Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000167 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000167
Unique NameTCONS_00000167
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length5821

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000167 ID=TCONS_00000167|Name=TCONS_00000167|organism=Clytia hemisphaerica|type=transcript|length=5821bp
aatacaaaaaaagcGTAACATTCTAAAATGGTAGTGAAGCTACGGAGACT
AGACTAGGTGAAGCAACTTGACACAGAAATTTTGGGGAAACTTTCTGTGT
GCCAACATGATGACGTAAAGACTCTAAAGATGGACCTTTGTATACTTAAA
CAATTAGTTATGCCAACTTGATCATGAACTTAATAATCTGGTAGAAAGCT
GAAGAAATTTGGTTAATAAAGCacgtttttatttacttttgttttttgaa
tgcaccaaaaagttttaatttttgatttaccGTTGATTCACGATTTACAC
CGTCCAGTCCACCAAAGATTTAATTTATCCTTGCTTCAAAATTGATTACA
AAAGATGTCTACCAAAGTCAAAGTTGCAGTACGAGTCCGTCCACTCAACA
AAAGAGagTTGGAAATGGCCACAGACATCGTCATTGATATGAAAGGCGCA
CAGACATTTCTTAAAGCAcccaaaaatgaaaaACATTCGCATATGACCAT
TGCTTTTGGTCTATGGACCCaaacaataaagaaaaattttcaaGTCAAGA
ATACGTATTTTCATGTCTTGGGAATGATGTCTTAGATAATGCATTCAATG
GATACAATGCATGTATCTTTGCATACGGACAGACAGGCTCTGGTAAAAGT
TACACTATGATGGGTGCACCTGGACAAAAGGGACTCATACCCAGGATTTG
TGATACACTGTTCGATAAAATAAGTGCAGCTGTAGAAAAAGATAAAAGCA
CAACTTTCAAAGTTGAAGTATCGTACATGGAAATTTATAATGAAAAAGTC
AGAGATTTATTATGCCCTAAAAGcgaCAAACACAATTTAAAAGTGAGGGA
acacaaaatacttggcacataCGTGGATGGTTTATCCAAATTACTTGTAC
ATGGTTATAATGATATAGAAAATTTAATGAGCGAAGGTAACAAATCGCGT
ACTATCGCGGCAACCTCTATGAACGCAGAAAGCAGTCGATCACATGCTGT
GTTCTCTGTTGTCATGACGCAATCACAATCGGATGAAGCCACCGGACTTG
TCGGTGAAAAAGCTGCCAAAATAAGTTTAGTCGATTTAGCTGGCAGTGAG
CGTGCATCGAAAACGAACGCGTCCGGAGACCGTCTAAAAGAAGGAAGTAA
CATTAACAAATCACTCACAACACTTGGTCTTGTCATCTCTGCTCTTGCTG
ATCAGgcGAGCGGTAAATCAAAGAAGTCCAATTTTGTACCGTACAGAGAT
TCAGTTTTGACATGGATATTGAAAGATAATCTCGGTGGAAACTCCAAAAC
TGTCATGGTTGCCACAATCAGTCCCGCAGGTGACAACTACGAAGAGACTC
TTTCAACATTACGTTACGCCGATCGTGCCAAACGTATTGAGAATCATGCT
GTCATCAACGAAGACCCCAATGCAACTCTGATCAGAGAGCTGCGTGGAGA
AGTGGAGAAACTGAGAGCGCAACTTTTGAAGCACGGTATAGCACAAGATA
CAGAATCATTACAAGAAGCTCTTgatcagaacgaaaaattgatGGAAGAA
GCCTCGCTGACGTgggaacaaaaagaaaaacaaactgaACGCATTCACCA
GGAACGGCACAAGATCTTGAAAGAGATGGGTATCAGCGTGCAAGATGCCG
GTATCGCCGTTGAGAAGGGACGATATTATCTGGTTAACCTGAATGCAGAT
CCTTCGCTCAATGAGATGTTGGTTTATTACCTGAAGGACCATACAAAAAT
TGGTAAAAGCGACGCATCTGACCCTCAGGACATCCAACTAAACGGTTTGG
GTTTACAACCACAACATTGCGTGATCGATATTGATAACGAAGAAGATACA
TCCTATATCGTCCCTTTTGAAGGGGCTAGAACATGCGTGAACGGTCAAGT
GATCACGGAACGCACGCAACTACGACACGGTGACCGTATTCTGTGGGGAA
ACAATCATTTCTTCAGAATCAATTGTCCCCACTCTCCTCCACCACCAGGA
ACGCAATCAgaagaaaaattggatttcGATTTCGCACAAAATGAATTGAT
GCTGAACGAATTTGATTCGCTTGGAGaaCCACTCCAGAATATTATCCAAC
AACTTGAAAAccaacatgaaaaagaaaaacaagGTGCTCTCGACCAGCAG
AAGGAGATGTACGAGCAAAAGCTAGAAGAACTACGGCGCGAGCGAACGCC
TGACACAACAAGCGGCCGCACGNCGAGCAAAAGCTAGAAGAACTACGGCG
CGAGCGAACGCCTGACACAACAAGTGGCCGCACGAGTTCAGGGTACAATT
CAGAAGATCGGGTTTTGAACTCAACGCCGACCTCCTTTTATGACAGCCAA
CTTTTGTATGAAGAGAGTTTACGTCGCCTGCGTGAAGAAGTGATCCGCGC
AAACGTTTTGGTGCGCGAGGCCAATCAGTTGAGCTCTGAAATGAAAAAGG
ACGCTGATTTCGCTGTCACGCTTCAgATCCCAACAGCTACACTATCACAA
GCCGCCAGTCAAGGGCCGTTGACAAGCGAAGTAGCGGTCGTAGTGAAACA
CAAAACGCGTGGCACACAAGTTTGGTCTGTGGACAAGCTTGGTAATAAAA
TTTATGACATGCGAGATGCTTATCAAACCATCACAGAAAACCCACTAGAG
GCTAACCTGGACGATACTGATGATGACGGTTTATTTTTCGAAGTGGAATG
TCACACTTTGATTGGCGTCGCCACAGTCTGGTTGGAATGTCTGTATCAAA
ACGTCCCCTTGGATTATTCAGCTCCGGTCATTAGTCAGCAGGGTGAAGTC
TGTGGACGCATGTCTGTTGAGATTAGGAGGATACAAGACGAGACGACATC
TTTATCACTTGATGGGGACAGTGTCAGCGATGAAGATGATATCGAAGGAT
TGGCCATGGGAAGCTCTGTCAAAGTACAGATTACAATCAAAGAAGCTCAT
GGTTTACCTCTCTCCCTCTGCAATTACGTGTTTGGTCAATACACTTTTTT
CGATCAAGAACTGTCCGTCATCCCGCCCTTGAACGCGGCCGCCTCGCCCG
TTACCGCCTCGAAATCTAACTCAATGACCTTTAACAACACAAAAACATTC
ACTGTCGAAGTTGACGAAGATTTTTTAGATTACGTCACTGACGGTTCATT
GGCTATTGAAGTTTACGGTAACCGAAGTAGAGGATATGACACCAAACCAG
CTCCGTTGCAATTGCCTCAGGAAATGGATAATAGTAAATCACTTGTCGAC
AGTGAAATGCTTGACCGGGTTAACCAGTACAGAACCAGATGGAGAGAGTT
ATCGCGGCAACTCGAATTATGGGTCGAAATCCACGAGTTGAATGAACAAG
GTTTTTACTCGCCTGTCGAGTTACTCCAACGTGAGGGACAAGAGGCCGGC
GGTGTGTTTATGTTACGTCAAGGGTATTCACGCCGTGTCGTGACACAAGT
CGTCGTCCCCAAACATAACAGTCAAGGATCGCAAGGACTTTTGCCAGTTG
TTATCGAGTCCATTTCGAACGTTGCTGTTGGAAGTGTCACCGTCCGAAAT
AAAACACAAAAGGGACTTGACAGTTATCAAGAACGAGATTTACAGACCTT
GCGAGATCGTTTTTCGAATTCAGTGATGAAAAAGCGAGAATATTTGGATC
AACAAATCCAAGAGATGATAAATAAACCaaACAAATCCCAAGAGGACAAA
GAACACGAGGGAATGTTGATCGACCAATGGGTGTCCTTAACTGAAGAACG
AAACGCCATCTTGTGTCCGAATACTGGAAGTGGCGTGCCTGGTGCTACCA
GTGAATGGAACCCGTTACCGGGAATGGAAACGCACATCCCTGTCATCTTT
TTGGACCTGGACGacaATGCATTGAGCGGGTGTGGAGACATTGATGCTGA
ACCAGCCGGTCATCATTCCTTCCTCTCTTTCGAACAATCCGACTCAATCA
TTGGTCTCCCGATTATGAAATACGATCAGAAACGGGTCACAGCAACTGCT
TCTTGGGATTCGTCTATCCACGATTCTGTATATTTGAACCGGGTGACACA
GAATACGGAACGGGTCTACATTATTTTGAAGTTAACACTACGATTGAGCA
GCCCGGCTTTGGTGAACATTGTATTACGGAAACGTATCTGTGTCCGTATG
TACAAACGCCCAAGTTTGAAGGACTCCTTAAGGCGGAAGTTTTGGCGTCA
AACCAATGTGCCCACCCGTTGTGGCGTACGTTTCGAATTGATCTCGCACA
TACCAAGGcAATCGGGAGAACAGACGGAAGAACGTGAATCACTGGCGCAA
AAAGCAGCAGAAGCAATGCATGTCGGGACAGATGGGGAAGAACTCATGGA
TGGTGAAGCTATCGATAAATATAATAAAGGGATTTCACACGTCGAGAATA
TTTTGAATCTTCACAAACTTCGTCAAGAAGTCTTGGTCAAAGAGAAGCTG
GCAGCTGTTGGAAGGTCCAGTAAATCACTGACCAATCGGAACATGAGAAA
ATACGCAAGCACACCTAATCTTTTCAACGCTCCGAGTATGTCAAATTTAT
GGCGATCACAAGCGTATCCATCGAATAGTGATTTGAACAACAGTGAACTT
GCACCGTCCAGTGGTCTCAATGGAATGAACGGAGAACTAAACAAGAACCG
AAGCTCCAGTCGTGCAAGTTCGGCGGGCGATTATTTGCGCGCGCGGCAAA
CAAACCAACGAGCCAAATCACAAAACAATCGGTATAGCGTCGGCGCATTC
AACAGTCCCTCCCAATCCCCGCGTATGGCTTTACGACAATACGATATTGA
TATTGACGGCGAATCGGCGGGTCGCACGACACCTCCGCGTGACCGCTTGG
TCCCGCGTAATAACACCACACCTGTGTTACCATCTTTAGTGGAAAGCTCT
CCGACAACGACTGAGCCACCACAGATGGAACTATTAACCGCGAAACAGAA
TTTGAGCCGAACGAATTCCAAATCGAGTAATGCCGACACTGATGACGATG
AGAAACCGACCATCATTGTCGGTGACGAAGAAATCCCGAGCCCTCGATTA
AAAGTCGGTGATGTTGTCAAGATTACCGAAAACTTGGAAGGGCAAGTCCG
ATTCTACGGGAAAACTCAATTCGCTGATGGCACTTGGGTCGGAATCGCCT
TAACTGTACCCGAAGGTAAAAACAACGGTACAGTTCAAGGAGTTAGTTAT
TTCAATTGCGATCCAAATCATGGGTTATTCATACGCGCTGAAAAATTACT
CAAAAgttgatgaccaaaatgttattATGATGATATTGTTGTCTGTCGGT
ACGTCGCCGTACGTCGCCAATGCTGGAGAAGGTATATAACGGGAATACGT
CGTGACGGTACTCCCGTCGCTAGCCGTTATTTTACAAATTCTTTCCCTTA
TGACGTTTGTAAAAGAGATATTTTCGATTCCAATTAAATTTCACTTTATA
ACTAATTATGTGACTCTATGATGGATATTTAAATcatgattttaaaaatt
ctatCGTTGCATTGTTGGAGTataaataataatgttttagGTGCTTTTAA
ATTGTAAAGAAATGGTTCATCtaccattttgatgacgtcattatttcttg
gttttgtgacgtcatcattgaCAATGTCTCTTATTGGTTAGTTGGTCGTA
TTAAAATAATACGCGCTTCAAGAGAGAGAGAATAATTTTATTTCTGTACT
GTATAATGTagtgttgttttatttttaaacgaATTTGTTTCATTTTACTA
CGATACTTACGTAAGAGACAAATATATATGAATAGGCTAACAAATTTGAA
TCGGAAGgcgtaaaatcaaga
Run BLAST on NCBI

protein sequence of TCONS_00000167-protein

>TCONS_00000167-protein ID=TCONS_00000167-protein|Name=TCONS_00000167-protein|organism=Clytia hemisphaerica|type=polypeptide|length=939bp
MKKDADFAVTLQIPTATLSQAASQGPLTSEVAVVVKHKTRGTQVWSVDKL
GNKIYDMRDAYQTITENPLEANLDDTDDDGLFFEVECHTLIGVATVWLEC
LYQNVPLDYSAPVISQQGEVCGRMSVEIRRIQDETTSLSLDGDSVSDEDD
IEGLAMGSSVKVQITIKEAHGLPLSLCNYVFGQYTFFDQELSVIPPLNAA
ASPVTASKSNSMTFNNTKTFTVEVDEDFLDYVTDGSLAIEVYGNRSRGYD
TKPAPLQLPQEMDNSKSLVDSEMLDRVNQYRTRWRELSRQLELWVEIHEL
NEQGFYSPVELLQREGQEAGGVFMLRQGYSRRVVTQVVVPKHNSQGSQGL
LPVVIESISNVAVGSVTVRNKTQKGLDSYQERDLQTLRDRFSNSVMKKRE
YLDQQIQEMINKPNKSQEDKEHEGMLIDQWVSLTEERNAILCPNTGSGVP
GATSEWNPLPGMETHIPVIFLDLDDNALSGCGDIDAEPAGHHSFLSFEQS
DSIIGLPIMKYDQKRVTATASWDSSIHDSVYLNRVTQNTERVYIILKLTL
RLSSPALVNIVLRKRICVRMYKRPSLKDSLRRKFWRQTNVPTRCGVRFEL
ISHIPRQSGEQTEERESLAQKAAEAMHVGTDGEELMDGEAIDKYNKGISH
VENILNLHKLRQEVLVKEKLAAVGRSSKSLTNRNMRKYASTPNLFNAPSM
SNLWRSQAYPSNSDLNNSELAPSSGLNGMNGELNKNRSSSRASSAGDYLR
ARQTNQRAKSQNNRYSVGAFNSPSQSPRMALRQYDIDIDGESAGRTTPPR
DRLVPRNNTTPVLPSLVESSPTTTEPPQMELLTAKQNLSRTNSKSSNADT
DDDEKPTIIVGDEEIPSPRLKVGDVVKITENLEGQVRFYGKTQFADGTWV
GIALTVPEGKNNGTVQGVSYFNCDPNHGLFIRAEKLLKS
Run BLAST on NCBI

transcript from alignment at sc0000001:544789..591162-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000167 ID=TCONS_00000167|Name=TCONS_00000167|organism=Clytia hemisphaerica|type=transcript|length=46374bp|location=Sequence derived from alignment at sc0000001:544789..591162- (Clytia hemisphaerica)
AATACAAAAAAAGCGTAACATTCTAAAATGGTAGTGAAGCTACGGAGACT AGACTAGGTGAAGCAACTTGACACAGAAATTTTGGGGAAACTTTCTGTGT GCCAACATGATGACGTAAAGACTCTAAAGATGGACCTTTGTATACTTAAA CAATTAGTTATGCCAACTTGATCATGAACTTAATAATCTGGTAGAAAGCT GAAGAAATTTGGTTAATAAAGCACGTTTTTATTTACTTTTGTTTTTTGAA TGCACCAAAAAGTTTTAATTTTTGATTTACCGTTGATTCACGATTTACAC CGTCCAGTCCACCAAAGATTTAATTTATCCTTGCTTCAAAATTGATTACA AAAGATGTCTACCAAAGTCAAAGTTGCAGTACGAGTCCGTCCACTCAACA AAAGAGGTATAAAAGTTTAAGGTGGTACAACCTACTTTCTTTCTGTCTTT AGTTTGAGCTTTTTTCTTTAACCTTTCCAGCCCAAAAGAAGGTTCTAAAA CATTCACCATAGGTTCCTAAAGATACCTGGCTATGTTTTGAAAATCAACC ATAATTTTGATGATAGTCCTTTCTGTCAAACTTCGCCTCACAAAAATGCG GGAGAGCTCCAAGTCGGAGTATTTTTCCCTGATAATTAAAATGGGTGTGG GTAATTTTCCCACTAAATCTGATTTTGTCAGAAATATATTTGGGGAAATT TTCCAAAATTAGCCAATTCCATTTTTTCAAAATATGAATTTTTTTCTCAG GAAATTCGAAATCGTTTTGGAAATGTGGGAGTTGTGTGAGAATATCCTGA AAATAAATGTAGGGGAGAGTTCAGGAGTTGACAGCTATGCCTTTAGGAGA TGGCACTACTGTATACCGTAGAGTCGTCTAATCTCGACATACGTCTTGCA ATCTCGACACCGGATCTGTAAAATAATCAAAACAAACCTTGAATGAAATT CTTGGTATCATTCTTATTGAACAAGTTCATCCATCAAACTAGAAGTTCAG TAAACATTGCAATCCTTTCAATTATAAAAACAGCCAAATTATAAGCAGTT TTACACAACACACGAAACGCATGCAACTTCCTCGTAACTTTCTCGTGTCC ATCATTAAAATTTTACAACTTAATTACGCTTCAAGTCACGTGATAAAAAT AATTCGCGCGCTTAGCCTGGTTTCCCATTCCTTTTATATAAAAACACACG CTCTAGGCGCTAACAGGCCGCACGCCGTGATTGCCAGTATGGCGGTCACA TTAAATTCAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCACGGTAAAAATGTCTACT AAAAAATTCCTCGCGTGCAAAATGTTGTGTTGTTGTGATTTGGACATCTT CGTTGAAAGTATGCTAATTAGTTTTTAGCGGCTACTACATCGTTAAAGTT TTCTTTTCAAATATAAGTAATAACACTTCACATTTCTCATATTATATTAA CAATCTGTGACGTGATAGAGAGAGAGTACATTTNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNAACTTTGGTATGTATTTGTTTA TGTTTGATTTTTTATTTCGAAGACCAGCCTACAGCTATGTCGAGATTGCA AGACGTATGTCGAGATTAGACGACTCTACGGTACCAATTTTGTTTGACGT TTGCCGTCAATTTCAATCGATCTTGACAAATTTTATCTGAAGTTCTAGTT ACTTTTTAGTTCTAATCAAATCAAAATGGTAGTGTTATCTCTGAAGGGCT TTTCACTCCAGTCAGGACCTCTTTGGTCTTTTTTAACATTAGTTCGGATA TAATAAAAACATACCTGATCAACACATCCAAACCTTCTGTCTTGCGTTTA CTCTTTCCTTCCCAACAACTTTCGTTTTTGCTTATGTAGGTTTTAAAATC CACAAGTAATGAACCTCTTATAGCTTTATNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTGCTA AGACCTTTGCTTGAAATCGAAAGCGAAACCAAGATTATTTAGCGCACACT GCCGTTTGCGTAATATCGATAAAGTGAAATGAGGTCCTGACTGCACTCTG TCTGATCTGTTATTAGTACAACCCAGGGTAAGGCCTGAACTGGTTATGGG GCGCTGCCCTTCTTTAGATTATTAGAATATTGGTGAAGACAGCTTTTTCA GTGGGATAACAATAGAAAAAGTGCCCTTTTAGGCCACCAACGTAAGCTGC CCTGCCTTTCTAAAGTATAGCCTGTTTGTCCAAGACAAAAAATTGGTCTG TTTCAGTCAGGAAAAGTGTAATTTAGGGAAAAATCAGTTGGAATTTTGGA TTAGGAAAATTTTAGAAATTTACAGAATGTTTGACAGAAAATATGGAATT TCAAAGAAATTGCAGTTTTAGCTGTGATATTTTAGACGGACCATCAACGC GATCCTTAGATCTCGCTATACAGTCCCTTTTTTTTAAGATGACGGGTGAG TTTATTGAGGTAACTGAGGAGTCATTTTTGGTTTGGCTTGACCAGACGAG TATGGATGGCAGGGATCTATGATCTAATTTAAAAAGTAATGTATTTTGTG GTTCACGATGTTTTTTCGTAAATGTATATACGAAGCATAAATTCCAAAAC TCTGCAAAACCACAATGCAACGTATCTCATCTCATCTTCTTTGAAAAATT ATTAGTTTAAACAAGAATTTTGAACTGTTACTTTGCTTACAAATTATTCT TTAAAGTAGAAAATGCATAGCATATATTATATATTGATAAAAACGCTTTG TGAAAGCTAAATAATTTTGAGGCTGCAGCGGCTTATTTAAAGCTTTCCTT TGTTTGTCAAAAAGTCTTGACTCAATTTCAAATCGTTAATCTGATCCCTG GATGGAATTTTCTGAGTTAATCGAGGTAAATTTTTGGTTTACCATGATAA GATGAGTATGCAGGGATTTTTCTAAGTACTTTGAGTTCCACCCTGACTTT TTTCTGAATTTACATTGAGATTCTAATATGCCTGACAGAGCATCTGCTCA GCAAAGCTGTTTATTGATGAAGCTGAGGGTCTGGGAAATGTTTAAATATG