771..674881Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:673909..673975TCONS_00000170-exon-sc0000001-1491911889:673909..673975Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:668781..668926TCONS_00000170-exon-sc0000001-1491911889:668781..668926Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:668075..668149TCONS_00000170-exon-sc0000001-1491911889:668075..668149Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:666609..666731TCONS_00000170-exon-sc0000001-1491911889:666609..666731Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:666074..666117TCONS_00000170-exon-sc0000001-1491911889:666074..666117Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:665352..665483TCONS_00000170-exon-sc0000001-1491911889:665352..665483Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:663433..663496TCONS_00000170-exon-sc0000001-1491911889:663433..663496Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:636011..636168TCONS_00000170-exon-sc0000001-1491911889:636011..636168Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:631807..631880TCONS_00000170-exon-sc0000001-1491911889:631807..631880Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:628356..628435TCONS_00000170-exon-sc0000001-1491911889:628356..628435Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:627240..627304TCONS_00000170-exon-sc0000001-1491911889:627240..627304Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:626106..626178TCONS_00000170-exon-sc0000001-1491911889:626106..626178Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:624872..624940TCONS_00000170-exon-sc0000001-1491911889:624872..624940Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:609780..609905TCONS_00000170-exon-sc0000001-1491911889:609780..609905Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:606860..606946TCONS_00000170-exon-sc0000001-1491911889:606860..606946Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:605720..605786TCONS_00000170-exon-sc0000001-1491911889:605720..605786Clytia hemisphaericaexon
TCONS_00000170-exon-sc0000001-1491911889:601427..601701TCONS_00000170-exon-sc0000001-1491911889:601427..601701Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:601427..676150 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.168742 0.021548 2.7543e-08 0.612446 0.000748404 0.270671 0.197886 1.80942 0.000285201 4.94014 2.04385 0.00492762 0.301996 0.0614723 0.388256 0.349245 1.75559 7.11594e-08 0.0544247 1.147 0.619185 0.832166 1.55558 2.80717 12.861 2.09373 2.48361 2.31936 0.271267 0.0163319
Blast
BLAST of TCONS_00000170 vs. Swiss-Prot (Human)
Match: LRRC9 (Leucine-rich repeat-containing protein 9 OS=Homo sapiens GN=LRRC9 PE=2 SV=2)

HSP 1 Score: 424.861 bits (1091), Expect = 4.459e-132
Identity = 236/500 (47.20%), Postives = 343/500 (68.60%), Query Frame = 3
Query:   57 RVTCLRLDGQHLSKISNLEKLENLKWASFNDNDITKIEGLDNCKDLIELSLANNCLSKIDGIHHLKKXXXXXXXXXXXXXXDGIDFASLNNLRFLAFDNNFVLSLNGLQHSTSLLEIYAGNNKLQELRDIFYLKNIPTLIILDMMGNPLVKECNNYRLFLIYHLQSLKALDGIPVNFTEGGMAKDTFGGKLSTDFIAEKLGHSNFLELCELDLPHCNIRTVDLNSSELFKNLRSLNLEQNNLSCFGGIVNLHNLKVLCLNHNHIESIFPK------------------KSGTNSPQVISTNKNASSDDSTNQFKAVLENLEVLHLGYNGIANLAALELGRLVSLKALFLQGNEINKVDGLDGLYELRELVLDKNKIKAFTENSFRNQWKLAELHVEENRLRDLSNLEPLTCLNRLYVGLNRLQYGTDLEKLECLPNLFELSVIGNPIARRMSHRMMLIFRQPNLLSIDGIPVSNEERSKAEIHFLEQQGGIQALQALSNS 1502
            ++T L LDGQHL +I+NLEKLENLKWASF++N++TK+EGL++C +L EL+L  NC+SKI+GI  + KL  L ++NN L+  +   F ++ +L  L+ +NN + SL+GLQ S +L+E+Y  NN +   +++  LK +  L+ILDM GN ++    NYRLF+I+HL  LKALDGIP+  +E   AKD FGG+L++D IAE+ GHSNF ++ EL+    +IRTVDL   + F+N+ ++NL+ N+L+ F G++ L N+KVLCLN+NHIESI P+                   SG     +  TN++  S ++      ++ +LEVLHLGYNGI NL  L+L RL +LK LFLQGNEI++V+GLD L  L+ELV+D N+I++F +++F     L  LH+EENRLR+L  L+ L  L +L++G N++Q  T+LEKL+ +  L EL+V GNPI R+M HR MLIFR PNL  +DG PV++++R+KAE H  E Q    +L  +++S
Sbjct:  888 KITALNLDGQHLFEITNLEKLENLKWASFSNNNLTKMEGLESCINLEELTLDGNCISKIEGISKMTKLTRLSINNNLLTGWEEHTFDNMLHLHSLSLENNRITSLSGLQKSFTLVELYISNNYIAVNQEMHNLKGLCNLVILDMCGNIIIWNQENYRLFVIFHLPELKALDGIPIEPSETDSAKDLFGGRLTSDMIAERQGHSNFKQMQELNWTSSSIRTVDLIPVDQFRNVCNVNLQNNHLTSFSGLIYLPNVKVLCLNYNHIESIMPRLKPQTHLTSRQLLYQKVPSSGYGQQGISKTNRDIMSSEN---LPPIMHSLEVLHLGYNGICNLIQLQLNRLRNLKFLFLQGNEISQVEGLDNLVVLQELVVDHNRIRSFNDSAFAKPSSLLALHLEENRLRELGKLQSLVKLEKLFLGYNKIQDITELEKLDVISTLRELTVYGNPICRKMLHRHMLIFRLPNLQMLDGSPVNSDDRAKAEFHLAELQAKKNSLIPVTHS 1384          
The following BLAST results are available for this feature:
BLAST of TCONS_00000170 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
LRRC94.459e-13247.20Leucine-rich repeat-containing protein 9 OS=Homo s... [more]
back to top