GAGGAGGGGGTTTCCAGTGGATCTAGGGTAAAGCCTTGGTTGGGGTTCAG AGGGGGAAGCTCTTGTAATACATTGAATATGTACATATTGTTGGTTATTT TTGCTTGTAAACAAAGGAAATATTTTTCTATTTTTGATCGAATTTCAAAT CTGGGATTGATTATTTTGACTGTATATATACCAACATAAAAAAATGCTTA GAAAAATCCCCTTAATTCTCCGTAAACATTTGAAGTTTAACACAAATTTT TCAATTTTAATCAAATTTTTATATACCTTATCTTTGGCTTCATCTCTGAC TTATTGATTTCTGCTTGGATTTATTTTTGGGGTATAATACACTTCAGTAT CCTTTAAAAAATTTTAGAAAGGAAAAAGGTAGGGCTCTCCAAAAATGTAC AGGCTTTTTCCTAAAATTCATACATTTTAGATTTATAAATTAAAAGTCGT TGACACCATCCCTACAAATACAACAGAGGCCATGAATAATGAACTTTCAC TATGAATTAATTAGTTAGAGTTACCATTAAAAAAAATTATAATGTATATT ATTATACATAATGTAATAGTCTGTCGTGATCACAATTTCCTCACTCTCCA CTGTCAGTGCATCTCAAACCCTCAGAGAAAATATACAGAAAACACATATT ATATTGGACTTAGTACCAAATTCTGTACTACCAAATACTAAATAAAATAA CAAAAAATGTGTCAAAATAAAGTTTTTTGGAATTTGCAAAAAATAGCTAC ATGGGATTATTTTCTAATTAAGGCCGCTACCCACGCAGCATTTTACGGTT GGCATACAAGGCGTGCAGCTTAATTATTGCATAGATTACATAAATTGAGC GCAACAAGAGTTGAAATTTTTCAACTTTTTTCGCTAGGCTGTGCAGCTTC CCTATTGTTCTTTTTTAAATAGCCAATCAGAAGAGACATTTAACTTTCTT GTACCGTGTGCAAAGGAATTTCAACAAAAGAGAAAAGAAAAAATGTGCAG CACATCTCCCCTTTAATTTGGATCAGTGGAATAAGAAAAGCATTTAGCGA CCAAAGCGCCCGAGCCATGCGGCTTGTTCGTCGAACATAAAATGCTGAGT GGGTAGCAACCTTTAAAAGTATTTGGAGCAAGCTACCAAAAACATAACTT TTTTATTTTTCCATTTTTTTTACAAATGTTCCAGTTTCATTTTGTCTAAA GGGATGAAGATAATTGAATGAGCTATGATGATATATAATAAGCTATAATT GCTCCACGTTCTCTGTGCTTGGTAAATTGATTGGCAGATTAAAGTCTATT CACCTGTGAGTTCCTGAGGGTTCTGCAGAGATGGCTTTTTCAAATCAACC CTGTCCTTGAACTGTTGTTTTTGAGATTGAACGGCAGCACTTAGCTACGA CAGTTCATTTGGATGGAAATTGATTTGGAGTACAAACAATAAGAATGTTT TGGAATGTCAGGAATATTGATGGACGTTTCACAATGTGCCTGAAAGTTCT ATGACATTCCTAAACTAGTAAATAAAAGGAAACAACCAGGATTGCTCAAG CTCAAGAACGTTCTGTAGTGTTCTTAGAATTTTCTTAAACCTTCAAGAAC GTTCAATAGCTTTTGTTGGACCTACCCCGGTGGAGGTCCTATAAATTAAC CTCTGTTCGTCCGTTCGTTCGTTTGTTCGTTCGTTACCAACTTTTCTCAA GATTGGCTCATTAGTTTTTTCTGATTTTTTGCACAAAGATGTGTAGCTAT AAACCCTCGAATGTGACGGAGCCCGATTTTCGAAAAAAAAATTTTTTGGG CAAATTTGGGCGAAAAAACGGCTAAAAAATGGGTATTTTGAAAAATTGGA TCATTAATTTTTTCTGATTTTTTGCATGAAAGTAGGGTACCATCATAGGT AAAAGATGGTTCAAGCAGATTTTCGCAAAAAAATTTTGTTGGCTCAAAAA AGGCATGTTTATCTAAGAATCACTATTAATAAGCATACATCAATGTTCTT AGTCAAATTACTCAATTTTTTTATGAGATAGATGTTTTTTTTTGCTCATG AGGGCTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNTCATGAGGGCTTACTTTTAAAGAATATGTGTGTTT AGACATAAAATTTTGGTTGCTTGGCGTGATTTTATAGAAAAACTGGCCAA ATTCGATATTTTTTTATAATCTCATTATCAACTTAGGTATTAGCTTTTCT CGAGATTGGCTCTTTCATTCTTTACGATTTTTTGCACAAAGATGCATAAC TATAAACCCTCGAATGTGACGGAGCTCGATTTTTGAGAAAAAATTTTTGG GGTAAATTTCAGCTAAAAAACGGCCAAAAAAAGATTTTTTTTCTGATTTT TTGCATGGAATTAGGTAAAATGGCTCAAGCAGATTTTTGTAAAAAAGAAT TTTTCAGCTCAAAAAACGCATCTTTATCCATAAGAATCACTATTAATAAG CATAAATTAATGTTCTNNNNNNNNNNNNNAGATGCATAACTATAAACCTT CGAATGTGACGGAGCCCGATTTTCGAAAAAAAATGTTTTTGGGCAAATTT GGGCCAAAAAACGGCTAAAAAACGGGATTTTTTGACTTTGTGGAATATTG GATCATTGCTTTTTTCTGATTTTTTTGCAGGAAAGTATGTATAAGATGGC TCAAGCAGATATTTGTAAAAAACAAATTTTTCAGCTCAAAAAACGCGTCT TTATCTACAAGAATCACTATTAATAAGCATACATCAATGTTCTCAGCCAA AATACTCAATTTTTTGATGAGATAGATGTTATTTTGCTCACGAAGTCTTG AATATGAAAAAATATTTCAAAAGCATGAAATTTTGATTTCTAAACGTTTT TTTAAAAGAAACAAATGACTAATTTTAATAGATCGTCAATATTTGTGTTC TGAATGATTGTTTAATGGTCACGTCACGTAGATATCAATTATAAATGTGT TAAATGCATATTCAGGTAGGTCCATAAAAGTATCACTTGTTTTATTTGTA TTCAAAAGTCTCTTGTGAGGACACATTTACACAATTAGATGGGAGTTGGT AGATTAGATCAACTTATATTACTGATTGTTTCTGTTAAAAATAAATTTGA TGACAATCCAATCACAGAGTTGTTTTCAGATTTCAACCAATGAGATTGTC CCATACAAAGCAGATTGCCCGCCAACGTTTTGGTGCTAATGGCTTTTTAG CATCTTGCACACCAGGTCAAGATATAAATATCACCTTTTTAACTCTTTCA TCTCTCTGAGGCTTAGGCTTATTTTTATCATTAATTAATTCTCAATGTAA GAGTTATGCTGTCAATAAAGTGCCACAAAAAATATTTTCTGGTTAGATGA CGCACAATTGATATTATCCAGGGGAATAAATTTGTAGTTCTTCTTCTATT TCTGCATATTGGCCAATTTGATGAAATATAAATTCGAAGTCTTATATTTC ATAGAATAGCTGATTTCTAATTTTGAGAATCCGAAAGATTGGCAACCAAT CATTTTTGCCTGCTTAGGGCTTTTCTCTTTGATGTTTTATTTTATTCTTT GTTGATTGGTCATGTTCATCAATCACTCACAAATCATTTCTTGAAATGAA AACAAAAGGCTTTTTACTAAACTGTCAGCAATGTCCAGGCTACTGTTTTT TGGTTTCAATGGCGGTGAGTTTTGAATTTTCTTGAAAAGTTTTCATAATG ATAATTGTGGATTCAGTGCTGAAGTTTTTTATTAAAAAAAGGTCTATCAT CTTTACTGATTTTTACAAGCAGTAGCACTGTGAAGCTGCAGCACATGGAA TTAAAAATTATTGGAGCACTTACTGTCAATATATCAATATTTCCGTTGGA TTTGAAGCCAATTCATTAGAGTTAATATTTTAAAATTTGGATTCACACTT TCATCCGTTCTCAACTTGTATTGTATTTCTATACTATTTGGTTGTGAGTT TCAGCTGGCCTTGAGGCCCATTCTCGCAACTAGAGATGCTTTCAATAAGT GGCCTGTCAGCACCTTGGACTGACTACCCAGTACCCCTTCACATGGCATG TTTTGCCTTGGACCAAGGTTCATTCACTTGCCAAGTGAACTGTTTCGAAT GGGAATTGATCCTCAGTCACTTGTCACATAGAGAAAGTGTCTACTTTGTA TCTATTGTTTCATCTTCAAAACAAATTTAAAACGGCTGCGTATATTTTTA TTTTATTACAACTGTTAGTCGTTATTATAAGCAAAACAATGAGGAATGAA TACATAGGGCTGGCACAGTCACTTTCGGTCGCGGTTGTGGATGGTGAATT TTGTCGTTCTTTTTTAACGTTGCGAAGTATGCACTTCTTCCCCCTCCTGT GCAGCAACACAGGCCAATGACCACTATACCACAGTTCCCTCTTTCCATTA TCATCATTATGATTTACAGGGTCCTGGTCCTGGCTTTTTCTAAGTTTGAT TTGTGTTTAATGTTTGTTCCTTCTGGTTCCTTTCCAAAACATCCACATAG AAGAATTTACAGGAAAAACTATTGTTTTTTTTTTCTTTTAAATTATCAAC CCAGTTGATCTTCCTTATCTTTCATTAATTATTCATCAGCAGGTTTTATG TTTGAAAATTGCTCAAGAATTTAAATTGGTTTTATTAAGAAGGGGTGTTT ATTTCCACAAGTTTTTAGTTCTCCTCTAATTCTCAGATCAAACACTCCCA AACATGCCATAGTTTTGAATACTAATATAAAATCGATGTTGATCTGAACT TTTTATATCAGTCCTCCTTCATCTAATAGTTTTTAAAACATGATTTTACA GAAAAACTTTAAAACTGGAAAAAAATATTTCTATTTCGTTCCTCTGATTT TACCATAAAGTATAAATGAAATTCAAAAATATGAGATTTCATATGTTGTT TAAAACAAAAAGTACATCTCACATCTGGTACTTTTTGATATTGATTATAG ATTTTTTATTCTTTTTTTTACTATAAAATCATCATGAAAATTAGGTGTTA AAATTTTTGATATTCACTCAGATTCACTTATGATAACACTCAGCCTTTGA AGCTTTTTGAATTTCTTTTTATACATTTTCTTGACAGTGTCAGATAACTT TAATCTGATTATAAAAAGTTTTTGCCTGGAATTACACTCAAAATGACAGA TTTTAGTATTCAAATAATACTTTAATTAAAGAAGTTTAAACCTCCCCCTA AAAAGTTTTCTTTTCTCATTTTTATGTCAAAAGAATCATCATACCAAAAA CAAATACCCAATCTGGGATTTTTCTAAGCACTTTTATGTCCGTATACCGG CCAAAATATTCTATCTAAGATTGAGTCTTTGAAGATTTTTTTCTAGCAAA ATTAACCTTTTTTGTTGTTTATGAGCAACAATGATTATTATCTACATATT CAAGAGTTTTTGGGAGCATCGCCCTCTGAACACCCGTACAAGACCCCCAG TTTCATCAATGTACAGCTTTGTTGAGCTAGTTCCCTTTCAGGCATATTAG AAATTAAATCTAAGTTTCAATCTGCCAATCTGCCAAAATCCCTGCCAATA CCTTATGAATAGAAGGTTTGCCATAGGACTAATATTCTAAATACAGTGGA CTTAGATTTGAAGTTATAGCCGATGCCCAAATATCCCAAATTATGGACTT TTTGTGAGCAATGTTAAACATTAATGATGTGAGGTCACATACGTTTTTAA TCCTGAGAAACTGGGATGATGACTTTGAAGCCAGGTCATGTTTGGATCTC TGGAAAATTTGTGCTTAATTCAGTACTTTTTAGACCTAACCAGATTTTCT AGCCTCTACCTCTAGGGACACTTTTTTTATAAGAAATTGGAAAGTTTTGA TGATAGTCAGCTTTTTTTGGCACTATGAGCCTCAAATTGTTCCTATCTTG TTCTTATTTATAGGATGTAATTGAGGTATTTTTGCGTTATACCCAATTTT TACTTTTTTGACCCCTAAATTGCTTGAAATTGAGTAATTTCAGGTTCAGC ATTGTTCTTAAATTGGCGATTTTGAGCCTCATTCTTCAAAAAAACTTCAT ACTGTGTAAATACAAAAATTATACTTTATATACCTGTGCTTAATTCTCAG CAATTAAACATCAAAGGTTAGTGTAGAAATCCAGTGAGAATGGGTAATAT GCCCTCCCCTCCCCTCCCTTACCTTCAGTTAGATAGTTTAAGTTATCTAA AGGGGAGCCTTCAGGTCGCTTCCAACTGCAGTTGCAAGACACACTTGCTA CCAAAGGTCGTGTTATCAGAACACAAAACATTTTTTTTTATCCAACAACT TTTTCATTTTTTAAAATTTAGTTTATCTTCATTTTTTCAGAGTTGGAAAT GGCCACAGACATCGTCATTGATATGAAAGGCGCACAGACATTTCTTAAAG CACCCAAAAATGAAAAGTAATCTTTTAATTTTGTTTATTTTTTACTTTAC AGTTCACATTTAGTAAGTAGCTTGAAAAACTTTTTATAAATTGTGCCTGC TTTGTATTATCATTTGACAAGGCAAGTTTTAAGGAAGCCTGCTTTTTGTT AAACCTTTCAGTCCCAGAGCTTTTTCACTTATTTAAAGATCAAAAACTCA AAATCTTTGCACAGATGTCTTACTGGACACCCAACAACCAACCTATTTTC TCCAAAATTTCATGCGCTTTCCAATAGTCCAGGAAAGGAGAGTTCCAGGA AACTTCTTAGTTCCAGGAATATAGCCCGTCAAAGCTGGATTCCTCCGAAG GTAGGGACTGAAAGGGTTAAAGAAAATCGGACAATATTTTCAAGGCTTCT GAGAGTTTTCCCACGTTTTACGTAATTTCAAAATTAATCCCTAATTTTTC TTTTTTCTTTCTTTTCATCATCTTCTGCAACAACTTAGAAAGTCACAAAG GGTAAGTTTAGCTTCACTTTGATTCTTTTTTAAGAAGATTCACACATTCA GACATTGTTGTGCCCAATTGTATTTTTAAGGAGCTAATCAAATAGTTATT GATATTTTGGCCTGCTGCAGATAACTTTTGTAGTCCTGAGAAAAACACCT CCAAATCTTTTGACTCAAATATTTAAACTGTTTATTGAGTAATTTGCTTT TCAAATTTCCAAAATTGAGCCTTTTTCACTAGCCTTTAAGATTGTATTTC CATTATTTTTAAAATACAAAAAAATTTCATTTCACAATTTCTTTTTTACT GATTTAGCTTCTTAGAGGCATTTTTCTTTTGGTGATTTCTGTTTTTTTTT TCAAAGAATTTTGATATTGAGATGCTTACTCAAGGCACCACACCTGATCT CAGACTTCGGTTTTCAGCTTGTCACTTCCTTTTGTGTCTTGTGAATTCCT TTGTCATTTATTCTCTGTACTATTGTTATTTTTTATTTTTTANTTGTCAC TTCCTTTTGTGTCCTGTGAATTCCTTTGTTATTTTTTTTTATTTTTTGTT ATTGTATTTTATATCTTTCTTCCATAATGCATATTGTTTTTGTTACAGTT TGTCATGGTTGTCGCTAGTTTGTATCTTCTTTGATATTTATATAACTTCA CTTTGTTTCTTTAGACATTCGCATATGACCATTGCTTTTGGTCTATGGAC CCAAACAATAAAGAAAAATTTTCAAGTAAGTCAATTTAAACTGGTTTTCT GCTATGCAAGGATTTTGCCAGAAATGTCAACTAACTCACTGTATGATTGT TATTTTTTGCAGTGTTGCATGCACATTGTTGAGGATTTTAAAAATATTTC TTGTCTATTCTTTTTCTTTCGGTTTAAAGAATATGTCAATGCCTATAAGC CTCCCCCCCCTCAGTTCACATATATTTGGCGAAAAATTCCAATATTTAGT TAAAAAATGGGATGTGTTCATATAAAAAGCATATGATTAGGTTTGAACTT CAAGCCTAAAATTATTTTTCTTTTAACCCTTTGAGTGCCAGGGTCCTTTT TTCTAAGTTTTTTTTAAAAAATCGCTAGTTCAAACTTTAAGGGCTTATAT CTCCTGATCTAGAAGGAATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNACGATTTCTAACTCAAACTGGGCATTA CAGGAGGGCTTCGCCCTCCTATATAGCCCATGTCGTATATATACGACATC GGCACTTAAAGGGTTAAATCTTTTAATTCTTGATCCCTTGCTTCCCCTAT TGGCCAATTTTAATGCAATAAGGAGGCCATACTTGATATTAGCATTCTTT TTATTACCCTTGTAATCTATTCCAAATCAAAGTTAAATTGATAGACCTTT TCATAAATTATGTCACCAACATGACTTGCCTCGTATTCAAACAATTTCCA TAGTGATCATATCCCTTGGGACATTAAATGATTTTTTATAAATAGAAAGT AGTTTTAATAAAATCCGCTTGGAGATAATCACCATGGGAATAATTTCAAA ACGAGGCAAGTGATATTCGTGACGTAAATTATGAAAAGGTCTATCAATCA AAGATTTTACCCATATAATTTAATCAAAGTAAGAAATGATTATAATAATG ATTCTTTTTATCACCCCCTTTCAGGTCAAGAATACGTATTTTCATGTCTT GGGAATGATGTCTTAGATAATGCATTCAATGGATACAATGCATGTATCTT TGCATACGGACAGACAGGTATGTATACCTTGCCTTTCTGTAAATTTTAAG GCTTTATAGATTCTGAAACACTCCTAAATTATTCTTAAGACGTTGTATAG AAATACTCACAAAATAGTGAAAATAAGACCATTTCAAGACTTTGTAATGC TTAAAAAACTATTGACTTTAGTTACACGGTCTTTTCGAGCTGGGATACAG GATAAACAGGGCCAGTAAAGACCGTATTGGTGGCGAGGGTTGCCGAGTTT CATTCGAAAGCGCATTCGTCAATATGCAATATATCTTCTCTTTTTCTCAA TCGAACGTGAGGAAGACAGATACGGTATATATCCCACCTCCACGTGATGT CTTTTGACCAATGAAATCGCGAGATAATGACATGTATACCATGTATACCT TGTCTTACTGTAAATTTGAAGCAACAAGAGTGATTCCCCTAAATTTTTTA AAAGTGATTATTAAGTAAAAGTCAGGGATACTTGGCTTATTTAAACTACA TGTTTTTATAAGAACATCCTTGAAAATCCAAATTTTTTGAAGCCTTCAGA TGTTCTTAGTTTGAAGCCTAAAAATGTTCTTAAATTGTTCTTTTTAATTT CGCCATTTTGTAAGTATGTTTGTCAATTTTTGAGTGTTTAGAACTCGTAA AGCCTTATTAAAATGTTCTTAATTTGTTCTTAATATTTTGGCCATCGAAG CAGTATGTTCTTGTAAAAAATGAACGTGTAGGACCACAAGTCATGGAAGG TCACTTATGTAATTCAGATACTTTTGAAATATCCTAGAAATAGATGGGTA AATGGATGGATGGATAGAGTCAATATTTTGCGTGGATAGCCCAGTAATCT ACTACTTTGAAACGATCTTTTCAATTGTTATTACGGGGTCAAGAACCAGC ACGCTCGGCTATCTATGTACTGCGAGCGGAACATTAGAAGGAGCGCGGAC TCAAACCCATCGCTCCTACGTACAAAATTAAATCTAAATATTCAATGTTT CTTTCTCCCTATTTTCCAGGCTCTGGTAAAAGTTACACTATGATGGGTGC ACCTGGACAAAAGGGACTCATACCCAGGATTTGTGATACACTGTTCGATA AAATAAGTGCAGCTGTAGAAAAAGATAAAAGCACAACTTTCAAAGTTGAA GTATCGTACATGGAAATTTATAATGAAAAAGTCAGAGATTTATTATGCCC TAAAAGGTATAATTATGAGTTTTTTAGGGGTGGGGGTTCTAATTGGACGG TTAATTTTATTTAAATATCAATTTCCTAGTTCAAAATATGATTAGATGAA ATTAGGTTTGATTTTTATACGCAGTCTCTTATTTTGAACCTCTATTACTC GATTCGCTATTCTGAAGAAATTTTTAGGTCCAATTTAGAGGAAAAGTCAA TTTGCTCTCCTTTTTTATTTTCAGCGACAAACACAATTTAAAAGTGAGGG AACACAAAATACTTGGCACATACGTGGATGGTTTATCCAAATTACTTGTA CATGGTTATAATGTAAGTCAAAATGTTTACTCTTAGGTGCTTGATAAATG AGGGGGAGGACCTCTCATACCCCTCAGATACGTTAAATATCTGCTTTAGT GCACAATGAGAAACCTCTCTCTTGACAGCATTGACGAGCAGCCCAATATA GTATATTTCCGCATTTCCTGTCTCCCGATCATTTTAACTTTGAGTGGAAT CTCTGACATATTTAGCATCTACCGGGTGCGCCACGATAAAGTTTCTCTCT TTAAAGTTAACTTTCTCGAGGTCTAAATAGATTAAAAGAACCAATATTTT CCGTTGGAAAGAGGAAAGATAAACTTAAATTTTGATGAGTCATTTATTAA ATTTGGTTGTTAAATTTAGATCAAAAGTTATGGTCAATTGAATAAAAAAA TTACTTTCAGAGGGACCTCAAAAACGTTGAAAATCGACCTATCCAAATGT TCGTTCTAAAATAAGTATACACTCTGATGCCATCATACGCAGCAAGAATC AACCTTTACCTCTCATATGCTGGGCAACCACACGGATGTCTTGCATTCCC TGGTCTAGCGACCAGATCGAAATCAATACTTTATTTATACATTTGTTTTT TCACTCACAGGATATAGAAAATTTAATGAGCGAAGGTAACAAATCGCGTA CTATCGCGGCAACCTCTATGAACGCAGAAAGCAGTCGATCACATGCTGTG TTCTCTGTTGTCATGACGCAATCACAATCGGATGAAGCCACCGGAGTAAG TTGTTTATATCTTTTGTGTTATTCAAACGGTGTCCCTACTGGCCAGGCCA TTTTTCATGCCCTTTTAGAGTCGCTGTCTCTCCTGAAATCACAATAATTT TGGTAAAAGCAGTCTTTTTAGCCGAAAAACACAATACAAAGTGTCCTTTT TGACCACCAACGGACGCTGCCCTGCCTTTCTTAAATGTGTCCTGTTGGCC CTTTTTACATCAAAGGCATTTATTTGTGAGGATATCCAGCATTTACGTGC TGCAGGAAAAAAAACAAATATTTTTGGACCTACCCCGGTGGGCTGTAGGT CCTATAAATTAACCTCTGTTCGTTCGTTCGTCTGTTCGTCCGTTCGTCCG TTCGTCCGTTCGTTACTAGCTTTTCTCGGGATTGGCNNNAGCTGTACTTT ATATTTTTTCATGAAATTTTGCACACTGATGCAAAATGACAATACCTAAA ATGTGACGGAGCCCGATTTTCGAAAAATATTTTTTCCCGGCCGAACAGGG GGGGGGCACGCAGTTACTAGACATGATGTGTAGTAAGTGCTTTTTCAACA CTTTTTTTCAGGACCACCACCCTTTGCAGTTACTACACCTTGGTAGTAAC TGTTTTCTGAAAAGATTTCCAGGTACCACCCCTGTTTTTGAGTGATATCA TCAAAAACATCTCGAAATTACCCTAAATTGCGATTATTTTTCAACCTAAT ACCATTTTGTGCTAGATTTTCTTTTAATTTACTTGTTTAACAGCTGTTGA GAACATTTTAATGATAATTACGGAAAGCATAATTTCAAAGTTGGGTCTGA GAAAAATTTCAAATTTTTTTTCGTCCATTTATAACAAGAATATTTTTTTT AACAAAGAATTTTTTCACAAAAAAATTCATTTTTTGTAAAAAATTTTGAA AGTTCTTTAAAAAGAATCAAAATATAAGCACTTACTACACCAAAAGTGCT AGTTTTAGCGTTTGGCACCACCCCAAAACAGCAGTTACTACACTGTGTAG TAACTGTTTTCATAACTTCTGAATACAGTACCACCACGGTAGTAAATGTC ATACTGTCTTGTAGTACCTGCGTGCCCCCCCCCCCCGGGCCGAAAATGCC AGAAATATGCCGGAAAACCGTTTTTTTTTAACATTTTCTCGAATTTTCAT CTTTAGCTTTTTCTGATTTTTTGCAGAAAGATGCGTATTTGCAATGCTCA AAACATGGCCGAGTTCGATTTTTGAGAAAAATTCTATTCCGGCTGAAAAT GCCGGAAATATGCCGGAAAAACCGGTTTTTTGGCATTTTCTCGAGATTTC ATCATTAGTTTTTTCTGATTTTTAGCACAAAGATGCGTATTAACAATGTC TAAAACATGGCCTAGTCCGATTTTTGAGAAAAATTCTATTCCGGCTGAAA ATGCCGGAAATATGCCGGAAAAACCGGTTTTTTGGCATTTTCTCGAGATT TCATCATTAGTTTTTTCTGATTTTTAGCACAAAGATGCGTATTAACAATG TCTAAAACATGGCCTAGTCCGATTTTTGAGAAAAATTCTATTCCGGCTGA AAATGCCGGAAATATGCCGGAAAAACCGGTTTTTTGGCATTTTCTCGAGA TTTCATCATTAGTTTTTTCTGATTTTTAGCACAAAGATGCGTATTAACAA TGTCTAAAACATGGCCTAGTCCGATTTTTGAGAAAAATTCTATTCCGGCT GAAAATGCCGGAAATATGCCGGAAAAACCGGTTTTTTGGCATTTTCTCGA GATTTCATCATTAGTTTTTTCTGATTTTTTGCAGAAAGATGCGTATTTGC AATGCTCAAAACATGGCCGAGTTCGATTTTGAGAAAAATTTTACCGGTTG AAAATGCCGGAAATCGTCTTTGCAGATTTTCATTATATGTTTTCCTTGTA TTTCTATGTTCTTCACACAAAACATTATTGATAACAATGCTCACCATCAA CAATCAGTGATGAATTTATTGCGTTATACATTTTCGCTAAACGATATATT TTCTGACTGATTTTTTTCTCCTCGCATTGCTATCTAACTTTCATCATCAG GTAGGTCCATTCAGCATCTAGCTTGTTTAGTCTGGAATATATCGCATGCG TTGGCACTATTTAAAAAAGAGCGAATGGGCTCTTCCTGAAAATTTTTGTA CACGGGGGGGGGGGATAGAAATAGAAATTACCACTCGGAAAAGCATCAGT TGACCCCTGGACATTCAAAATTACCCCTAAACAGAGCAAGTTTGCCCAAA GAACACGGCAAGTTTTGAAGATTTTCACAACCTCCTGGACAATACATCCA ATATATCCTCCACCCCCAAAAATTTTCTGGAAGAGCTCAATAACGTTAAA ACTCGTGATTACGGTATATAAATGAACAATATGGTTGTAAATGTAGGACA CACCTTACTGTTTGTTTATAATTTCATCTTCTTGTTATAATTGTTGGTTT CCCACCTGGTATTGAAGCCACCGTACCGTGAATTGCTTATTTCAACAAAA ACAAATTTTTGATAGCATCGATAGCTTTACAAAGCACCTTTGGATCTGGT GTATTGAAAAAAATACTAAAAATACTCAAAGTAAAGTCACCAAAGTGGCA TGAAACTGCCAGTAGAAGAATAAAAAAGTGTCTTTTCTTCTTGACTGACT AAAAAAATAGTTACTTGAATTCTTACTATATTTTTAGCTTGTCGGTGAAA AAGCTGCCAAAATAAGTTTAGTCGATTTAGCTGGCAGTGAGCGTGCATCG AAAACGAACGCGTCCGGAGACCGTCTAAAAGAAGGAAGTAACATTAACAA ATCACTCACAACACTTGGTCTTGTCATCTCTGCTCTTGCTGATCAGGTTA GTTTTGTTAAAAAGGTTTGATTCTGAAGGATTGCTGATTTGTCTGCACCG TAAACCAGAGCCATGAGGTTTGAGTCTCCCTTGCATTCTTACTGTCCAAC TTACAGATAGTGTACGGGAGGGTGTTAGTGATTTATAGTATATGAAAACC ATTCTAAATTCTGTCCAAGTTAACTAGATTAAATGTTTTTTTATTTGTTC ATGTATTTTTTTTCTTTGTTCTTGCCATCCCGGGGATTGGGTCCAAGTCT ACAAGTCCAAGTTCAGAATCTAAATACGTCAAATATCAGATAATTTTGCA TTTCCCTGTCAGCAGCCTTATGATGAGCAAACCAATCCTTATTTTTATTT TTACAGGCGAGCGGTAAATCAAAGAAGTCCAATTTTGTACCGTACAGAGA TTCAGTTTTGACATGGATATTGAAAGATAATCTCGGTGGAAACTCCAAAA CTGTCATGGTTGCCACAATCAGTCCCGCAGGTTGGTTTGTATTCATTATT ATTTAATTTTCCTAGATAGTATGTTATTGTACATCAGGGATACAGCCGCC TCTCCATAATTCAAACACCAAGGGGGGTAGTAATCGGAAAGAATAGTTCA TTTTTAATAAAGAGACGAAGTAACCAGAGGTAACCTAAACCTCTGGCGAT GAACCAGAAGCTGATCTCTGCAGTCTCGAGAATCGATTTATAGAGTGAGT TGAGTGAGGCCTCTCTTCTAAAGAATTTCTTTTTCGATGATTTTCCTTTA TACAATTTTTTGAAGTGTCGTTGTGTTGGTCGCACGGTTCTGATCACTCA AAAACGAATTATGTAATGTTTTTTTCAGGTTCAGCACCTCTGCAATGTCT TCTGACCTTAAGTTTTGCATATTTGCATAGGTATTGGCTAGAAAAAATAT TTAAAGTAAAAAATAATTTGATAGTTAAGTCTTTGCAATGGTCCATATAA TGACTTAGTTCAAAGACGATAGCTACAAAACGTTATCCAATAAAATGGCT TCATTTGGTTTCAGTACGATACGGGACACAGGAATTTGTAATCGTTATCT GAATTCTTCATTTGCATCTCAACTTTCTTAGGTGACAACTACGAAGAGAC TCTTTCAACATTACGTTACGCCGATCGTGCCAAACGTATTGAGAATCATG CTGTCATCAACGAAGACCCCAATGCAACTGTAAGACACTGGCTCTGGTTT AGACGGCGCACTTTTCGCCTTACCTATTCATGATATGCACCACTGGAGAG TCTTCTGAGGATTTTTGAAATATCCCACCCAATACGTCACTTTAACAATA GAAAAAGTGACGTATTGGGTGGAACGAAAACAGAAAAGTTGCATAATTTC NCTTAAACAATAGAAAAAGTGATTTGGTGGAACAAAAAAAGAAAAGTTGC ATAATTTTGTGAAGTCATTGCAGTGGTGCATATCATGAATTCTAATTGTG AATCAAAGTAGGCATAAAGTTAGCTGTTTTTTAAACTCAATGCGTTGCCC TCTTTTGACGTCAATGCAATGACTTCTTTCAATCTTTTTCAAGCAAAGAT TTTAACTGCCGACTACCGTCCCACTTTTTTTCTACTCTAACAATTAGGTC TTCCAAACCTTTTCAAAACTTTCATCATTTTAAGTAGCGTGTCCTTTTCC CTACACGCGATTTTTTTATCACTATTGCGTCAAGGGAAAAGCCGTGGTCG TCTGGTACAGGCCACTTTTTTAGATGCTTGGGTTTGAATTGACGTCAAAA GTTAATGCATTCTCAGGTAAAGTTGACTCTCGGTAATTCGAACTCGAACG GGGGCTCCAATTTGTTCCAGAAAGATTCGAATTAAAGAAAGTATTCCACG AAGTTTTCCTTGTGACGGGAGCTGAGAATTAGTTCGAATTACTTATCGAA AGATTTGAACGATAGAAGTGAGCGAGAGTCAGTTGTACAGACATTTTGCT TTGTTACTTCTTTCGCTTACAACATTAAGTTAAATTCAAGGCACTGTATT CTAGGTATTTTATCAACGCTTGTGGTGTGAAATCTAGCTTGTAAGCTGTA GCTGGCGCTCTCTAATTCGATTTCAAGGGGATTTCGTCGAATAAGGGAGT GTAGTCGAATAGTACAGCGTAGTCGAATAGTACAGTGTAGTTTATATGGT GATATTCAATTATTATCAAATAGTGCATCGGAGCTAATCGAACAGTAGAA CGTCGAATTAGAGAGCATCCACTGTATCTAAAAAAATAAACTTAACATAT ATTTTTCTTTTCCATAGCTGATCAGAGAGCTGCGTGGAGAAGTGGAGAAA CTGAGAGCGCAACTTTTGAAGCACGGTATAGCACAAGATACAGAATCATT ACAAGAAGCTCTTGATCAGAACGAAAAATTGATGGAAGAAGCCTCGCTGA CGTGGGAACAAAAAGAAAAACAAACTGAACGCATTCACCAGGTAAAAGAG TTGACAGACTCTCTCTTATTCGATCACTATATAAGGGCTTAGAAGACTTT TTTTTTAGTTCGAACTTCAATAGATCAATGATATTCCTGTAATATCTAAA CATGATCGGAGTTTTTTGAAAAGTGGTACCCTAATGGCGGCAATACTCAA TAGCGGTGTAAATGCATTGAGAGCGCTAGATCTACCTTCCCTCAAAAACT TTTGATGATGAAGCGCCGTTAGACGATAATTTTCAACACTGCAATGGCTT CTTTACGGGTAACAATTCAAAAAAAACTTCGATCAAAGATGACAGATATA GCTTGATCCAGGGATATATAAAGGTTAGTGACCTCTCCCAGCTCCCGGAC TATAAACTGTATCTAATAACTGACCATTGCTACATTCCAGGAACGGCACA AGATCTTGAAAGAGATGGGTATCAGCGTGCAAGATGCCGGTATCGCCGTT GAGAAGGGACGATATTATCTGGTTAACCTGAATGCAGATCCTTCGCTCAA TGAGATGTTGGTTTATTACCTGAAGGTATGTGTTGTCTAATCAATTCTGA TTAACGCCTAATCTTTTTTTGGATTTTCGAGGGTGTAAACACAGTTTTTT TACAAGCATACAAAGATTTAAAAGTTGGCTCTTAGATGCAAGTCTGAAAA TGCTTATATCATAAGCAAAATTATAGCAAAATTTCCGAAAATCTCTAACA TCCCAGCCACAAACAGCCAAAATCAGAAAATACATTTTTCGTAGGCTCAA GGTAATACTTAGCACGTGCTCACATTTTTGTCAAATATGAGCCTAGAGAA GAGAAGGTAAGTGAGAAAGAAGTGAACCCTCCGAATCATCCGGAATGGGC CCTATCCCTGGATAGATACCTACCCTAGGATAGGGAAATTACCACGCTTA CCAGACACTGCTATCCCTGCGCTCGTGACGCGGCAGAATTATTGGTGTAT AGGCGATGATACTCTGAGTGGGATACTTCTTTTCGAGGTCTAAATGTGGA TGAGCGTGTTGCCCTTCTTTCTGAATATATATTAAACATTGTTTCCAATT TCGTTCCCAATAAAATAAATACAATCAGGGATAAGGATGCGTTGTGGATG ACTCCTGAGCGTAAACAAATGCTCCTCGACAAAGCTAAAATTTATCGCCG GTGGAAAAAGCGGGGGGATCCCTTGGATGAACAGGCACTCGATGATATCT CCAGAAGATCTAGACTGGCTATCAAAGAAGCCAAGGAAAACTATTTTACT CGTCTTGGCAATTCTCTCAACGATCCGTACATCGGAAGTAAGAAATACTG GTCTACCCTTAAACAATTCTTAGGCATGCGCAAAACACCAAAAATCCCAC CCATACGTGATAACAGAGACATCCTCGTNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNTTGACGAAGATAAGATTGAGTCTTTAATAAAATCT TTAAACATAAACAAGGCTCATGGATGGGACGATATTTCTACACGTATGGT TAGGATTTGCGGTAAATTTCTAGTCAAACCTTTGTGCAGTATTTTCAATC TTTCAATTCACTTAGGTATCTTCCCTTCCCAGTGGAAGAAAGGAAATGTT GTTCCTGTTTATAAAAAGGGGGACAAAAGCATTGCTAAAAACTACGGACC AGTGTCTCTTCTTCCAGTGTTTAGCAAATTATTTGAAAAGTGCATTTATG ATGTACTTTACAAGTTTTTTTGCAAGCAACAATCTTTTTACTTCGTGCCA GTCAGGTTTTCGGGAGGGTGATTCTTGTGTCTCTCAGTTGTTGTCCATAA CGCATGACATCTTTACAGGGTTTGACACTGATCCACCTTCGGACACGAGG GGAGCGTTTCTTGATATCTCAAAGGCATTTGATTGAGTCTGGCATGAGGG TTTAATTTACAAACTCCAATCCTACGGGGTAACTGGTCCCTTACTTTCCC TTTTGAGAAATTTTCTATTAGGTAGGTATCAGAAGGGAAGGCAGGAGTTC CTCAAGGCTCAATTCTTGGTCCTTTGTTTTTTCTAATCTACATCAACGAC ATTCCTAACAATCTCGAGACCAAGGCTAAAATCTTCGCTGATGACACGTC TTTATTTTCATTAGTGATTGACCAACTTTTGAGCAGTGAGGAATTAAACA GAGATCTTGCAAGAATAAGTGAGTGGGCTCGTCAATGGAAGATGTCTTTT AATCCTGATCCTACAAAACAAGCTGTGGAAGTTTACTTTTCTAAAAAGGC TCTTACCAGCTAATGCTCCTGTTTTATTTTTCAATAATACTGACATAAAA ACTAGTGAATGTCAGAAGCATCTAGGTCTTATCTTGGATTCCAAACTCTC ATTCAGTCACCATTTAGACGAAAAAATAAAAAAGGCCAACAAAGGTATTN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNTTGGCCTCATTAACAGACTTCGCAAACA TGTACCAAGAAAATCTCTGCTTACTTTATACAAATCTTACATTAGACCAC ATTTAGACTATGGGGATATTATATATACGACCATCCTGGAAATTCGACTT TTGTTCGTAAGCATGAATCCGTCCAATATAATGCCTGCCTTGTTATAACA GGCTGCTTTCGTGGAACGTCTCAAGAAAAACTTTGTTCTGAACTTGGTTT CGAGAGTCTTGCTGATCGTCGATTTAGTAGAAGAATGACCTTCTTTTACA AAATTTTAACCAATTTAGCCCCCTCTTATTTACGTAACTACTTACCAGCA AGACTTGCGGCACCGGGTAATCTAAGAACAAGAAATCCTATTTATCAACT TAATATTCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATATTCTGGCTGGTCGTAT AGGAGATATGCCTTCAGTATCTACCTTCAAAAAAGCAATCCTCGAGTTTC TAAGGCCCAAACCTTCTCCTGTTTTTGGAGCTCATGACAACCAGGGTGTG ATCCTTCTCTATCGTCTTCGAGTAGGATTTAGTCACCTCAATGAACATAA ATTTAGACACGGTTTTCGTGACACCTTAGATCCATTTTGTGCGTGTAGAA CAAATTCCATCGAAAACTCTCAACACTTTCTTTTGCACTGCTCTATTTAC TCTCAGGCAAGACATCTTTTGTTCAACAGACTTCTGAACCAAGACATAAA TATTCATCCACTAAGCCCTCCTAAGCTCTTCAACCTTTTGTTGTACGGTG ATCCAGAATTACCTTTCAACATAAATAACATAATAATTAATCTTGTCATT GTTTATTCTCGACTCTGAAAGGTTTAGTGTTGCTTTATTTTAGTTTAATG ATCTCCTTACACAGCTCTAATACTTTTTTTTAACATTTGTGTTTATCCTT TTAGTGATGGTTTTCCCTTTACATTTTTTCTTTTATTCAATAGCTTAGTA CCCTTGGCGATATCACTTAGTGTCTTGCGGGGGGAGGAGCTATTAATTTT TTCTGTGTTTGTTTTTGTAAGTAGTATATGTTCGTAAGTGTAATGTAGCT TCTCAAGTCATATATATAAAAGAAAAAAAAATACTCGAACTACACGGGAG GACATATATCTTCGCAGGTGTTGAACCTATGAGTATCGTCACCACGCCAC ATGCAATGCCTAGCACAGTCTCCATACTCTTTTACCTTTTACCCAGTTCC CCTCACAAGGCATGGGTTGACCCAGGCGAAGGTACACTCACTTGCCAAGT GAATCACAGCACCGAGTGAGAATCCTAGATGTACTTATAATTAATTACAA TGCTTATAAAAAATGTAGAACGTTTTGTTGTTTGAAATTCCAGTCTCAAT AAGTTTTTCCGGATATCTAAATTTTGCTTTCTTACTGAAATTATTATTTT CTTTAACCAGACCATCCATCCCCCCTTATTTCTTAGGACCATACAAAAAT TGGTAAAAGCGACGCATCTGACCCTCAGGTAAGCATACCTTGTTAAACAA AGTTAAATATTAATGATATGACCGGCTAGTAAAGTTTGAAGAACATCAGA GAGTTAATGTATTTTCACTTATGAATAACGCTTAGTTTTGATCCCAAAAA TCGAGGACGGTAAATGAGCTTCTTTACCATCGTCATCAGTCGATCAGGAT CTAGACAAATCAGAACCTAACCTTCTCCATCGCAGAAAAAACACATGCAT CGCTATTATAACACTGAAGGGTTTCACAACTTATTCACTTTTGTAATAAG TCAATAGTAAGACATAGTGGAATAATAATTTTATTTTCAATTTCAATTTC AATTTCAATTTCAATTTTTAATTTTAATTTTAATTTTAATTTTAATTTTA ATTTTAATTTTAATTTTAATTTTAATTTTAATTTTAATTTTAATTTTAAT TTTAATTTTAATTTTTGTTTTTATTTTCACTTTTAATTTCTTCTGAACAG GACATCCAACTAAACGGTTTGGGTTTACAACCACAACATTGCGTGATCGA TATTGATAACGAAGAAGATACATCCTATATCGTCCCTTTTGAAGGGGCTA GGTAAGTTAAGTGTGAACTAACTTTTTCTCCTACTTTGCTCTTGAATGGT TTTGATTTGACATAGTTTGAAGGGGTTAGGTATGCTAAATGCGGACTCTA CTTTTAACAAAACTTCTTTTCTCCTACATGGTTTTTATAAGAACAAACTA TTCATGATATGCACCATTGCAATGTCTTCCGTTCCACCCAATAGCTGATT GGTTGAAAGTGATGTATTGACTGATTTTACGTCACTTCCAACCAATCAGC TATTGGTTCTGTGACGTAATGTCAGAAGACATTGCAGTGGTGCATATCAT GAATATCAGGACATAAGGCTGCGTTGGCCAAAATATTAAAAACAGTTTAA GTTTTTGTACAGTGTCAACAAGAAAATGCTTCAAATTAGTACACTCATAC CTGTGATTTAAAATTAATTAGTAAGCATGCAATTACAACCTGTTTAATCA AACAAAACTTATAATTTTCTCTCTTTATAGAACATGCGTGAACGGTCAAG TGATCACGGAACGCACGCAACTACGACACGGTGACCGTATTCTGTGGGGA AACAATCATTTCTTCAGAATCAATTGTCCCCACTCTCCTCCACCACCAGG TTAAAAAGGCCATAATTTTTAAATTCAAATCAATGGAAATCACACGGGAA ATGTTTCAGTTACTTATTTTCCTATTTATCTTTAAGTCTAAATCAATAAA CCTTTTCAAAATATTGCTATATTGCTTATAAGACTCAAGGGATTAAATCA CTTTGATAATGGCTCCGAAACGAGGCAGTCATTGCACTCAAAGTGATTTA TGAAAATGCCTTGATAGAAATCAAACGGGCAATATTTCAATTACTTATTT TCTTGAAAAAAAGCCTTGTGTCTTGAGATAGTTTAATGTATAGTTTTGTC TTGCTACTGCAATCGGAGACGACCCCAAAGCGCCTCTAAAGCGCCTCTTT CGACCCGAAATGTGCCACTCTTTCCTCCTTGAATTGCTCCACTTATTCGT TTTTTTTAGTTGCAGTATCAAACAGAGAGGCAATAAATGATTTTTTTAAA AATAAGTTTAGAGTTTTTGGTAAAACCTTGTCAGGGGTTGAGCCCACTGC CCTGCGCACCATATTAGGATGCTCTACCTTATCCGCCCGACGAAGCTGTA GCTTTTAGTAGCCAAACAAGTTTTAATCTTTCTACTTTCTTCTATAGGAA CGCAATCAGAAGAAAAATTGGATTTCGATTTCGCACAAAATGAATTGATG CTGAACGAATTTGATTCGCTTGGAGGTATTTAAATTATTCTTTCTTAGAA ATCTTGTGTTCTTTCTGTATTTGAACATCACTCAATTGATAACTTAGACA AAACACACACGTGATGAAAAATCTTCAACAATTATATTACTTTTTGAACA GAATAGCTCAAGCAGCAGTAAGAAGGGGTCTTTTGTTGCTTATAATTTAG CATCAATGTTTTAAAGGATAGCATTTAAATTTATCTACTATCGTTTGCTG ACAGGGCATTTTTAAACAAAAGAAAGAACTTCTTTCACTCCCTCCAATGC CTCGTCAGCACAAAATGTTGTGAAATTCTTCATGCTGCTTTTTCACCATA AGAGGCGTGCTTCATTTCTTTATGTATCATTTCTTTTAAAACTTCGTAAG ATGAAGCCCAAGAACAAAATTCCGTATCGTTAAAAAATTACAAAATCAAC CAAAATATCTGCAAATTATAATAAACCAAAATACACTACAGAAGAAATCG TCAGCGATTGGGTATCAACAGTAGATAATTAATGATTCATTTTGTAAAAC TGGCAGTCGAACTATTAGTTTTAAAATTAGTACAGATTTGTACACATTTT TCGACTATATACATTAACATTTAACCTTTCGTTTTTATTTCACATTTTTA GAACCACTCCAGAATATTATCCAACAACTTGAAAACCAACATGAAAAAGA AAAACAAGGTTTGCATTTCATTTCTAGAGATACAGAGATCCAATATAGGT CCTCATGAGAGTATACTATTTGTTAAATGAATCAAAAGAGGAAATGATAG CTCCCGATAGCTTCTTTTTGTGTTTTCATCCTGTGCAAAAAAAAATTTTG AAATGTGATTGTTGCTCTGACAATGGCCTTGTGATTTAAATTTAAGTGTT TTTAAAACGGAACCTATGTATGGCTGTTCGACGAAAGGCGGTAAAAAAGC CCTTTATTTTGGCTTCGGTTAACGTTATTCGCTTTCTAAGGGTTACTAGC GAGTGCCCCGCAAAGATATCAGCTTTTCTTTTAGAAGAATTTCCGCTCGA CTTTTTTTCTAGAAGCAAAGCTCATATACTGCGCGGGATAAGTCTAGCTT GCTGTCCCCCTTAGCCTGTAGAAAAGCTCCATAGCGCGAATGAAGACTAA AGAAAATTCCTCCTCTGTCGTCGTGATTTATCTATACTTAACCTCATTAT TGTTCTAAAAGATAACCTAAATACATTGACTCTATCTTTCCAGGTGCTCT CGACCAGCAGAAGGAGATGTACGAGCAAAAGCTAGAAGAACTACGGCGCG AGCGAACGCCTGACACAACAAGCGGCCGCACGNCGAGCAAAAGCTAGAAG AACTACGGCGCGAGCGAACGCCTGACACAACAAGTGGCCGCACGAGTTCA GGGTACAATTCAGAAGATCGGGTTTTGAACTCAACGCCGACCTCCTTTTA TGACAGGTAAGATATTTATTACCATGAATTTTTAATTTCACAGAAATCTA TGCTTTACCTTCATCAAAATAGTTTGGAATAATAATTTCAGTTTCAATTA ATCAAAGGTTAAGTTCATATAAAGTAAGAATCATTGTCATTGTCAGATGC GGTATTTTAGAATTGTGAATTTTCCATATGTAAAATGTTTTAGTTTTGGG CTTAACTTTAATAGGGGAAACACTTCTTTACTTCAATTCTATTCTTTCAC AGCCAACTTTTGTATGAAGAGAGTTTACGTCGCCTGCGTGAAGAAGTGAT CCGCGCAAACGTTTTGGTGCGCGAGGCCAATCAGTTGAGCTCTGAAATGA AAAAGGACGCTGATTTCGCTGTCACGCTTCAGGTAAGATTTTGATTTTAA TTCTTATTGTTTGTCAATATTGTGTATCCTTTCTCCACCTTACACTTATT TACTTGCTTAGATGCTCAGGCCTGCAGGCCCCTTGCTCTTCATGACCAGG GCTTTCCAATCATGACGGTCCATGGTAGGTTCTTCTAGTTGAGCCAGTGC AGAACCAGTATCAACATTCATTTGGTCTTTCCATTATTTTGGAGGTCTTC CATGCGGTCTGGGGTTTGTGAAGTTGTCTTTGAATGCAATTTTGAAAGGA TTATCCAGGTCTCTGCGGATGATATGGCCAGAGCAGGAGAGACGTCTCTT TCTAACGATGTCAACGACGGGGGTGGTGACTCCAAGCCGCCTTACACTAA AAGCTGTATAACAATTACATATACATGGCTCTAAACATAACTCGAACCGT AATAAATAACGCTCAAAATGATTTTCCAGAGTAAGCAAGTTAGTAGGCTG CGTCATATCTTCCTTCGTTTCGAGCGTAAAACTCCTACTCTTCGGCATAT GCTCACTGCTCTTGTTCGCATACGCACTGAGGTTTTGATAAAACAATAGA GAGTTTCGAAACCTAAGCCAATCAGCTGTGTTTTAAACATTCTTTTGTTA AATAAAAACTTCTATCATGTTTAATCCTATTGATAGGTGAATTCCCGGTG GGGGTCACGAGTGGTGGCCGCCTATAGACCAAGAGTAAGGCCTAAAAGCC TACTGCTTTCTATAGACGATATCGGCTTTACATGAAAACTCAGATTTAAC CCCCGAGAATTGCCCACAATGCTTTGCTTCGAAAAAAGTTTACGATGAAA TTCTTTCCACGCAAAGCATTGTGGGTAATTCTGGTATACTTTCCCTTTTT ATTAATTGACGCTCGTGAATTACTTGAATGACTTGGTTTTCTGTAACTTA CATTTCATCTTCAAACGCTAAATATTTTATTAAAAAGTGGTTGATTTCAT TCTTTTCCTAGATCCCAACAGCTACACTATCACAAGCCGCCAGTCAAGGG CCGTTGACAAGCGAAGTAGCGGTCGTAGTGAAACACAAAACGCGTGGCAC ACAAGGTCGGTAGTAATTCTCGCCAAAATAATTTTCACATTTTTTTTAAA AGTTATAATGCTAACATTTAATTTTGATCTAAAAGGAAGCTTATCTGGCA CCCGATGCAGAAATTTTCATTCGACACGCTAAAGCTCTTAAGGTCAAAAA AGTTTTCAAGATCTGGAAGGTTTAGATTACGGAATTTCGCGACCGCGCGT TAAGTAATTTGCAGCGGGAGGTCTGGTAACCCAGCCTTCGTTTTCGGGGA TTGGCGGGTCCAACTGAAATATTTTTAGCTTCATGCACAAGGGTAGTTGA ACCCGACTGGGGATGAGGCACATCAAAGGCTGACTATCATTCCTCTCCTC TCCGGCAAATTGGCTAGCTCCTTGAACGTGGGTGGCTGCCAATCCGCCAT CGGAATATCAGGCAAATTTCCCCTCGTAGAGGAATGATAGTAGATCTAAG GTTACGCATCCCTTGTCGAGTTCAAATGCTATTATCATGAAAGTATTTCG GTTGGATCCGCCAATCACACCAAAAACGTGGGTTGGTTCTGGCAAAATTC TGTAATCCAAATCTTTCAAATGTTGAATACTTCCCTGACATTCAGAGCTT TTGTTTTTAACAAGAGTCTTTTTAGTGATATTTACTACCACACCCTTGTA CTCAAGTTCAAAAGATATGACAATCCATTTGTATTGGAAATTGCTTTAAT TTCTGTAATTCTTTTTTCGACAGTTTGGTCTGTGGACAAGCTTGGTAATA AAATTTATGACATGCGAGATGCTTATCAAACCATCACAGAAAACCCACTA GAGGCTAACCTGGTAAGTTTACTTGTCTGTCGTGTCTTCATAATTCGATT CCAAACCCCTCAGTTTTTCATTATGATTATTTATAAGGGGAGGGGAAGGT TATATCAACTTGTCATACAATGTGTCCCGAAAAAAGTGAACAAATTTTTA TATAAAGTATAATGCAAAATTTTTTGACTTAATTAAGTTACATATTAAAG CTTAATATACTTAATATTTTAATTTTAAAAACTTATTCAATCATCTTGAC AAATGGTGTATTGGACTGTCCCATTAAAAATTCATACGGGGTAGACGAAC CTCATCAATCGAGAAAAGAAATCTTGGTAATGTGTGGATACCCTGGAAAA TCTTTTCATACCTTTAGAATATTGATCACCGATATATTGTGTAAGTAGCC CATAATATTTTAGGCAATACTTTAGTTCGAATTACAGAAAAATTTACAAA AACACAATCATCAACTCTTTAGGACGATACTGATGATGACGGTTTATTTT TCGAAGTGGAATGTCACACTTTGATTGGCGTCGCCACAGTCTGGTTGGAA TGTCTGTATCAAAACGTCCCCTTGGATTATTCAGCTCCGGTCATTAGTCA GCAGGGTGAAGTCTGTGGACGCATGTCTGTTGAGATTAGGAGGATACAAG GTAAGCCAGGCTTCAGGTAGATATTCTTAGGTTCTTGACCTAATAAATTC TGAGGGGGTGGGAAATTTTTCAAAAAGAGAGTAGAGTCGATATTTTACGT GGATGGCCAAGTAACCCAGGACTTTTAGATAGTCTTTAGATTGTCCGGGT GTGGCCGGGTAGCTCAGTCTGTAGAGCATTCGTCTTACAATCCAAGGTTT GTGGGTTCGATCCCCGGTCACCGCCAACTCAGCGGATGGGTAGCTTAGAT TGGGTAATCTTATCTAGGGTAATCTAGGCGGTAAGTTACTAGGAGCTGAG AGAGAGTATGTGTGGCGCTCTACCTCAGCATTCGATCTCCCAGGTCTAGC GCAAATAGAAAAGGGTATAGACTCCCTCACTCCCGGCTCCGCCGACAGCC ACCAGATGAATATACTTACTACTTACTTAGATTGTTTCCACTGAGACCGC CTTTAAAAAAAGTTTGCGTACGTTCTCGAAAAAGTTTTTTTCTGCTTCTT GTTACAGACGAGACGACATCTTTATCACTTGATGGGGACAGTGTCAGCGA TGAAGATGATATCGAAGGATTGGCCATGGGAAGCTCTGTCAAAGTACAGG TAATGAATTTAATTATGTAACTTTCTACAATCATGGACAAAATATTTGAG ACAAAAGGGATTTCCCCGCGAAAATCTTAAACACCACAAATGATTTTTAA AGGCCTTAAACTACAGTTGGAAAGTATGTAGAGTTTAACTCTGAGTGTTA AAATGAGACTTAATATAAGACTTAAGACCTTAGGATCTCAGGATTTAAAA GCTCAAGTTTGCTCCAATAAGGTTTGGAATATAGCCTAGAAGCCACCAAA CCCATTTCGACCATGATTGTAGGTCATATTCACATAAGTTAAAACCACTC ATTTTTCGCACTTGACAGGCTAAATTTCCCATGAGAGTGTGTACAGTTTT GAAGTGGACTAGAGTACGCCATGTTGTTTTCTGATTTTTCATTTTCAAAC CATTCTNAGTGTGTACAGTTTTGAAGTGGACTAGAGTACGCCATGTTGTT TTCTGATTTTTCATCAGTTTTTCGAGCATTCATTTTCAAACCATTCTGAT TCCATGGAAATGAAAAACAACAATGGCAGACTAGTTAAGTCGAATGTGTA ATCTTAACCTGACCTGTTCAGCCAAAAACATTGGAAACCGCGTTGCTTTT TCCTTAAGAATGAAAGTGAAATTCACCCGAAATCTGGATGGAAAACGTTA AAGTGCCCAGCAAACATGGGCAGATTCTCTTACAGGCCTTTAAAGTGCAT ACGTGATAGCGCAGAGTAATCAGAATCTGCTCGGAGATCAGCATGTTATA GTTGTATAATAAAAATATTTTGAATATATTATACTCCTTGGTGCTTTGGT GGTGTTAAAAAGGCAATAAAACCGGTCAATTTTGTTTGCTATTTTCTAGA TTACAATCAAAGAAGCTCATGGTTTACCTCTCTCCCTCTGCAATTACGTG TTTGGTCAATACACTTTTTTCGATCAAGAACTGTCCGTCATCCCGCCCTT GAACGCGGCCGCCTCGCCCGTTACCGCCTCGAAATCTAACTCAATGACCT TTAACAACACAAAAGTAAGTGAACTGTACTGTCAGTGTCTTTCGAATTCA TCGATTTCTTTCTTAGTAGAAATGTCTGTCGTATGTCTAATAATCATGAA GTTAGAGAAATTGAAAATCGGGATAAGACCTACCGTACTACAATATAAAC TACCATAATAATACAAAAGCTTTATCTTTTAAAATTTTTTCCCTCGAAAA TCAAATGAAAATAATTCCGCTAAAAATTAAAGTTTCCGAACGACGAACCA AGCTGGCTGGCCGGCCGAAAATGACTATGCGAGAAATCTTTAGTAACTTA TCGGCCCTTTTTACACCGGCCCTTATTGGCGTTATTTTTGGGCTTGTGGC GTAATAAGGGCCGGCGTAAAAAGGGCCGGCGTAAAAAGGGCCGATAAGGT AGATAAATTACCGGCTTAGTTTTGTCTTTTTTCTAAAGTGGCTGTACCGC AGCACTATTCGAATTTTTGTCATTTTGGCGCGTTTGATTGTTCAGGTAGG TTTTCATTTTTTTCCTGGGATAGAAATTTCAGAACCCAAACAATCTATTT TATTTCCTTTTTCCTTTCCTCTCAGACATTCACTGTCGAAGTTGACGAAG ATTTTTTAGATTACGTCACTGACGGTTCATTGGCTATTGAAGTTTACGGT AACCGAAGTAGAGGATATGACACCAAACCAGCTCCGTTGCAATTGCCTCA GGAAATGGATAATAGTAAATCACTTGTCGACAGGTTAGTATCCTACAAAT GGGCTTTTCCAGAAAAAAAATTTACCTTCATTGTTGAGGATATTGATTTT TCGAAGTATCGAACCCCCTGGATATCCTACTTTATTAGTAAAGTCCCCCA CCCACCCCCAGATATCCACTCTTAAAAACATACTCAACCCCCTTGATATC CTCTCTAATAAAGATGCTTTTTCCACTTTTGAACAAAAATCGTTAACCCC TTGGATATCCGATATCCTCAACAGGGGGGGGGGGGGCACGGACTATTTCT GGAAAAGCCCAATGCACGTTCATTTTATAGACCCTGTTTTTCGCTCCTGT GGATAAATAGATAGAGATAGGTAAAGTCGATATTTCGTGGATAGCCCGGT AATCTAGGACTTTTAGCCAGCCTTTCGATTGTTTTCACGGAGTCCACGGC CAGTCGGTTCGGCTCTCTATGAACTGAACGGAACATTGGATGGAGCGGGA ATTCGAACCGCAAACCCCTGGTTTGTAACGCTGACGCCTTTGACCACTTA GCTGTCAGCCCCTTAAAAAAACTAGAAACTTTGAGATTTTCAAATATGCT TTTTACAATTTACTTGTTATTTTCGTTTTTATGTTAAAATGTGTCTGTCC TTTCGTATGTTATAAACGCACATATACATATTGGTATACGTTGATGGGCC TTTTAAAACGTACAACATCTGCTAGCTAGGATAGAACCATAAAACTTGTT GCAACGAACGGCTTTAAGGCCGGTCTCTGCTTGTGCGCGCTGCAATCGCA CCTTTTGGCTTAAATCCTTTTTGGTTGGAAAAAAGATTACGTAATAAACA TGTAGCGCGCGCTCGAAAAAAAAAGTTGAACACATTTCAACTTTTTTCAA CCGTTACGTCAGATCGCGCCATTGGACTTGCTTCATTTTTCTTTTGACCA ATAGCGTGGAAGTATTGCTCGAAAAAGCGCGATCGAAGCGCGTGCAAGTG GAGACCGGCCTTTATCAAACGTTGAAATGGTTATTCCCCTAAAACTAAAA TGTTACTGCCGCAAATACCTTCCTTCACTGCAGTAGTACCTCCCCTTAAA GCATCACGCCATTCTAACTTGGTGAAACCTGTTTTCAAGATTAAGGTTGA CTAGATAGTCTTGGTCCCGATAACGTAGAGTTGAGGCTGCTCTTATATCT AGAACTTTAAGACCCCCCTTTCGATTGTTTTCACGGCCAGCTGACTTGAC TTTTTATGAACGGAACAGAACATTGGAACGGGCAGGGATTCAAACCAAGA ACCCCGTGATAGGCGAAAATAATTTCGTTATGATGAACCATATAGATGAA CCCATAGTCTGCGGCCGCGTCAGAAAAAGTTTTTTTTTCACCCGGCCGGT TTCCGGAAACACTACATTTTTTTAATTTTCGCCTAAGGTCATAAATTTGT TAAAATAATATTATTAACACTGGGCCAGGTTTCATTGTTCATTTTGAACT GACTATTTTTGTTTTTCTTTTTTTTTACAATATAGTGAAATGCTTGACCG GGTTAACCAGTACAGAACCAGGTAAAAGATCCGCCAAAAAAACAAGAGAC TAACTTATCATCAAAAACTAAAGAAACATGCTATCAAAAACTAAAAAGAA CTTACTTTAACTAAAGCAAACCAAACTACCATTAAAGATTTAATATTAAT TTCATTCTAAATACTAACAGAATCTTTTTCTCACTAAAAACGAAAAGAGT TTCTTATACCTAGTGAATTTTCAGACATGGTTTGCTGAACTTTAAGTGAT AAATCATAGTCTTGGAGTCCCTTAATAAACATCTTGAAACCAATATCACA AGAATTGAGAAATTTGGAAATTTTCAGGGTGTTACAAAGAAATTTTTGAA AATACGATTTTACAAGTTGTTTCGATAAGAACACAAATATAGAATCACAC GCTTTTTTTATCAGAACCAGTAAATTTTGTCTCAGGCTGGACAGCTCTTA ATTTTTTGAAATTTTCCGGCTTAAATGTTCTTACGATGATGCTCTACGTA GTACTATCTTAATATTTCTAAAATCTGAGGCTTAAAATTGTTTTACCACT TTTCAGCTTCGTGTTCTTATAAAATAGTTCTCATAAAAAAAACTTGTACC TAATAACTTAAGTCAAACTGACTTTCTCGACTAATTTGAACACTTGCTTT TAAACACTGATAAATCACTGACACTAACACAAACACATTTAACATCCACT TTAACATTTATTTCCGCTATGTATTATCCTCCATCTACCTTTACTTTAAT TTTCTGTTTTTTCTTATTCTGTATGTTCTTTGCATGTTCGTATATTCTTA TCTTGGAAATCATTTTTCTGTTACTGCTTCAACCAGATTAATTTTCACGA GATTTTATTTCGCGAGCCAAAAAAATCGCTAAATTTTTTGAATTTTATTT TCGTGAAACAGCACTTTGAAGGGTTTTGCGTGATTTAGCTAAAGATCAGT CGATTTAAGTCACAAGGGTATATAAGCAGGGTTTTTAAGCCGAACATCGT AATTTGATAATTTGGTGTATTTCGCGAGTTAGCAATCTCGCACTATATCG CGTTTTTAATTTTCGCGAAAATGGGAAAAAAATAATGCGAAAATAAATCT CGAGAAGAATAATTCAATTAAAGTATATTACACTGCGCTTTCGAGTCTCA GAGAATTTAGGATGTTATGGTTAGCATGTGTTGTTTTTTCATGACTTACG TGTATAGACCTTTTCATAAATTACGTCACGAACATCGTTTGCCTCGTTTT GAAACTATTCACTGGATTTTATTTAAAACTACTTTCTATATATAAAAAAA TTATTTAATGTCTCAAGAGACGTAATTACCATGGTAACTTTTTGAATACG AGGCACGTGATGTTCGTGACGTAATTTATGAAGAGTTTTATTATTTGCAC GGCTTAACTACGTAAATGTGACAACAGAACGATTTTTAGCATACTGAAAA GTTGTCGTTTGAAAGTTCCCGCATCCATCGTACTCCTTGCCCAGTCTAGA TTTATTCTTCGTTCTAATTTAGATGGAGAGAGTTATCGCGGCAACTCGAA TTATGGGTCGAAATCCACGAGTTGAATGAACAAGGTTTTTACTCGCCTGT CGAGTTACTCCAACGTGAGGGACAAGAGGCCGGCGGTGTGTTTATGTTAC GTCAAGGGTATTCACGCCGTGTCGTGACACAAGTCGTCGTCCCCAAACAT AACAGTCAAGGATCGCAAGGACTTTTGCCAGTTGTTATCGAGTCCATTTC GAACGTTGCTGTTGGAAGTGTCACCGTCCGAAATAAAACACAAAAGGGAC TTGACAGTTATCAAGAACGAGATTTACAGACGTAAGCAATTTGTTTTTTC ATAGACCAGTGGTGCATATCGTATTTCATTAAATAAGCGCCAAGATAGCG TTTTTAATGTTCGATAATATGTGGTACTTAAAGGGTTACTAACTACAACC TTGTCGGATGATCTTTAAGAAAACTAAACTCTTCACAATATTATGGGCTT TTAAAATGGGTGTTACAAAGTTTTGCATTTGCAACGAACCATCCAAGCAG TTGATTGTCTAGTGTATTATGATGTATTATAAAGCTTTTTTCACATGTGC GTAAAATTTTATTTAAGACCTTGAAGGGTGGGGAATTTCCCTAAGCTTAC GTAGTGTTTTAAGGCCTTATGTGGAGTTTTCTTACGTTCAAAAAGTTTTG AACGGAAAGATAAGTCACGTAAAACCCTCTTAATCAACAAAAACTCTACA TAATGTCAGGGAAATTCCTTAAAGACAGCCTTACGAACGATTTTCCGTAA GGTCTTAAATAAAATTTTACGTACATGTTAAAAAAGCTAAAAGCCAACAT GACTTGAATTTTAAGAATCTTCAGTTTTCCATTTGATACAATTTCGATTT GTCATTTTTATTTCATTGATTTCCTATTCTCTACTTTTCAGCTTGCGAGA TCGTTTTTCGAATTCAGTGATGAAAAAGCGAGAATATTTGGATCAACAAA TCCAAGAGATGATAAATAAACCAAGTAATTTCTTTTGTTTTTCGTTTGTT TGTCTCTTCTATTGTTTCTTGCTTGTCCAGAGTTTAATAAGTGATTATAA TTTTCCACTGCTGTGATTGACAATTTTCAGTAGATGATCTAAAAGTGTCA GGCCTAAGCAGCGCGGTTGCTTATGAAAAAATGTTTACTTAATAATAACC TTTCCTCTTCTCTATTATTCTATCAGACAAATCCCAAGAGGACAAAGAAC ACGAGGGAATGTTGATCGACCAATGGGTGTCCTTAACTGAAGAACGAAAC GCCATCTTGTGTCCGAATACTGGAAGTGGCGTGCCTGGTGCTACCAGTGA ATGGTGTGTAACATGTGTCTTTCTCTTCCTATCAGCTCTATCGAGAGCTA TTGGTTTTTGTTGAGTGTATCGAATACCGCGTGATTTGATCTTTTTTCCG AATAATAGTCATTTTCACAAAATTTCGTCTTTGCAAACATTTTAAAATAC CAAAACTTTTTGGTAAAACAAACAAAATAAGCTAAAGAGAGGTCGATTCG CAAAAAAACAAAAAATTGCAAAAAAAAAGGACACTAAGATTTATTAACTT TCGTTAATTTTCCATTTTTAGTTTTGCAATGTTATTGTTATCTAAGTCGA AATATTAATAATTTTCTAGCAAGGATAAATTATGATTAATAAATTCTCTT CATCATGTCTCGATCTTGCTTTCATGAATTATTTCCGAAACAGTAGATTG TTTGATCCTTTCAATTATTTTTCAATTTTCGTTGCCATAGGAACCCGTTA CCGGGAATGGAAACGCACATCCCTGTCATCTTTTTGGACCTGGACGGTAA GTTTGCTGCTTATATCTCCTTATGGTGTCTTTTTACAATTCGTCTGGGAA AGTCCCTCAACAAATTCATGGTTTATACAGCGGAGTCTCTATATCTCGAA CACTCACGAGGAATATTGATTTACTCAAGTTAGGGAAATTTCGAGTTATG GAGTAAGGTTTATAAGATATTGTTAGCTGAAAGGACCATAAAACTTATTC GAGTTAAGGACACATTTGAGTTTTAGAGGTTTGAGTTATGGTGACTCCGC TATTTATCGAGCGGCCATGACGAACATCTCATTACTCAAGTGAATGATCA TATCATTTTGTTTGTTTAATGATTCCCAGAAAATCAACACACCGTATCCT CCGTAATGAACCATATTCACGATATGCATCACTGCAATGTCTTCCGACAT TACATTACGGACCCTCCAACAGCTGATTGGTTGTAACTGACGTCAAATCA GTCAATACTTTCAACCAATCAGCTGTTGGATCCATGAAATATCATGAAAT AGAATGTTATTTTAGCCTCGATATTGAGGAGGTCCTGTTTTCCATACAGG AAGATGCTGGCGCCTGTTGGCCTCAGAAAAGCTGGAAAATCAAGCGAGGG TCAAAGAAATCTTGTGTAAAAGTCCAGTAGATCTCTTAATAATAAAACCA TTATAAATCGGTTATCGATCGTAGATATAATAACTTTTTCCGTCTTTTTT TTCTAGACAACGCATTGAGCGGTTGCNTATAAATCGGTTACCGATTAACT TTTTCCGTCTTTTCTTTTCTAGACAATGCATTGAGCGGGTGTGGAGACAT TGATGCTGAACCAGCCGGTCATCATTCCTTCCTCTCTTTCGAACAATCCG ACTCAATCATTGGTCTCCCGATTATGAAATACGATCAGAAACGGGTCACA GCAACTGCTTCTTGGGATTCGTCTATCCACGATTCTGTATATTTGAACCG GGTGACACAGAATACGGAACGGGTCTACATTATTTTGAAGGTATATTTTG AATAACTTGATTTCGTCGTTTTGCACAAGGTGCCACTTCCTGTACAAAGA TTCTCCTGACTTTTCCGGGGGATCTTTCCACTATTTACCCGGGATAACCG GCATGATTTTGGAAAGGTTTTTTTTCTAAAGGTATGGAAATCTTGTGTTT ACTTGCGAAACTGCCTAAATTTCCGAAGCTCACTTTTCAACTACCCGAAG TCCTGGTCTTCTACCAATGTAAAGTTTTCCGTCGAATCTTAGTGCGGGGA GAGGAATTTTATGCAAAACAACGTTACAGAGAGGGAGGGTTGACTGAAAT GTGTTCGAATTAATCCATTAAGTGTCATTTATCCGTAACTTCAAATGTTC ATATATGTTCTGATTTCGAATGCGCGTAGACACCCCAACTGAGAATGACA ATATGGACCGATTTGTACGTCGCTGAGGCACTCGACCTAATGTTTGATTT GTTTCACACGCACAATATAGATTGATCTTTTTACACTTCCGAAATTTATT CATAATATCGTTATGTAATGTTTTCTACGCGAACACTCCGGCTTTTGGCA ATAGACCTTATCGGAGTTTTTGATTTTCCTAAAAAAGCGATGCATTGTGG GATTGTTTCGAGTGTATTACAATAGAAATCTCTTAGGAATTCCTCGAGGG AATTATATTGTAATACACTCGAAACAATCCCACAATGCATCGCTTTTTTA GAAAAATCAAAAACTCCGATAAGGTCTATAGTGGCAAATTTTGAATAATT TTTCTCTAGCTTGATTTGCCACTATTGGCAAAAACCAGAGCTGTGTTTCC GTAGAAAATATTACGTCATGAATATCATGATGACCTTTTGAAGGAGAAAG ATTAGGCCTCGTATGACTTTTTAGCTTTTTGGACCTACCTAAGGTAGTCC TTTAAATTAACCCTTGTCCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTT CGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCG TCTGTTGCCAGCTTTTCTCGGGATCGGCTCTTTAGTTTTTTCTAATTTTT TGCACAATGATGCAAAATGGCAATGCCCAAAATGTGATGGAGCCCAATTT TCGAAAAAAAATTTTTTCCGGCCGANNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTCTGATTTTTTGC TCAAAGATGCGTATTAACAATGCCCAAAACATGGCCGAGTCCGATTTTTG AGAAAAAAATTTTTCCGGCCGAAAATGCCTGAAATATGCCTGAAATCGCC GTTTTCTGGATTTTCATTGGACTTTTCCATATAATTGGTTGTTATTTCAT TCAAAAACATTATTAATAGCAATGCCCACCATCAAGCATGTTTAAATTTT CAATAAAATTGATTTTTGAAGCCGGAACTTTCTAAAAATCGCCGGAGCAG CCGATTTTTGCCGGAAAAACGGTATTTCTTGAATTTTTTGAGCTGTACTT TATATTTTTTCATGAAATTTTGCACACTGATGCAAAATGTCAATACCTAA ATTGTGACGGAGTGCGATTTTCGAAAAAAAATTATTTCCGGCCGAAAATG CCGCAAATATGCCGGAAAAACTGTTTTTTTGGCATTTTCTCGAGATTTTA TCATTAGTTTTTTCTGATTTTTTGCTCAAAGATGTGTATAAACAATGCCC AAAACATGGCCGAGTCCGATTTTTGAGAAAAAATTTTTTCCGGCGGAAAA TGCCTGAAATATGCCGGAAATCANNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNCCTTATAATTGGTTGTTTTTTCATTCAAAAATATTATTAA TAGCAATGCCCACCATCAAGCATGTTTCAATTTTCAATAAAATTGATTTT TAAAGCCGGAACTATTTCAAAAGTCGCCGGAACAACCTATTTTCGCCGGA AAGACAGTATTTCTTGAATTTCTCGAGCTGTACTTTATATATTTTTTATG AAATTCTGTACACTGATACAATATGACAATACCTTAAATGTGACGGAGCC CGATTTTCGAAAAACATTTTCTTCTGGCCAAAAATGCCGGAAATATGTCG GAAAAACCGGTTTTTTGACTTTTTCTCGAATTTTTAGTTTAAGTTTTTTC TGATTTTTTGCAGAAAGATGCTTATTCGCAATGCTCTAAAAATGGCCGAG TTCGATTTTTGAGAAAAAAATTTTTCCGGTTGAAAATGCCGGAAATCGCC GTTTTTGCAGATTTTCATTGGAATTTTTCCTTATATTTCTNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNTTTTCCTTATATTTCTATGTTTTTCACACGAAAACATTATTGA TAACAATGCTCACCATCAAGCATGATTCAATTGTCAATAAAACTGATTTT TGCGACCACAACTTCCTATTTATTTTTTCCCTACAACCCTTCCCCCCCTA TCAACAATCAATGATGAATTTATTGTGTTGTGTATTTTCGCTAAACGCTA TATTTTCTGACTGATTTTTTTCATTTTTCTTTTCGCATTGCTATCTAACT TTCATCATCAGGTAGGTCCATTCAGCATGTTGCTTGTTACATGTGAAAAA AAAAAACAGTTAAAACGTACACTGTTTTAACCAATGATGTTTCTGATCAA GATCATGACCATGAACTCACTAGTCTGAATTTCTTTCGTACTCATTTATT TAAAGTTATCAGCTGATAATGGTTACTGTTTTCTTTAGCCAATCATATCT TACCATTTATCCCATTTAGTTAACACTACGATTGAGCAGCCCGGCTTTGG TGAACATTGTATTACGGAAACGTATCTGTGTCCGTATGTACAAACGCCCA AGTTTGAAGGACTCCTTAAGGCGGAAGTTTTGGCGTCAAACCAATGTGCC CACCCGTTGTGGCGTACGTTTCGAATTGATCTCGCACATACCAAGGGTAA AGATTTAAATTCAATTCTGAATAATTTTTTTTTGAAATGCTTGAAATCAT TGCTGGTCTTATTTTTCGATGTTTTCTAGATACTAAACGTCATTAACGTC TGTTCGATGTTCGATTATGAACTTGCTTCAAAATTGGAAAAGACCTCGAA CTTTTGTGGAACTAAAAAATTTTTTCGAGTTACAGCGACTTATGTTTATA AATAAGGTTTCTTAAGGGACCAGAAAACTTGTTCGATTTAAACCTTTGAG TTTAAGGGGGATTGAGTTATCGAGACTACTGTATTTTTATGAGAACAAAC TATATAAAGAACAAGTTAAGAACATTTTAAGGCTTTATGAACTCTAAAGC ACCCGATTTTTTAGGAAATTGAACAACAATACTCACAAAATTGTGAAATT AAGAACATTTTTAGGCTTAGAACTTAAAAAGTCAAGAACATCCGAAGGCT TCAAAATTTTTTTATATACTTAAAAAATCGTAAATGGAAATATTACGGTA GCCGATATTCATTTTCTTCTTTTTGTAGCAATCGGGAGAACAGACGGAAG AACGTGAATCACTGGCGCAAAAAGCAGCAGAAGCAATGCATGTCGGGACA GATGGGGAAGAACTCATGGATGGTGAAGCTATCGATAAATATAATAAAGG TATGGTTAGAAAGATGTTATTGTTTAATCATGTCCCAATGTGTTGAGACA GGGAGAGTGTTCAAGTCTTAATTTTAAAGGGGTCTCTACAAAAGTCTTGA TAAAAATCTATTTGAAATATCATAGTGCAACTTATTTCATCAAGAAATTA TTTGGCGACCGCAAAGTTTAATATAATTGCTTCACTGTTGATCCGTAAAA AGAAATTTCTCATCAAAATTAACTTCTTCAGGATCTGTATTGATCTTTTC ATAATTATCTTCTAAAAGATTTTGCATTGTTTTCTTTTTCAGGCAAAATT TAGTAGCCCCATGATCCAACCAAATAGGTTTTACGCCAAAAATCTAAAAA CTGCGTTCCTTGCAAAGTTAGTTCCCTTCAGGCAATTTTACTTATGCTGG AAAATCATGTCCCTTCCAAAAAATACCTAAAATCTATTCTCTAATCTTTT TTCTTCTGATAGGGATTTCACACGTCGAGAATATTTTGAATCTTCACAAA CTTCGTCAAGAAGTCTTGGTCAAAGAGAAGCTGGCAGCTGTTGGAAGGTC CAGTAAATCACTGACCAATCGGAACATGAGAAAATACGCAAGCACACCTA ATCTTTTCAACGCTGTATGAATTTCTGTTTTTCTTACAATTTTCCTTCCG TAAATTTCGAAATTTCGTCTTAAGACGAATACACAGGTTGCAAAATAAAA AGTCTGAGGACAAATCACGCTTTTATATGAAGTTTTTATGTGCTTGTTAC ATGACATTTGTTTCTGATCGGTTCGAATTTATTGACACTAATTAAGTTAT CAGCTGTAAGTTGTAAAGCAAGTAACATGGGAATAAAATCACGTGAACTG TTTGAGTAATCACGTGTTTTGACTGCATTGATATAATTTTGCAGCCCGTG AATTCAGCTAAATTTAGATTCGACTCACCTCCAATAAGTGGACGAATCTA AATGAAGAGATCACGAGAAAGTTCTTCTTTAAATTTGGTAGAGACAGGCT CTACCTTCAAATACCTTCAAATTTTTTTTGACGTCGATCAAATCTATCTA TTTCACAATATCATTCTTTTTTCAGCCGAGTATGTCAAATTTATGGCGAT CACAAGCGTATCCAGTAAGTTGTATTTTTCCATCCACTGCTCATTAAGTG ACATCGTGGAATGTCATAGCAACATCAGCTCTCGGATGTCGGTTATTACA TCTGTCATGAATATCTTCCCTACAAAACAGTTTTTTCATTTCTCGGTGTA ACCTTAAGGGCTGCATATACTACACAATATATTGTCGGGCAATATATTGA GAATATATTGCTGAATGCTGGCAATATATTGAAAGGTGCCCGCAATATAT TGTCAGCTCATTTTGCAATATTCCAACAATATAGGGGGATTGTTTACAGA AAGAAAACTCCTTTTTATAATAGAGCACCTGTTGTTTACTTTGTATGCTA CGGTCCGCAAGCAATATCGTTGAATATGGATCACCAATATATTGTGTAGT CTAAGTAGCTCTTTAGCTTTCCACTGTTGTCATAGTTATAACAAATGCTT CATCTTTCTCTAACTTTTAGTCGAATAGTGATTTGAACAACAGTGAACTT GCACCGTCCAGTGGTCTCAATGGAATGAACGGAGAACTAAACAAGGTATG TATGTTAATGATATACAGTTGAACCTCTCTAATTCGACATACGCTCCACA ATTCGATGATATTGAAAGTCACCGTCAAAAAGAAACTGTCACAAATGACG TTCTATTATTCGATATGCTCCCTTATTCGATAATATTGTATTTGGTGATC ATCTAGCATCTTTTCCATTTTTTCCTCATTTAGAACCGAAGCTCCAGTCG TGCAAGTTCGGCGGGCGATTATTTGCGCGCGCGGCAAACAAACCAACGAG CCAAATCACAAAACAATCGGTATAGCGTCGGCGCATTCAACAGTCCCTCC CAATCCCCGCGTATGGCTTTACGACAATACGATATTGATATTGACGGCGA ATCGGCGGGTCGCACGACACCTCCGCGTGACCGCTTGGTCCCGCGTAATA ACACCACACCTGTGTTACCATCTTTAGTGGAAAGCTCTCCGACAACGACT GAGCCACCACAGATGGAACTATTAACCGCGAAACAGAATTTGAGCCGAAC GAATTCCAAATCGAGTAATGCCGACACTGATGACGATGAGAAACCGACCA TCATTGTCGGTGACGAAGAAATCCCGAGCCCTCGATTAAAAGTCGGTGAT GTTGTCAAGATTACCGAAAACTTGGAAGGGCAAGTCCGATTCTACGGGAA AACTCAATTCGCTGATGGCACTTGGGTCGGAATCGCCTTAACTGTACCCG AAGGTAAGACTATGGTCTATCATTTTCCTAAGAGAGAATTAATGAAATCT TCGAATTTTTACTTATTGGTTCTTTGGTCGATTTTCTACGTTCCTTTTTC CAAAAGACCAGCACCTTCGTTCGTACTTATGATTTTAACACGTACATTAA TAACATCAAAAAGAAAGATGTCGCAGGGTACTAACCTTGATTTTCCGGAA AACTTTGTCTCAGGTACCACAACCCTTTATCAAATTTAGACACCGCCACC CGGCTATGGGTCAGGAAAGTAGCCTGCAACTATCCCCTGTTCAAATCGGC CGTTCCTGAGAAAGGGGTACGTTGCGTCACACTCATTTTTGACTGGGTAC CGCCAGTGTGGACCTATGAGCTCCGCGATCAAAGCAGCATTTGATAGCAC GCATAGAGACGGTTCAATCAGGCATAGACTACGATCTCCGATCGTGGTTG ACAATTTCTCCGGATGGCCCAAACGGGGAAACTAATGATTAAATGTTATT GTTATCTTTTCGTTTTAGGTAAAAACAACGGTACAGTTCAAGGAGTTAGT TATTTCAATTGCGATCCAAATCATGGGTTATTCATACGCGCTGAAAAATT ACTCAAAAGTTGATGACCAAAATGTTATTATGATGATATTGTTGTCTGTC GGTACGTCGCCGTACGTCGCCAATGCTGGAGAAGGTATATAACGGGAATA CGTCGTGACGGTACTCCCGTCGCTAGCCGTTATTTTACAAATTCTTTCCC TTATGACGTTTGTAAAAGAGATATTTTCGATTCCAATTAAATTTCACTTT ATAACTAATTATGTGACTCTATGATGGATATTTAAATCATGATTTTAAAA ATTCTATCGTTGCATTGTTGGAGTATAAATAATAATGTTTTAGGTGCTTT TAAATTGTAAAGAAATGGTTCATCTACCATTTTGATGACGTCATTATTTC TTGGTTTTGTGACGTCATCATTGACAATGTCTCTTATTGGTTAGTTGGTC GTATTAAAATAATACGCGCTTCAAGAGAGAGAGAATAATTTTATTTCTGT ACTGTATAATGTAGTGTTGTTTTATTTTTAAACGAATTTGTTTCATTTTA CTACGATACTTACGTAAGAGACAAATATATATGAATAGGCTAACAAATTT GAATCGGAAGGCGTAAAATCAAGA

Coding sequence (CDS) from alignment at sc0000001:544789..591162-

>TCONS_00000167 ID=TCONS_00000167|Name=TCONS_00000167|organism=Clytia hemisphaerica|type=CDS|length=56400bp|location=Sequence derived from alignment at sc0000001:544789..591162- (Clytia hemisphaerica)
GTAAAAACAACGGTACAGTTCAAGGAGTTAGTTATTTCAATTGCGATCCA
AATCATGGGTTATTCATACGCGCTGAAAAATTACTCAAAAGTTGAAACCG
AAGCTCCAGTCGTGCAAGTTCGGCGGGCGATTATTTGCGCGCGCGGCAAA
CAAACCAACGAGCCAAATCACAAAACAATCGGTATAGCGTCGGCGCATTC
AACAGTCCCTCCCAATCCCCGCGTATGGCTTTACGACAATACGATATTGA
TATTGACGGCGAATCGGCGGGTCGCACGACACCTCCGCGTGACCGCTTGG
TCCCGCGTAATAACACCACACCTGTGTTACCATCTTTAGTGGAAAGCTCT
CCGACAACGACTGAGCCACCACAGATGGAACTATTAACCGCGAAACAGAA
TTTGAGCCGAACGAATTCCAAATCGAGTAATGCCGACACTGATGACGATG
AGAAACCGACCATCATTGTCGGTGACGAAGAAATCCCGAGCCCTCGATTA
AAAGTCGGTGATGTTGTCAAGATTACCGAAAACTTGGAAGGGCAAGTCCG
ATTCTACGGGAAAACTCAATTCGCTGATGGCACTTGGGTCGGAATCGCCT
TAACTGTACCCGAAGTCGAATAGTGATTTGAACAACAGTGAACTTGCACC
GTCCAGTGGTCTCAATGGAATGAACGGAGAACTAAACAAGCCGAGTATGT
CAAATTTATGGCGATCACAAGCGTATCCAGGATTTCACACGTCGAGAATA
TTTTGAATCTTCACAAACTTCGTCAAGAAGTCTTGGTCAAAGAGAAGCTG
GCAGCTGTTGGAAGGTCCAGTAAATCACTGACCAATCGGAACATGAGAAA
ATACGCAAGCACACCTAATCTTTTCAACGCTCAATCGGGAGAACAGACGG
AAGAACGTGAATCACTGGCGCAAAAAGCAGCAGAAGCAATGCATGTCGGG
ACAGATGGGGAAGAACTCATGGATGGTGAAGCTATCGATAAATATAATAA
AGTTAACACTACGATTGAGCAGCCCGGCTTTGGTGAACATTGTATTACGG
AAACGTATCTGTGTCCGTATGTACAAACGCCCAAGTTTGAAGGACTCCTT
AAGGCGGAAGTTTTGGCGTCAAACCAATGTGCCCACCCGTTGTGGCGTAC
GTTTCGAATTGATCTCGCACATACCAAGGACAATGCATTGAGCGGGTGTG
GAGACATTGATGCTGAACCAGCCGGTCATCATTCCTTCCTCTCTTTCGAA
CAATCCGACTCAATCATTGGTCTCCCGATTATGAAATACGATCAGAAACG
GGTCACAGCAACTGCTTCTTGGGATTCGTCTATCCACGATTCTGTATATT
TGAACCGGGTGACACAGAATACGGAACGGGTCTACATTATTTTGAAGGAA
CCCGTTACCGGGAATGGAAACGCACATCCCTGTCATCTTTTTGGACCTGG
ACGACAAATCCCAAGAGGACAAAGAACACGAGGGAATGTTGATCGACCAA
TGGGTGTCCTTAACTGAAGAACGAAACGCCATCTTGTGTCCGAATACTGG
AAGTGGCGTGCCTGGTGCTACCAGTGAATGCTTGCGAGATCGTTTTTCGA
ATTCAGTGATGAAAAAGCGAGAATATTTGGATCAACAAATCCAAGAGATG
ATAAATAAACCAAATGGAGAGAGTTATCGCGGCAACTCGAATTATGGGTC
GAAATCCACGAGTTGAATGAACAAGGTTTTTACTCGCCTGTCGAGTTACT
CCAACGTGAGGGACAAGAGGCCGGCGGTGTGTTTATGTTACGTCAAGGGT
ATTCACGCCGTGTCGTGACACAAGTCGTCGTCCCCAAACATAACAGTCAA
GGATCGCAAGGACTTTTGCCAGTTGTTATCGAGTCCATTTCGAACGTTGC
TGTTGGAAGTGTCACCGTCCGAAATAAAACACAAAAGGGACTTGACAGTT
ATCAAGAACGAGATTTACAGACTGAAATGCTTGACCGGGTTAACCAGTAC
AGAACCAGACATTCACTGTCGAAGTTGACGAAGATTTTTTAGATTACGTC
ACTGACGGTTCATTGGCTATTGAAGTTTACGGTAACCGAAGTAGAGGATA
TGACACCAAACCAGCTCCGTTGCAATTGCCTCAGGAAATGGATAATAGTA
AATCACTTGTCGACAGATTACAATCAAAGAAGCTCATGGTTTACCTCTCT
CCCTCTGCAATTACGTGTTTGGTCAATACACTTTTTTCGATCAAGAACTG
TCCGTCATCCCGCCCTTGAACGCGGCCGCCTCGCCCGTTACCGCCTCGAA
ATCTAACTCAATGACCTTTAACAACACAAAAACGAGACGACATCTTTATC
ACTTGATGGGGACAGTGTCAGCGATGAAGATGATATCGAAGGATTGGCCA
TGGGAAGCTCTGTCAAAGTACAGGACGATACTGATGATGACGGTTTATTT
TTCGAAGTGGAATGTCACACTTTGATTGGCGTCGCCACAGTCTGGTTGGA
ATGTCTGTATCAAAACGTCCCCTTGGATTATTCAGCTCCGGTCATTAGTC
AGCAGGGTGAAGTCTGTGGACGCATGTCTGTTGAGATTAGGAGGATACAA
GTTTGGTCTGTGGACAAGCTTGGTAATAAAATTTATGACATGCGAGATGC
TTATCAAACCATCACAGAAAACCCACTAGAGGCTAACCTGATCCCAACAG
CTACACTATCACAAGCCGCCAGTCAAGGGCCGTTGACAAGCGAAGTAGCG
GTCGTAGTGAAACACAAAACGCGTGGCACACAAGATGAAAAAGGACGCTG
ATTTCGCTGTCACGCTTCAGGTAAAAACAACGGTACAGTTCAAGGAGTTA
GTTATTTCAATTGCGATCCAAATCATGGGTTATTCATACGCGCTGAAAAA
TTACTCAAAAGTTGAAACCGAAGCTCCAGTCGTGCAAGTTCGGCGGGCGA
TTATTTGCGCGCGCGGCAAACAAACCAACGAGCCAAATCACAAAACAATC
GGTATAGCGTCGGCGCATTCAACAGTCCCTCCCAATCCCCGCGTATGGCT
TTACGACAATACGATATTGATATTGACGGCGAATCGGCGGGTCGCACGAC
ACCTCCGCGTGACCGCTTGGTCCCGCGTAATAACACCACACCTGTGTTAC
CATCTTTAGTGGAAAGCTCTCCGACAACGACTGAGCCACCACAGATGGAA
CTATTAACCGCGAAACAGAATTTGAGCCGAACGAATTCCAAATCGAGTAA
TGCCGACACTGATGACGATGAGAAACCGACCATCATTGTCGGTGACGAAG
AAATCCCGAGCCCTCGATTAAAAGTCGGTGATGTTGTCAAGATTACCGAA
AACTTGGAAGGGCAAGTCCGATTCTACGGGAAAACTCAATTCGCTGATGG
CACTTGGGTCGGAATCGCCTTAACTGTACCCGAAGTCGAATAGTGATTTG
AACAACAGTGAACTTGCACCGTCCAGTGGTCTCAATGGAATGAACGGAGA
ACTAAACAAGCCGAGTATGTCAAATTTATGGCGATCACAAGCGTATCCAG
GATTTCACACGTCGAGAATATTTTGAATCTTCACAAACTTCGTCAAGAAG
TCTTGGTCAAAGAGAAGCTGGCAGCTGTTGGAAGGTCCAGTAAATCACTG
ACCAATCGGAACATGAGAAAATACGCAAGCACACCTAATCTTTTCAACGC
TCAATCGGGAGAACAGACGGAAGAACGTGAATCACTGGCGCAAAAAGCAG
CAGAAGCAATGCATGTCGGGACAGATGGGGAAGAACTCATGGATGGTGAA
GCTATCGATAAATATAATAAAGTTAACACTACGATTGAGCAGCCCGGCTT
TGGTGAACATTGTATTACGGAAACGTATCTGTGTCCGTATGTACAAACGC
CCAAGTTTGAAGGACTCCTTAAGGCGGAAGTTTTGGCGTCAAACCAATGT
GCCCACCCGTTGTGGCGTACGTTTCGAATTGATCTCGCACATACCAAGGA
CAATGCATTGAGCGGGTGTGGAGACATTGATGCTGAACCAGCCGGTCATC
ATTCCTTCCTCTCTTTCGAACAATCCGACTCAATCATTGGTCTCCCGATT
ATGAAATACGATCAGAAACGGGTCACAGCAACTGCTTCTTGGGATTCGTC
TATCCACGATTCTGTATATTTGAACCGGGTGACACAGAATACGGAACGGG
TCTACATTATTTTGAAGGAACCCGTTACCGGGAATGGAAACGCACATCCC
TGTCATCTTTTTGGACCTGGACGACAAATCCCAAGAGGACAAAGAACACG
AGGGAATGTTGATCGACCAATGGGTGTCCTTAACTGAAGAACGAAACGCC
ATCTTGTGTCCGAATACTGGAAGTGGCGTGCCTGGTGCTACCAGTGAATG
CTTGCGAGATCGTTTTTCGAATTCAGTGATGAAAAAGCGAGAATATTTGG
ATCAACAAATCCAAGAGATGATAAATAAACCAAATGGAGAGAGTTATCGC
GGCAACTCGAATTATGGGTCGAAATCCACGAGTTGAATGAACAAGGTTTT
TACTCGCCTGTCGAGTTACTCCAACGTGAGGGACAAGAGGCCGGCGGTGT
GTTTATGTTACGTCAAGGGTATTCACGCCGTGTCGTGACACAAGTCGTCG
TCCCCAAACATAACAGTCAAGGATCGCAAGGACTTTTGCCAGTTGTTATC
GAGTCCATTTCGAACGTTGCTGTTGGAAGTGTCACCGTCCGAAATAAAAC
ACAAAAGGGACTTGACAGTTATCAAGAACGAGATTTACAGACTGAAATGC
TTGACCGGGTTAACCAGTACAGAACCAGACATTCACTGTCGAAGTTGACG
AAGATTTTTTAGATTACGTCACTGACGGTTCATTGGCTATTGAAGTTTAC
GGTAACCGAAGTAGAGGATATGACACCAAACCAGCTCCGTTGCAATTGCC
TCAGGAAATGGATAATAGTAAATCACTTGTCGACAGATTACAATCAAAGA
AGCTCATGGTTTACCTCTCTCCCTCTGCAATTACGTGTTTGGTCAATACA
CTTTTTTCGATCAAGAACTGTCCGTCATCCCGCCCTTGAACGCGGCCGCC
TCGCCCGTTACCGCCTCGAAATCTAACTCAATGACCTTTAACAACACAAA
AACGAGACGACATCTTTATCACTTGATGGGGACAGTGTCAGCGATGAAGA
TGATATCGAAGGATTGGCCATGGGAAGCTCTGTCAAAGTACAGGACGATA
CTGATGATGACGGTTTATTTTTCGAAGTGGAATGTCACACTTTGATTGGC
GTCGCCACAGTCTGGTTGGAATGTCTGTATCAAAACGTCCCCTTGGATTA
TTCAGCTCCGGTCATTAGTCAGCAGGGTGAAGTCTGTGGACGCATGTCTG
TTGAGATTAGGAGGATACAAGTTTGGTCTGTGGACAAGCTTGGTAATAAA
ATTTATGACATGCGAGATGCTTATCAAACCATCACAGAAAACCCACTAGA
GGCTAACCTGATCCCAACAGCTACACTATCACAAGCCGCCAGTCAAGGGC
CGTTGACAAGCGAAGTAGCGGTCGTAGTGAAACACAAAACGCGTGGCACA
CAAGATGAAAAAGGACGCTGATTTCGCTGTCACGCTTCAGGTAAAAACAA
CGGTACAGTTCAAGGAGTTAGTTATTTCAATTGCGATCCAAATCATGGGT
TATTCATACGCGCTGAAAAATTACTCAAAAGTTGAAACCGAAGCTCCAGT
CGTGCAAGTTCGGCGGGCGATTATTTGCGCGCGCGGCAAACAAACCAACG
AGCCAAATCACAAAACAATCGGTATAGCGTCGGCGCATTCAACAGTCCCT
CCCAATCCCCGCGTATGGCTTTACGACAATACGATATTGATATTGACGGC
GAATCGGCGGGTCGCACGACACCTCCGCGTGACCGCTTGGTCCCGCGTAA
TAACACCACACCTGTGTTACCATCTTTAGTGGAAAGCTCTCCGACAACGA
CTGAGCCACCACAGATGGAACTATTAACCGCGAAACAGAATTTGAGCCGA
ACGAATTCCAAATCGAGTAATGCCGACACTGATGACGATGAGAAACCGAC
CATCATTGTCGGTGACGAAGAAATCCCGAGCCCTCGATTAAAAGTCGGTG
ATGTTGTCAAGATTACCGAAAACTTGGAAGGGCAAGTCCGATTCTACGGG
AAAACTCAATTCGCTGATGGCACTTGGGTCGGAATCGCCTTAACTGTACC
CGAAGTCGAATAGTGATTTGAACAACAGTGAACTTGCACCGTCCAGTGGT
CTCAATGGAATGAACGGAGAACTAAACAAGCCGAGTATGTCAAATTTATG
GCGATCACAAGCGTATCCAGGATTTCACACGTCGAGAATATTTTGAATCT
TCACAAACTTCGTCAAGAAGTCTTGGTCAAAGAGAAGCTGGCAGCTGTTG
GAAGGTCCAGTAAATCACTGACCAATCGGAACATGAGAAAATACGCAAGC
ACACCTAATCTTTTCAACGCTCAATCGGGAGAACAGACGGAAGAACGTGA
ATCACTGGCGCAAAAAGCAGCAGAAGCAATGCATGTCGGGACAGATGGGG
AAGAACTCATGGATGGTGAAGCTATCGATAAATATAATAAAGTTAACACT
ACGATTGAGCAGCCCGGCTTTGGTGAACATTGTATTACGGAAACGTATCT
GTGTCCGTATGTACAAACGCCCAAGTTTGAAGGACTCCTTAAGGCGGAAG
TTTTGGCGTCAAACCAATGTGCCCACCCGTTGTGGCGTACGTTTCGAATT
GATCTCGCACATACCAAGGACAATGCATTGAGCGGGTGTGGAGACATTGA
TGCTGAACCAGCCGGTCATCATTCCTTCCTCTCTTTCGAACAATCCGACT
CAATCATTGGTCTCCCGATTATGAAATACGATCAGAAACGGGTCACAGCA
ACTGCTTCTTGGGATTCGTCTATCCACGATTCTGTATATTTGAACCGGGT
GACACAGAATACGGAACGGGTCTACATTATTTTGAAGGAACCCGTTACCG
GGAATGGAAACGCACATCCCTGTCATCTTTTTGGACCTGGACGACAAATC
CCAAGAGGACAAAGAACACGAGGGAATGTTGATCGACCAATGGGTGTCCT
TAACTGAAGAACGAAACGCCATCTTGTGTCCGAATACTGGAAGTGGCGTG
CCTGGTGCTACCAGTGAATGCTTGCGAGATCGTTTTTCGAATTCAGTGAT
GAAAAAGCGAGAATATTTGGATCAACAAATCCAAGAGATGATAAATAAAC
CAAATGGAGAGAGTTATCGCGGCAACTCGAATTATGGGTCGAAATCCACG
AGTTGAATGAACAAGGTTTTTACTCGCCTGTCGAGTTACTCCAACGTGAG
GGACAAGAGGCCGGCGGTGTGTTTATGTTACGTCAAGGGTATTCACGCCG
TGTCGTGACACAAGTCGTCGTCCCCAAACATAACAGTCAAGGATCGCAAG
GACTTTTGCCAGTTGTTATCGAGTCCATTTCGAACGTTGCTGTTGGAAGT
GTCACCGTCCGAAATAAAACACAAAAGGGACTTGACAGTTATCAAGAACG
AGATTTACAGACTGAAATGCTTGACCGGGTTAACCAGTACAGAACCAGAC
ATTCACTGTCGAAGTTGACGAAGATTTTTTAGATTACGTCACTGACGGTT
CATTGGCTATTGAAGTTTACGGTAACCGAAGTAGAGGATATGACACCAAA
CCAGCTCCGTTGCAATTGCCTCAGGAAATGGATAATAGTAAATCACTTGT
CGACAGATTACAATCAAAGAAGCTCATGGTTTACCTCTCTCCCTCTGCAA
TTACGTGTTTGGTCAATACACTTTTTTCGATCAAGAACTGTCCGTCATCC
CGCCCTTGAACGCGGCCGCCTCGCCCGTTACCGCCTCGAAATCTAACTCA
ATGACCTTTAACAACACAAAAACGAGACGACATCTTTATCACTTGATGGG
GACAGTGTCAGCGATGAAGATGATATCGAAGGATTGGCCATGGGAAGCTC
TGTCAAAGTACAGGACGATACTGATGATGACGGTTTATTTTTCGAAGTGG
AATGTCACACTTTGATTGGCGTCGCCACAGTCTGGTTGGAATGTCTGTAT
CAAAACGTCCCCTTGGATTATTCAGCTCCGGTCATTAGTCAGCAGGGTGA
AGTCTGTGGACGCATGTCTGTTGAGATTAGGAGGATACAAGTTTGGTCTG
TGGACAAGCTTGGTAATAAAATTTATGACATGCGAGATGCTTATCAAACC
ATCACAGAAAACCCACTAGAGGCTAACCTGATCCCAACAGCTACACTATC
ACAAGCCGCCAGTCAAGGGCCGTTGACAAGCGAAGTAGCGGTCGTAGTGA
AACACAAAACGCGTGGCACACAAGATGAAAAAGGACGCTGATTTCGCTGT
CACGCTTCAGGTAAAAACAACGGTACAGTTCAAGGAGTTAGTTATTTCAA
TTGCGATCCAAATCATGGGTTATTCATACGCGCTGAAAAATTACTCAAAA
GTTGAAACCGAAGCTCCAGTCGTGCAAGTTCGGCGGGCGATTATTTGCGC
GCGCGGCAAACAAACCAACGAGCCAAATCACAAAACAATCGGTATAGCGT
CGGCGCATTCAACAGTCCCTCCCAATCCCCGCGTATGGCTTTACGACAAT
ACGATATTGATATTGACGGCGAATCGGCGGGTCGCACGACACCTCCGCGT
GACCGCTTGGTCCCGCGTAATAACACCACACCTGTGTTACCATCTTTAGT
GGAAAGCTCTCCGACAACGACTGAGCCACCACAGATGGAACTATTAACCG
CGAAACAGAATTTGAGCCGAACGAATTCCAAATCGAGTAATGCCGACACT
GATGACGATGAGAAACCGACCATCATTGTCGGTGACGAAGAAATCCCGAG
CCCTCGATTAAAAGTCGGTGATGTTGTCAAGATTACCGAAAACTTGGAAG
GGCAAGTCCGATTCTACGGGAAAACTCAATTCGCTGATGGCACTTGGGTC
GGAATCGCCTTAACTGTACCCGAAGTCGAATAGTGATTTGAACAACAGTG
AACTTGCACCGTCCAGTGGTCTCAATGGAATGAACGGAGAACTAAACAAG
CCGAGTATGTCAAATTTATGGCGATCACAAGCGTATCCAGGATTTCACAC
GTCGAGAATATTTTGAATCTTCACAAACTTCGTCAAGAAGTCTTGGTCAA
AGAGAAGCTGGCAGCTGTTGGAAGGTCCAGTAAATCACTGACCAATCGGA
ACATGAGAAAATACGCAAGCACACCTAATCTTTTCAACGCTCAATCGGGA
GAACAGACGGAAGAACGTGAATCACTGGCGCAAAAAGCAGCAGAAGCAAT
GCATGTCGGGACAGATGGGGAAGAACTCATGGATGGTGAAGCTATCGATA
AATATAATAAAGTTAACACTACGATTGAGCAGCCCGGCTTTGGTGAACAT
TGTATTACGGAAACGTATCTGTGTCCGTATGTACAAACGCCCAAGTTTGA
AGGACTCCTTAAGGCGGAAGTTTTGGCGTCAAACCAATGTGCCCACCCGT
TGTGGCGTACGTTTCGAATTGATCTCGCACATACCAAGGACAATGCATTG
AGCGGGTGTGGAGACATTGATGCTGAACCAGCCGGTCATCATTCCTTCCT
CTCTTTCGAACAATCCGACTCAATCATTGGTCTCCCGATTATGAAATACG
ATCAGAAACGGGTCACAGCAACTGCTTCTTGGGATTCGTCTATCCACGAT
TCTGTATATTTGAACCGGGTGACACAGAATACGGAACGGGTCTACATTAT
TTTGAAGGAACCCGTTACCGGGAATGGAAACGCACATCCCTGTCATCTTT
TTGGACCTGGACGACAAATCCCAAGAGGACAAAGAACACGAGGGAATGTT
GATCGACCAATGGGTGTCCTTAACTGAAGAACGAAACGCCATCTTGTGTC
CGAATACTGGAAGTGGCGTGCCTGGTGCTACCAGTGAATGCTTGCGAGAT
CGTTTTTCGAATTCAGTGATGAAAAAGCGAGAATATTTGGATCAACAAAT
CCAAGAGATGATAAATAAACCAAATGGAGAGAGTTATCGCGGCAACTCGA
ATTATGGGTCGAAATCCACGAGTTGAATGAACAAGGTTTTTACTCGCCTG
TCGAGTTACTCCAACGTGAGGGACAAGAGGCCGGCGGTGTGTTTATGTTA
CGTCAAGGGTATTCACGCCGTGTCGTGACACAAGTCGTCGTCCCCAAACA
TAACAGTCAAGGATCGCAAGGACTTTTGCCAGTTGTTATCGAGTCCATTT
CGAACGTTGCTGTTGGAAGTGTCACCGTCCGAAATAAAACACAAAAGGGA
CTTGACAGTTATCAAGAACGAGATTTACAGACTGAAATGCTTGACCGGGT
TAACCAGTACAGAACCAGACATTCACTGTCGAAGTTGACGAAGATTTTTT
AGATTACGTCACTGACGGTTCATTGGCTATTGAAGTTTACGGTAACCGAA
GTAGAGGATATGACACCAAACCAGCTCCGTTGCAATTGCCTCAGGAAATG
GATAATAGTAAATCACTTGTCGACAGATTACAATCAAAGAAGCTCATGGT
TTACCTCTCTCCCTCTGCAATTACGTGTTTGGTCAATACACTTTTTTCGA
TCAAGAACTGTCCGTCATCCCGCCCTTGAACGCGGCCGCCTCGCCCGTTA
CCGCCTCGAAATCTAACTCAATGACCTTTAACAACACAAAAACGAGACGA
CATCTTTATCACTTGATGGGGACAGTGTCAGCGATGAAGATGATATCGAA
GGATTGGCCATGGGAAGCTCTGTCAAAGTACAGGACGATACTGATGATGA
CGGTTTATTTTTCGAAGTGGAATGTCACACTTTGATTGGCGTCGCCACAG
TCTGGTTGGAATGTCTGTATCAAAACGTCCCCTTGGATTATTCAGCTCCG
GTCATTAGTCAGCAGGGTGAAGTCTGTGGACGCATGTCTGTTGAGATTAG
GAGGATACAAGTTTGGTCTGTGGACAAGCTTGGTAATAAAATTTATGACA
TGCGAGATGCTTATCAAACCATCACAGAAAACCCACTAGAGGCTAACCTG
ATCCCAACAGCTACACTATCACAAGCCGCCAGTCAAGGGCCGTTGACAAG
CGAAGTAGCGGTCGTAGTGAAACACAAAACGCGTGGCACACAAGATGAAA
AAGGACGCTGATTTCGCTGTCACGCTTCAGGTAAAAACAACGGTACAGTT
CAAGGAGTTAGTTATTTCAATTGCGATCCAAATCATGGGTTATTCATACG
CGCTGAAAAATTACTCAAAAGTTGAAACCGAAGCTCCAGTCGTGCAAGTT
CGGCGGGCGATTATTTGCGCGCGCGGCAAACAAACCAACGAGCCAAATCA
CAAAACAATCGGTATAGCGTCGGCGCATTCAACAGTCCCTCCCAATCCCC
GCGTATGGCTTTACGACAATACGATATTGATATTGACGGCGAATCGGCGG
GTCGCACGACACCTCCGCGTGACCGCTTGGTCCCGCGTAATAACACCACA
CCTGTGTTACCATCTTTAGTGGAAAGCTCTCCGACAACGACTGAGCCACC
ACAGATGGAACTATTAACCGCGAAACAGAATTTGAGCCGAACGAATTCCA
AATCGAGTAATGCCGACACTGATGACGATGAGAAACCGACCATCATTGTC
GGTGACGAAGAAATCCCGAGCCCTCGATTAAAAGTCGGTGATGTTGTCAA
GATTACCGAAAACTTGGAAGGGCAAGTCCGATTCTACGGGAAAACTCAAT
TCGCTGATGGCACTTGGGTCGGAATCGCCTTAACTGTACCCGAAGTCGAA
TAGTGATTTGAACAACAGTGAACTTGCACCGTCCAGTGGTCTCAATGGAA
TGAACGGAGAACTAAACAAGCCGAGTATGTCAAATTTATGGCGATCACAA
GCGTATCCAGGATTTCACACGTCGAGAATATTTTGAATCTTCACAAACTT
CGTCAAGAAGTCTTGGTCAAAGAGAAGCTGGCAGCTGTTGGAAGGTCCAG
TAAATCACTGACCAATCGGAACATGAGAAAATACGCAAGCACACCTAATC
TTTTCAACGCTCAATCGGGAGAACAGACGGAAGAACGTGAATCACTGGCG
CAAAAAGCAGCAGAAGCAATGCATGTCGGGACAGATGGGGAAGAACTCAT
GGATGGTGAAGCTATCGATAAATATAATAAAGTTAACACTACGATTGAGC
AGCCCGGCTTTGGTGAACATTGTATTACGGAAACGTATCTGTGTCCGTAT
GTACAAACGCCCAAGTTTGAAGGACTCCTTAAGGCGGAAGTTTTGGCGTC
AAACCAATGTGCCCACCCGTTGTGGCGTACGTTTCGAATTGATCTCGCAC
ATACCAAGGACAATGCATTGAGCGGGTGTGGAGACATTGATGCTGAACCA
GCCGGTCATCATTCCTTCCTCTCTTTCGAACAATCCGACTCAATCATTGG
TCTCCCGATTATGAAATACGATCAGAAACGGGTCACAGCAACTGCTTCTT
GGGATTCGTCTATCCACGATTCTGTATATTTGAACCGGGTGACACAGAAT
ACGGAACGGGTCTACATTATTTTGAAGGAACCCGTTACCGGGAATGGAAA
CGCACATCCCTGTCATCTTTTTGGACCTGGACGACAAATCCCAAGAGGAC
AAAGAACACGAGGGAATGTTGATCGACCAATGGGTGTCCTTAACTGAAGA
ACGAAACGCCATCTTGTGTCCGAATACTGGAAGTGGCGTGCCTGGTGCTA
CCAGTGAATGCTTGCGAGATCGTTTTTCGAATTCAGTGATGAAAAAGCGA
GAATATTTGGATCAACAAATCCAAGAGATGATAAATAAACCAAATGGAGA
GAGTTATCGCGGCAACTCGAATTATGGGTCGAAATCCACGAGTTGAATGA
ACAAGGTTTTTACTCGCCTGTCGAGTTACTCCAACGTGAGGGACAAGAGG
CCGGCGGTGTGTTTATGTTACGTCAAGGGTATTCACGCCGTGTCGTGACA
CAAGTCGTCGTCCCCAAACATAACAGTCAAGGATCGCAAGGACTTTTGCC
AGTTGTTATCGAGTCCATTTCGAACGTTGCTGTTGGAAGTGTCACCGTCC
GAAATAAAACACAAAAGGGACTTGACAGTTATCAAGAACGAGATTTACAG
ACTGAAATGCTTGACCGGGTTAACCAGTACAGAACCAGACATTCACTGTC
GAAGTTGACGAAGATTTTTTAGATTACGTCACTGACGGTTCATTGGCTAT
TGAAGTTTACGGTAACCGAAGTAGAGGATATGACACCAAACCAGCTCCGT
TGCAATTGCCTCAGGAAATGGATAATAGTAAATCACTTGTCGACAGATTA
CAATCAAAGAAGCTCATGGTTTACCTCTCTCCCTCTGCAATTACGTGTTT
GGTCAATACACTTTTTTCGATCAAGAACTGTCCGTCATCCCGCCCTTGAA
CGCGGCCGCCTCGCCCGTTACCGCCTCGAAATCTAACTCAATGACCTTTA
ACAACACAAAAACGAGACGACATCTTTATCACTTGATGGGGACAGTGTCA
GCGATGAAGATGATATCGAAGGATTGGCCATGGGAAGCTCTGTCAAAGTA
CAGGACGATACTGATGATGACGGTTTATTTTTCGAAGTGGAATGTCACAC
TTTGATTGGCGTCGCCACAGTCTGGTTGGAATGTCTGTATCAAAACGTCC
CCTTGGATTATTCAGCTCCGGTCATTAGTCAGCAGGGTGAAGTCTGTGGA
CGCATGTCTGTTGAGATTAGGAGGATACAAGTTTGGTCTGTGGACAAGCT
TGGTAATAAAATTTATGACATGCGAGATGCTTATCAAACCATCACAGAAA
ACCCACTAGAGGCTAACCTGATCCCAACAGCTACACTATCACAAGCCGCC
AGTCAAGGGCCGTTGACAAGCGAAGTAGCGGTCGTAGTGAAACACAAAAC
GCGTGGCACACAAGATGAAAAAGGACGCTGATTTCGCTGTCACGCTTCAG
GTAAAAACAACGGTACAGTTCAAGGAGTTAGTTATTTCAATTGCGATCCA
AATCATGGGTTATTCATACGCGCTGAAAAATTACTCAAAAGTTGAAACCG
AAGCTCCAGTCGTGCAAGTTCGGCGGGCGATTATTTGCGCGCGCGGCAAA
CAAACCAACGAGCCAAATCACAAAACAATCGGTATAGCGTCGGCGCATTC
AACAGTCCCTCCCAATCCCCGCGTATGGCTTTACGACAATACGATATTGA
TATTGACGGCGAATCGGCGGGTCGCACGACACCTCCGCGTGACCGCTTGG
TCCCGCGTAATAACACCACACCTGTGTTACCATCTTTAGTGGAAAGCTCT
CCGACAACGACTGAGCCACCACAGATGGAACTATTAACCGCGAAACAGAA
TTTGAGCCGAACGAATTCCAAATCGAGTAATGCCGACACTGATGACGATG
AGAAACCGACCATCATTGTCGGTGACGAAGAAATCCCGAGCCCTCGATTA
AAAGTCGGTGATGTTGTCAAGATTACCGAAAACTTGGAAGGGCAAGTCCG
ATTCTACGGGAAAACTCAATTCGCTGATGGCACTTGGGTCGGAATCGCCT
TAACTGTACCCGAAGTCGAATAGTGATTTGAACAACAGTGAACTTGCACC
GTCCAGTGGTCTCAATGGAATGAACGGAGAACTAAACAAGCCGAGTATGT
CAAATTTATGGCGATCACAAGCGTATCCAGGATTTCACACGTCGAGAATA
TTTTGAATCTTCACAAACTTCGTCAAGAAGTCTTGGTCAAAGAGAAGCTG
GCAGCTGTTGGAAGGTCCAGTAAATCACTGACCAATCGGAACATGAGAAA
ATACGCAAGCACACCTAATCTTTTCAACGCTCAATCGGGAGAACAGACGG
AAGAACGTGAATCACTGGCGCAAAAAGCAGCAGAAGCAATGCATGTCGGG
ACAGATGGGGAAGAACTCATGGATGGTGAAGCTATCGATAAATATAATAA
AGTTAACACTACGATTGAGCAGCCCGGCTTTGGTGAACATTGTATTACGG
AAACGTATCTGTGTCCGTATGTACAAACGCCCAAGTTTGAAGGACTCCTT
AAGGCGGAAGTTTTGGCGTCAAACCAATGTGCCCACCCGTTGTGGCGTAC
GTTTCGAATTGATCTCGCACATACCAAGGACAATGCATTGAGCGGGTGTG
GAGACATTGATGCTGAACCAGCCGGTCATCATTCCTTCCTCTCTTTCGAA
CAATCCGACTCAATCATTGGTCTCCCGATTATGAAATACGATCAGAAACG
GGTCACAGCAACTGCTTCTTGGGATTCGTCTATCCACGATTCTGTATATT
TGAACCGGGTGACACAGAATACGGAACGGGTCTACATTATTTTGAAGGAA
CCCGTTACCGGGAATGGAAACGCACATCCCTGTCATCTTTTTGGACCTGG
ACGACAAATCCCAAGAGGACAAAGAACACGAGGGAATGTTGATCGACCAA
TGGGTGTCCTTAACTGAAGAACGAAACGCCATCTTGTGTCCGAATACTGG
AAGTGGCGTGCCTGGTGCTACCAGTGAATGCTTGCGAGATCGTTTTTCGA
ATTCAGTGATGAAAAAGCGAGAATATTTGGATCAACAAATCCAAGAGATG
ATAAATAAACCAAATGGAGAGAGTTATCGCGGCAACTCGAATTATGGGTC
GAAATCCACGAGTTGAATGAACAAGGTTTTTACTCGCCTGTCGAGTTACT
CCAACGTGAGGGACAAGAGGCCGGCGGTGTGTTTATGTTACGTCAAGGGT
ATTCACGCCGTGTCGTGACACAAGTCGTCGTCCCCAAACATAACAGTCAA
GGATCGCAAGGACTTTTGCCAGTTGTTATCGAGTCCATTTCGAACGTTGC
TGTTGGAAGTGTCACCGTCCGAAATAAAACACAAAAGGGACTTGACAGTT
ATCAAGAACGAGATTTACAGACTGAAATGCTTGACCGGGTTAACCAGTAC
AGAACCAGACATTCACTGTCGAAGTTGACGAAGATTTTTTAGATTACGTC
ACTGACGGTTCATTGGCTATTGAAGTTTACGGTAACCGAAGTAGAGGATA
TGACACCAAACCAGCTCCGTTGCAATTGCCTCAGGAAATGGATAATAGTA
AATCACTTGTCGACAGATTACAATCAAAGAAGCTCATGGTTTACCTCTCT
CCCTCTGCAATTACGTGTTTGGTCAATACACTTTTTTCGATCAAGAACTG
TCCGTCATCCCGCCCTTGAACGCGGCCGCCTCGCCCGTTACCGCCTCGAA
ATCTAACTCAATGACCTTTAACAACACAAAAACGAGACGACATCTTTATC
ACTTGATGGGGACAGTGTCAGCGATGAAGATGATATCGAAGGATTGGCCA
TGGGAAGCTCTGTCAAAGTACAGGACGATACTGATGATGACGGTTTATTT
TTCGAAGTGGAATGTCACACTTTGATTGGCGTCGCCACAGTCTGGTTGGA
ATGTCTGTATCAAAACGTCCCCTTGGATTATTCAGCTCCGGTCATTAGTC
AGCAGGGTGAAGTCTGTGGACGCATGTCTGTTGAGATTAGGAGGATACAA
GTTTGGTCTGTGGACAAGCTTGGTAATAAAATTTATGACATGCGAGATGC
TTATCAAACCATCACAGAAAACCCACTAGAGGCTAACCTGATCCCAACAG
CTACACTATCACAAGCCGCCAGTCAAGGGCCGTTGACAAGCGAAGTAGCG
GTCGTAGTGAAACACAAAACGCGTGGCACACAAGATGAAAAAGGACGCTG
ATTTCGCTGTCACGCTTCAGGTAAAAACAACGGTACAGTTCAAGGAGTTA
GTTATTTCAATTGCGATCCAAATCATGGGTTATTCATACGCGCTGAAAAA
TTACTCAAAAGTTGAAACCGAAGCTCCAGTCGTGCAAGTTCGGCGGGCGA
TTATTTGCGCGCGCGGCAAACAAACCAACGAGCCAAATCACAAAACAATC
GGTATAGCGTCGGCGCATTCAACAGTCCCTCCCAATCCCCGCGTATGGCT
TTACGACAATACGATATTGATATTGACGGCGAATCGGCGGGTCGCACGAC
ACCTCCGCGTGACCGCTTGGTCCCGCGTAATAACACCACACCTGTGTTAC
CATCTTTAGTGGAAAGCTCTCCGACAACGACTGAGCCACCACAGATGGAA
CTATTAACCGCGAAACAGAATTTGAGCCGAACGAATTCCAAATCGAGTAA
TGCCGACACTGATGACGATGAGAAACCGACCATCATTGTCGGTGACGAAG
AAATCCCGAGCCCTCGATTAAAAGTCGGTGATGTTGTCAAGATTACCGAA
AACTTGGAAGGGCAAGTCCGATTCTACGGGAAAACTCAATTCGCTGATGG
CACTTGGGTCGGAATCGCCTTAACTGTACCCGAAGTCGAATAGTGATTTG
AACAACAGTGAACTTGCACCGTCCAGTGGTCTCAATGGAATGAACGGAGA
ACTAAACAAGCCGAGTATGTCAAATTTATGGCGATCACAAGCGTATCCAG
GATTTCACACGTCGAGAATATTTTGAATCTTCACAAACTTCGTCAAGAAG
TCTTGGTCAAAGAGAAGCTGGCAGCTGTTGGAAGGTCCAGTAAATCACTG
ACCAATCGGAACATGAGAAAATACGCAAGCACACCTAATCTTTTCAACGC
TCAATCGGGAGAACAGACGGAAGAACGTGAATCACTGGCGCAAAAAGCAG
CAGAAGCAATGCATGTCGGGACAGATGGGGAAGAACTCATGGATGGTGAA
GCTATCGATAAATATAATAAAGTTAACACTACGATTGAGCAGCCCGGCTT
TGGTGAACATTGTATTACGGAAACGTATCTGTGTCCGTATGTACAAACGC
CCAAGTTTGAAGGACTCCTTAAGGCGGAAGTTTTGGCGTCAAACCAATGT
GCCCACCCGTTGTGGCGTACGTTTCGAATTGATCTCGCACATACCAAGGA
CAATGCATTGAGCGGGTGTGGAGACATTGATGCTGAACCAGCCGGTCATC
ATTCCTTCCTCTCTTTCGAACAATCCGACTCAATCATTGGTCTCCCGATT
ATGAAATACGATCAGAAACGGGTCACAGCAACTGCTTCTTGGGATTCGTC
TATCCACGATTCTGTATATTTGAACCGGGTGACACAGAATACGGAACGGG
TCTACATTATTTTGAAGGAACCCGTTACCGGGAATGGAAACGCACATCCC
TGTCATCTTTTTGGACCTGGACGACAAATCCCAAGAGGACAAAGAACACG
AGGGAATGTTGATCGACCAATGGGTGTCCTTAACTGAAGAACGAAACGCC
ATCTTGTGTCCGAATACTGGAAGTGGCGTGCCTGGTGCTACCAGTGAATG
CTTGCGAGATCGTTTTTCGAATTCAGTGATGAAAAAGCGAGAATATTTGG
ATCAACAAATCCAAGAGATGATAAATAAACCAAATGGAGAGAGTTATCGC
GGCAACTCGAATTATGGGTCGAAATCCACGAGTTGAATGAACAAGGTTTT
TACTCGCCTGTCGAGTTACTCCAACGTGAGGGACAAGAGGCCGGCGGTGT
GTTTATGTTACGTCAAGGGTATTCACGCCGTGTCGTGACACAAGTCGTCG
TCCCCAAACATAACAGTCAAGGATCGCAAGGACTTTTGCCAGTTGTTATC
GAGTCCATTTCGAACGTTGCTGTTGGAAGTGTCACCGTCCGAAATAAAAC
ACAAAAGGGACTTGACAGTTATCAAGAACGAGATTTACAGACTGAAATGC
TTGACCGGGTTAACCAGTACAGAACCAGACATTCACTGTCGAAGTTGACG
AAGATTTTTTAGATTACGTCACTGACGGTTCATTGGCTATTGAAGTTTAC
GGTAACCGAAGTAGAGGATATGACACCAAACCAGCTCCGTTGCAATTGCC
TCAGGAAATGGATAATAGTAAATCACTTGTCGACAGATTACAATCAAAGA
AGCTCATGGTTTACCTCTCTCCCTCTGCAATTACGTGTTTGGTCAATACA
CTTTTTTCGATCAAGAACTGTCCGTCATCCCGCCCTTGAACGCGGCCGCC
TCGCCCGTTACCGCCTCGAAATCTAACTCAATGACCTTTAACAACACAAA
AACGAGACGACATCTTTATCACTTGATGGGGACAGTGTCAGCGATGAAGA
TGATATCGAAGGATTGGCCATGGGAAGCTCTGTCAAAGTACAGGACGATA
CTGATGATGACGGTTTATTTTTCGAAGTGGAATGTCACACTTTGATTGGC
GTCGCCACAGTCTGGTTGGAATGTCTGTATCAAAACGTCCCCTTGGATTA
TTCAGCTCCGGTCATTAGTCAGCAGGGTGAAGTCTGTGGACGCATGTCTG
TTGAGATTAGGAGGATACAAGTTTGGTCTGTGGACAAGCTTGGTAATAAA
ATTTATGACATGCGAGATGCTTATCAAACCATCACAGAAAACCCACTAGA
GGCTAACCTGATCCCAACAGCTACACTATCACAAGCCGCCAGTCAAGGGC
CGTTGACAAGCGAAGTAGCGGTCGTAGTGAAACACAAAACGCGTGGCACA
CAAGATGAAAAAGGACGCTGATTTCGCTGTCACGCTTCAGGTAAAAACAA
CGGTACAGTTCAAGGAGTTAGTTATTTCAATTGCGATCCAAATCATGGGT
TATTCATACGCGCTGAAAAATTACTCAAAAGTTGAAACCGAAGCTCCAGT
CGTGCAAGTTCGGCGGGCGATTATTTGCGCGCGCGGCAAACAAACCAACG
AGCCAAATCACAAAACAATCGGTATAGCGTCGGCGCATTCAACAGTCCCT
CCCAATCCCCGCGTATGGCTTTACGACAATACGATATTGATATTGACGGC
GAATCGGCGGGTCGCACGACACCTCCGCGTGACCGCTTGGTCCCGCGTAA
TAACACCACACCTGTGTTACCATCTTTAGTGGAAAGCTCTCCGACAACGA
CTGAGCCACCACAGATGGAACTATTAACCGCGAAACAGAATTTGAGCCGA
ACGAATTCCAAATCGAGTAATGCCGACACTGATGACGATGAGAAACCGAC
CATCATTGTCGGTGACGAAGAAATCCCGAGCCCTCGATTAAAAGTCGGTG
ATGTTGTCAAGATTACCGAAAACTTGGAAGGGCAAGTCCGATTCTACGGG
AAAACTCAATTCGCTGATGGCACTTGGGTCGGAATCGCCTTAACTGTACC
CGAAGTCGAATAGTGATTTGAACAACAGTGAACTTGCACCGTCCAGTGGT
CTCAATGGAATGAACGGAGAACTAAACAAGCCGAGTATGTCAAATTTATG
GCGATCACAAGCGTATCCAGGATTTCACACGTCGAGAATATTTTGAATCT
TCACAAACTTCGTCAAGAAGTCTTGGTCAAAGAGAAGCTGGCAGCTGTTG
GAAGGTCCAGTAAATCACTGACCAATCGGAACATGAGAAAATACGCAAGC
ACACCTAATCTTTTCAACGCTCAATCGGGAGAACAGACGGAAGAACGTGA
ATCACTGGCGCAAAAAGCAGCAGAAGCAATGCATGTCGGGACAGATGGGG
AAGAACTCATGGATGGTGAAGCTATCGATAAATATAATAAAGTTAACACT
ACGATTGAGCAGCCCGGCTTTGGTGAACATTGTATTACGGAAACGTATCT
GTGTCCGTATGTACAAACGCCCAAGTTTGAAGGACTCCTTAAGGCGGAAG
TTTTGGCGTCAAACCAATGTGCCCACCCGTTGTGGCGTACGTTTCGAATT
GATCTCGCACATACCAAGGACAATGCATTGAGCGGGTGTGGAGACATTGA
TGCTGAACCAGCCGGTCATCATTCCTTCCTCTCTTTCGAACAATCCGACT
CAATCATTGGTCTCCCGATTATGAAATACGATCAGAAACGGGTCACAGCA
ACTGCTTCTTGGGATTCGTCTATCCACGATTCTGTATATTTGAACCGGGT
GACACAGAATACGGAACGGGTCTACATTATTTTGAAGGAACCCGTTACCG
GGAATGGAAACGCACATCCCTGTCATCTTTTTGGACCTGGACGACAAATC
CCAAGAGGACAAAGAACACGAGGGAATGTTGATCGACCAATGGGTGTCCT
TAACTGAAGAACGAAACGCCATCTTGTGTCCGAATACTGGAAGTGGCGTG
CCTGGTGCTACCAGTGAATGCTTGCGAGATCGTTTTTCGAATTCAGTGAT
GAAAAAGCGAGAATATTTGGATCAACAAATCCAAGAGATGATAAATAAAC
CAAATGGAGAGAGTTATCGCGGCAACTCGAATTATGGGTCGAAATCCACG
AGTTGAATGAACAAGGTTTTTACTCGCCTGTCGAGTTACTCCAACGTGAG
GGACAAGAGGCCGGCGGTGTGTTTATGTTACGTCAAGGGTATTCACGCCG
TGTCGTGACACAAGTCGTCGTCCCCAAACATAACAGTCAAGGATCGCAAG
GACTTTTGCCAGTTGTTATCGAGTCCATTTCGAACGTTGCTGTTGGAAGT
GTCACCGTCCGAAATAAAACACAAAAGGGACTTGACAGTTATCAAGAACG
AGATTTACAGACTGAAATGCTTGACCGGGTTAACCAGTACAGAACCAGAC
ATTCACTGTCGAAGTTGACGAAGATTTTTTAGATTACGTCACTGACGGTT
CATTGGCTATTGAAGTTTACGGTAACCGAAGTAGAGGATATGACACCAAA
CCAGCTCCGTTGCAATTGCCTCAGGAAATGGATAATAGTAAATCACTTGT
CGACAGATTACAATCAAAGAAGCTCATGGTTTACCTCTCTCCCTCTGCAA
TTACGTGTTTGGTCAATACACTTTTTTCGATCAAGAACTGTCCGTCATCC
CGCCCTTGAACGCGGCCGCCTCGCCCGTTACCGCCTCGAAATCTAACTCA
ATGACCTTTAACAACACAAAAACGAGACGACATCTTTATCACTTGATGGG
GACAGTGTCAGCGATGAAGATGATATCGAAGGATTGGCCATGGGAAGCTC
TGTCAAAGTACAGGACGATACTGATGATGACGGTTTATTTTTCGAAGTGG
AATGTCACACTTTGATTGGCGTCGCCACAGTCTGGTTGGAATGTCTGTAT
CAAAACGTCCCCTTGGATTATTCAGCTCCGGTCATTAGTCAGCAGGGTGA
AGTCTGTGGACGCATGTCTGTTGAGATTAGGAGGATACAAGTTTGGTCTG
TGGACAAGCTTGGTAATAAAATTTATGACATGCGAGATGCTTATCAAACC
ATCACAGAAAACCCACTAGAGGCTAACCTGATCCCAACAGCTACACTATC
ACAAGCCGCCAGTCAAGGGCCGTTGACAAGCGAAGTAGCGGTCGTAGTGA
AACACAAAACGCGTGGCACACAAGATGAAAAAGGACGCTGATTTCGCTGT
CACGCTTCAGGTAAAAACAACGGTACAGTTCAAGGAGTTAGTTATTTCAA
TTGCGATCCAAATCATGGGTTATTCATACGCGCTGAAAAATTACTCAAAA
GTTGAAACCGAAGCTCCAGTCGTGCAAGTTCGGCGGGCGATTATTTGCGC
GCGCGGCAAACAAACCAACGAGCCAAATCACAAAACAATCGGTATAGCGT
CGGCGCATTCAACAGTCCCTCCCAATCCCCGCGTATGGCTTTACGACAAT
ACGATATTGATATTGACGGCGAATCGGCGGGTCGCACGACACCTCCGCGT
GACCGCTTGGTCCCGCGTAATAACACCACACCTGTGTTACCATCTTTAGT
GGAAAGCTCTCCGACAACGACTGAGCCACCACAGATGGAACTATTAACCG
CGAAACAGAATTTGAGCCGAACGAATTCCAAATCGAGTAATGCCGACACT
GATGACGATGAGAAACCGACCATCATTGTCGGTGACGAAGAAATCCCGAG
CCCTCGATTAAAAGTCGGTGATGTTGTCAAGATTACCGAAAACTTGGAAG
GGCAAGTCCGATTCTACGGGAAAACTCAATTCGCTGATGGCACTTGGGTC
GGAATCGCCTTAACTGTACCCGAAGTCGAATAGTGATTTGAACAACAGTG
AACTTGCACCGTCCAGTGGTCTCAATGGAATGAACGGAGAACTAAACAAG
CCGAGTATGTCAAATTTATGGCGATCACAAGCGTATCCAGGATTTCACAC
GTCGAGAATATTTTGAATCTTCACAAACTTCGTCAAGAAGTCTTGGTCAA
AGAGAAGCTGGCAGCTGTTGGAAGGTCCAGTAAATCACTGACCAATCGGA
ACATGAGAAAATACGCAAGCACACCTAATCTTTTCAACGCTCAATCGGGA
GAACAGACGGAAGAACGTGAATCACTGGCGCAAAAAGCAGCAGAAGCAAT
GCATGTCGGGACAGATGGGGAAGAACTCATGGATGGTGAAGCTATCGATA
AATATAATAAAGTTAACACTACGATTGAGCAGCCCGGCTTTGGTGAACAT
TGTATTACGGAAACGTATCTGTGTCCGTATGTACAAACGCCCAAGTTTGA
AGGACTCCTTAAGGCGGAAGTTTTGGCGTCAAACCAATGTGCCCACCCGT
TGTGGCGTACGTTTCGAATTGATCTCGCACATACCAAGGACAATGCATTG
AGCGGGTGTGGAGACATTGATGCTGAACCAGCCGGTCATCATTCCTTCCT
CTCTTTCGAACAATCCGACTCAATCATTGGTCTCCCGATTATGAAATACG
ATCAGAAACGGGTCACAGCAACTGCTTCTTGGGATTCGTCTATCCACGAT
TCTGTATATTTGAACCGGGTGACACAGAATACGGAACGGGTCTACATTAT
TTTGAAGGAACCCGTTACCGGGAATGGAAACGCACATCCCTGTCATCTTT
TTGGACCTGGACGACAAATCCCAAGAGGACAAAGAACACGAGGGAATGTT
GATCGACCAATGGGTGTCCTTAACTGAAGAACGAAACGCCATCTTGTGTC
CGAATACTGGAAGTGGCGTGCCTGGTGCTACCAGTGAATGCTTGCGAGAT
CGTTTTTCGAATTCAGTGATGAAAAAGCGAGAATATTTGGATCAACAAAT
CCAAGAGATGATAAATAAACCAAATGGAGAGAGTTATCGCGGCAACTCGA
ATTATGGGTCGAAATCCACGAGTTGAATGAACAAGGTTTTTACTCGCCTG
TCGAGTTACTCCAACGTGAGGGACAAGAGGCCGGCGGTGTGTTTATGTTA
CGTCAAGGGTATTCACGCCGTGTCGTGACACAAGTCGTCGTCCCCAAACA
TAACAGTCAAGGATCGCAAGGACTTTTGCCAGTTGTTATCGAGTCCATTT
CGAACGTTGCTGTTGGAAGTGTCACCGTCCGAAATAAAACACAAAAGGGA
CTTGACAGTTATCAAGAACGAGATTTACAGACTGAAATGCTTGACCGGGT
TAACCAGTACAGAACCAGACATTCACTGTCGAAGTTGACGAAGATTTTTT
AGATTACGTCACTGACGGTTCATTGGCTATTGAAGTTTACGGTAACCGAA
GTAGAGGATATGACACCAAACCAGCTCCGTTGCAATTGCCTCAGGAAATG
GATAATAGTAAATCACTTGTCGACAGATTACAATCAAAGAAGCTCATGGT
TTACCTCTCTCCCTCTGCAATTACGTGTTTGGTCAATACACTTTTTTCGA
TCAAGAACTGTCCGTCATCCCGCCCTTGAACGCGGCCGCCTCGCCCGTTA
CCGCCTCGAAATCTAACTCAATGACCTTTAACAACACAAAAACGAGACGA
CATCTTTATCACTTGATGGGGACAGTGTCAGCGATGAAGATGATATCGAA
GGATTGGCCATGGGAAGCTCTGTCAAAGTACAGGACGATACTGATGATGA
CGGTTTATTTTTCGAAGTGGAATGTCACACTTTGATTGGCGTCGCCACAG
TCTGGTTGGAATGTCTGTATCAAAACGTCCCCTTGGATTATTCAGCTCCG
GTCATTAGTCAGCAGGGTGAAGTCTGTGGACGCATGTCTGTTGAGATTAG
GAGGATACAAGTTTGGTCTGTGGACAAGCTTGGTAATAAAATTTATGACA
TGCGAGATGCTTATCAAACCATCACAGAAAACCCACTAGAGGCTAACCTG
ATCCCAACAGCTACACTATCACAAGCCGCCAGTCAAGGGCCGTTGACAAG
CGAAGTAGCGGTCGTAGTGAAACACAAAACGCGTGGCACACAAGATGAAA
AAGGACGCTGATTTCGCTGTCACGCTTCAGGTAAAAACAACGGTACAGTT
CAAGGAGTTAGTTATTTCAATTGCGATCCAAATCATGGGTTATTCATACG
CGCTGAAAAATTACTCAAAAGTTGAAACCGAAGCTCCAGTCGTGCAAGTT
CGGCGGGCGATTATTTGCGCGCGCGGCAAACAAACCAACGAGCCAAATCA
CAAAACAATCGGTATAGCGTCGGCGCATTCAACAGTCCCTCCCAATCCCC
GCGTATGGCTTTACGACAATACGATATTGATATTGACGGCGAATCGGCGG
GTCGCACGACACCTCCGCGTGACCGCTTGGTCCCGCGTAATAACACCACA
CCTGTGTTACCATCTTTAGTGGAAAGCTCTCCGACAACGACTGAGCCACC
ACAGATGGAACTATTAACCGCGAAACAGAATTTGAGCCGAACGAATTCCA
AATCGAGTAATGCCGACACTGATGACGATGAGAAACCGACCATCATTGTC
GGTGACGAAGAAATCCCGAGCCCTCGATTAAAAGTCGGTGATGTTGTCAA
GATTACCGAAAACTTGGAAGGGCAAGTCCGATTCTACGGGAAAACTCAAT
TCGCTGATGGCACTTGGGTCGGAATCGCCTTAACTGTACCCGAAGTCGAA
TAGTGATTTGAACAACAGTGAACTTGCACCGTCCAGTGGTCTCAATGGAA
TGAACGGAGAACTAAACAAGCCGAGTATGTCAAATTTATGGCGATCACAA
GCGTATCCAGGATTTCACACGTCGAGAATATTTTGAATCTTCACAAACTT
CGTCAAGAAGTCTTGGTCAAAGAGAAGCTGGCAGCTGTTGGAAGGTCCAG
TAAATCACTGACCAATCGGAACATGAGAAAATACGCAAGCACACCTAATC
TTTTCAACGCTCAATCGGGAGAACAGACGGAAGAACGTGAATCACTGGCG
CAAAAAGCAGCAGAAGCAATGCATGTCGGGACAGATGGGGAAGAACTCAT
GGATGGTGAAGCTATCGATAAATATAATAAAGTTAACACTACGATTGAGC
AGCCCGGCTTTGGTGAACATTGTATTACGGAAACGTATCTGTGTCCGTAT
GTACAAACGCCCAAGTTTGAAGGACTCCTTAAGGCGGAAGTTTTGGCGTC
AAACCAATGTGCCCACCCGTTGTGGCGTACGTTTCGAATTGATCTCGCAC
ATACCAAGGACAATGCATTGAGCGGGTGTGGAGACATTGATGCTGAACCA
GCCGGTCATCATTCCTTCCTCTCTTTCGAACAATCCGACTCAATCATTGG
TCTCCCGATTATGAAATACGATCAGAAACGGGTCACAGCAACTGCTTCTT
GGGATTCGTCTATCCACGATTCTGTATATTTGAACCGGGTGACACAGAAT
ACGGAACGGGTCTACATTATTTTGAAGGAACCCGTTACCGGGAATGGAAA
CGCACATCCCTGTCATCTTTTTGGACCTGGACGACAAATCCCAAGAGGAC
AAAGAACACGAGGGAATGTTGATCGACCAATGGGTGTCCTTAACTGAAGA
ACGAAACGCCATCTTGTGTCCGAATACTGGAAGTGGCGTGCCTGGTGCTA
CCAGTGAATGCTTGCGAGATCGTTTTTCGAATTCAGTGATGAAAAAGCGA
GAATATTTGGATCAACAAATCCAAGAGATGATAAATAAACCAAATGGAGA
GAGTTATCGCGGCAACTCGAATTATGGGTCGAAATCCACGAGTTGAATGA
ACAAGGTTTTTACTCGCCTGTCGAGTTACTCCAACGTGAGGGACAAGAGG
CCGGCGGTGTGTTTATGTTACGTCAAGGGTATTCACGCCGTGTCGTGACA
CAAGTCGTCGTCCCCAAACATAACAGTCAAGGATCGCAAGGACTTTTGCC
AGTTGTTATCGAGTCCATTTCGAACGTTGCTGTTGGAAGTGTCACCGTCC
GAAATAAAACACAAAAGGGACTTGACAGTTATCAAGAACGAGATTTACAG
ACTGAAATGCTTGACCGGGTTAACCAGTACAGAACCAGACATTCACTGTC
GAAGTTGACGAAGATTTTTTAGATTACGTCACTGACGGTTCATTGGCTAT
TGAAGTTTACGGTAACCGAAGTAGAGGATATGACACCAAACCAGCTCCGT
TGCAATTGCCTCAGGAAATGGATAATAGTAAATCACTTGTCGACAGATTA
CAATCAAAGAAGCTCATGGTTTACCTCTCTCCCTCTGCAATTACGTGTTT
GGTCAATACACTTTTTTCGATCAAGAACTGTCCGTCATCCCGCCCTTGAA
CGCGGCCGCCTCGCCCGTTACCGCCTCGAAATCTAACTCAATGACCTTTA
ACAACACAAAAACGAGACGACATCTTTATCACTTGATGGGGACAGTGTCA
GCGATGAAGATGATATCGAAGGATTGGCCATGGGAAGCTCTGTCAAAGTA
CAGGACGATACTGATGATGACGGTTTATTTTTCGAAGTGGAATGTCACAC
TTTGATTGGCGTCGCCACAGTCTGGTTGGAATGTCTGTATCAAAACGTCC
CCTTGGATTATTCAGCTCCGGTCATTAGTCAGCAGGGTGAAGTCTGTGGA
CGCATGTCTGTTGAGATTAGGAGGATACAAGTTTGGTCTGTGGACAAGCT
TGGTAATAAAATTTATGACATGCGAGATGCTTATCAAACCATCACAGAAA
ACCCACTAGAGGCTAACCTGATCCCAACAGCTACACTATCACAAGCCGCC
AGTCAAGGGCCGTTGACAAGCGAAGTAGCGGTCGTAGTGAAACACAAAAC
GCGTGGCACACAAGATGAAAAAGGACGCTGATTTCGCTGTCACGCTTCAG
GTAAAAACAACGGTACAGTTCAAGGAGTTAGTTATTTCAATTGCGATCCA
AATCATGGGTTATTCATACGCGCTGAAAAATTACTCAAAAGTTGAAACCG
AAGCTCCAGTCGTGCAAGTTCGGCGGGCGATTATTTGCGCGCGCGGCAAA
CAAACCAACGAGCCAAATCACAAAACAATCGGTATAGCGTCGGCGCATTC
AACAGTCCCTCCCAATCCCCGCGTATGGCTTTACGACAATACGATATTGA
TATTGACGGCGAATCGGCGGGTCGCACGACACCTCCGCGTGACCGCTTGG
TCCCGCGTAATAACACCACACCTGTGTTACCATCTTTAGTGGAAAGCTCT
CCGACAACGACTGAGCCACCACAGATGGAACTATTAACCGCGAAACAGAA
TTTGAGCCGAACGAATTCCAAATCGAGTAATGCCGACACTGATGACGATG
AGAAACCGACCATCATTGTCGGTGACGAAGAAATCCCGAGCCCTCGATTA
AAAGTCGGTGATGTTGTCAAGATTACCGAAAACTTGGAAGGGCAAGTCCG
ATTCTACGGGAAAACTCAATTCGCTGATGGCACTTGGGTCGGAATCGCCT
TAACTGTACCCGAAGTCGAATAGTGATTTGAACAACAGTGAACTTGCACC
GTCCAGTGGTCTCAATGGAATGAACGGAGAACTAAACAAGCCGAGTATGT
CAAATTTATGGCGATCACAAGCGTATCCAGGATTTCACACGTCGAGAATA
TTTTGAATCTTCACAAACTTCGTCAAGAAGTCTTGGTCAAAGAGAAGCTG
GCAGCTGTTGGAAGGTCCAGTAAATCACTGACCAATCGGAACATGAGAAA
ATACGCAAGCACACCTAATCTTTTCAACGCTCAATCGGGAGAACAGACGG
AAGAACGTGAATCACTGGCGCAAAAAGCAGCAGAAGCAATGCATGTCGGG
ACAGATGGGGAAGAACTCATGGATGGTGAAGCTATCGATAAATATAATAA
AGTTAACACTACGATTGAGCAGCCCGGCTTTGGTGAACATTGTATTACGG
AAACGTATCTGTGTCCGTATGTACAAACGCCCAAGTTTGAAGGACTCCTT
AAGGCGGAAGTTTTGGCGTCAAACCAATGTGCCCACCCGTTGTGGCGTAC
GTTTCGAATTGATCTCGCACATACCAAGGACAATGCATTGAGCGGGTGTG
GAGACATTGATGCTGAACCAGCCGGTCATCATTCCTTCCTCTCTTTCGAA
CAATCCGACTCAATCATTGGTCTCCCGATTATGAAATACGATCAGAAACG
GGTCACAGCAACTGCTTCTTGGGATTCGTCTATCCACGATTCTGTATATT
TGAACCGGGTGACACAGAATACGGAACGGGTCTACATTATTTTGAAGGAA
CCCGTTACCGGGAATGGAAACGCACATCCCTGTCATCTTTTTGGACCTGG
ACGACAAATCCCAAGAGGACAAAGAACACGAGGGAATGTTGATCGACCAA
TGGGTGTCCTTAACTGAAGAACGAAACGCCATCTTGTGTCCGAATACTGG
AAGTGGCGTGCCTGGTGCTACCAGTGAATGCTTGCGAGATCGTTTTTCGA
ATTCAGTGATGAAAAAGCGAGAATATTTGGATCAACAAATCCAAGAGATG
ATAAATAAACCAAATGGAGAGAGTTATCGCGGCAACTCGAATTATGGGTC
GAAATCCACGAGTTGAATGAACAAGGTTTTTACTCGCCTGTCGAGTTACT
CCAACGTGAGGGACAAGAGGCCGGCGGTGTGTTTATGTTACGTCAAGGGT
ATTCACGCCGTGTCGTGACACAAGTCGTCGTCCCCAAACATAACAGTCAA
GGATCGCAAGGACTTTTGCCAGTTGTTATCGAGTCCATTTCGAACGTTGC
TGTTGGAAGTGTCACCGTCCGAAATAAAACACAAAAGGGACTTGACAGTT
ATCAAGAACGAGATTTACAGACTGAAATGCTTGACCGGGTTAACCAGTAC
AGAACCAGACATTCACTGTCGAAGTTGACGAAGATTTTTTAGATTACGTC
ACTGACGGTTCATTGGCTATTGAAGTTTACGGTAACCGAAGTAGAGGATA
TGACACCAAACCAGCTCCGTTGCAATTGCCTCAGGAAATGGATAATAGTA
AATCACTTGTCGACAGATTACAATCAAAGAAGCTCATGGTTTACCTCTCT
CCCTCTGCAATTACGTGTTTGGTCAATACACTTTTTTCGATCAAGAACTG
TCCGTCATCCCGCCCTTGAACGCGGCCGCCTCGCCCGTTACCGCCTCGAA
ATCTAACTCAATGACCTTTAACAACACAAAAACGAGACGACATCTTTATC
ACTTGATGGGGACAGTGTCAGCGATGAAGATGATATCGAAGGATTGGCCA
TGGGAAGCTCTGTCAAAGTACAGGACGATACTGATGATGACGGTTTATTT
TTCGAAGTGGAATGTCACACTTTGATTGGCGTCGCCACAGTCTGGTTGGA
ATGTCTGTATCAAAACGTCCCCTTGGATTATTCAGCTCCGGTCATTAGTC
AGCAGGGTGAAGTCTGTGGACGCATGTCTGTTGAGATTAGGAGGATACAA
GTTTGGTCTGTGGACAAGCTTGGTAATAAAATTTATGACATGCGAGATGC
TTATCAAACCATCACAGAAAACCCACTAGAGGCTAACCTGATCCCAACAG
CTACACTATCACAAGCCGCCAGTCAAGGGCCGTTGACAAGCGAAGTAGCG
GTCGTAGTGAAACACAAAACGCGTGGCACACAAGATGAAAAAGGACGCTG
ATTTCGCTGTCACGCTTCAGGTAAAAACAACGGTACAGTTCAAGGAGTTA
GTTATTTCAATTGCGATCCAAATCATGGGTTATTCATACGCGCTGAAAAA
TTACTCAAAAGTTGAAACCGAAGCTCCAGTCGTGCAAGTTCGGCGGGCGA
TTATTTGCGCGCGCGGCAAACAAACCAACGAGCCAAATCACAAAACAATC
GGTATAGCGTCGGCGCATTCAACAGTCCCTCCCAATCCCCGCGTATGGCT
TTACGACAATACGATATTGATATTGACGGCGAATCGGCGGGTCGCACGAC
ACCTCCGCGTGACCGCTTGGTCCCGCGTAATAACACCACACCTGTGTTAC
CATCTTTAGTGGAAAGCTCTCCGACAACGACTGAGCCACCACAGATGGAA
CTATTAACCGCGAAACAGAATTTGAGCCGAACGAATTCCAAATCGAGTAA
TGCCGACACTGATGACGATGAGAAACCGACCATCATTGTCGGTGACGAAG
AAATCCCGAGCCCTCGATTAAAAGTCGGTGATGTTGTCAAGATTACCGAA
AACTTGGAAGGGCAAGTCCGATTCTACGGGAAAACTCAATTCGCTGATGG
CACTTGGGTCGGAATCGCCTTAACTGTACCCGAAGTCGAATAGTGATTTG
AACAACAGTGAACTTGCACCGTCCAGTGGTCTCAATGGAATGAACGGAGA
ACTAAACAAGCCGAGTATGTCAAATTTATGGCGATCACAAGCGTATCCAG
GATTTCACACGTCGAGAATATTTTGAATCTTCACAAACTTCGTCAAGAAG
TCTTGGTCAAAGAGAAGCTGGCAGCTGTTGGAAGGTCCAGTAAATCACTG
ACCAATCGGAACATGAGAAAATACGCAAGCACACCTAATCTTTTCAACGC
TCAATCGGGAGAACAGACGGAAGAACGTGAATCACTGGCGCAAAAAGCAG
CAGAAGCAATGCATGTCGGGACAGATGGGGAAGAACTCATGGATGGTGAA
GCTATCGATAAATATAATAAAGTTAACACTACGATTGAGCAGCCCGGCTT
TGGTGAACATTGTATTACGGAAACGTATCTGTGTCCGTATGTACAAACGC
CCAAGTTTGAAGGACTCCTTAAGGCGGAAGTTTTGGCGTCAAACCAATGT
GCCCACCCGTTGTGGCGTACGTTTCGAATTGATCTCGCACATACCAAGGA
CAATGCATTGAGCGGGTGTGGAGACATTGATGCTGAACCAGCCGGTCATC
ATTCCTTCCTCTCTTTCGAACAATCCGACTCAATCATTGGTCTCCCGATT
ATGAAATACGATCAGAAACGGGTCACAGCAACTGCTTCTTGGGATTCGTC
TATCCACGATTCTGTATATTTGAACCGGGTGACACAGAATACGGAACGGG
TCTACATTATTTTGAAGGAACCCGTTACCGGGAATGGAAACGCACATCCC
TGTCATCTTTTTGGACCTGGACGACAAATCCCAAGAGGACAAAGAACACG
AGGGAATGTTGATCGACCAATGGGTGTCCTTAACTGAAGAACGAAACGCC
ATCTTGTGTCCGAATACTGGAAGTGGCGTGCCTGGTGCTACCAGTGAATG
CTTGCGAGATCGTTTTTCGAATTCAGTGATGAAAAAGCGAGAATATTTGG
ATCAACAAATCCAAGAGATGATAAATAAACCAAATGGAGAGAGTTATCGC
GGCAACTCGAATTATGGGTCGAAATCCACGAGTTGAATGAACAAGGTTTT
TACTCGCCTGTCGAGTTACTCCAACGTGAGGGACAAGAGGCCGGCGGTGT
GTTTATGTTACGTCAAGGGTATTCACGCCGTGTCGTGACACAAGTCGTCG
TCCCCAAACATAACAGTCAAGGATCGCAAGGACTTTTGCCAGTTGTTATC
GAGTCCATTTCGAACGTTGCTGTTGGAAGTGTCACCGTCCGAAATAAAAC
ACAAAAGGGACTTGACAGTTATCAAGAACGAGATTTACAGACTGAAATGC
TTGACCGGGTTAACCAGTACAGAACCAGACATTCACTGTCGAAGTTGACG
AAGATTTTTTAGATTACGTCACTGACGGTTCATTGGCTATTGAAGTTTAC
GGTAACCGAAGTAGAGGATATGACACCAAACCAGCTCCGTTGCAATTGCC
TCAGGAAATGGATAATAGTAAATCACTTGTCGACAGATTACAATCAAAGA
AGCTCATGGTTTACCTCTCTCCCTCTGCAATTACGTGTTTGGTCAATACA
CTTTTTTCGATCAAGAACTGTCCGTCATCCCGCCCTTGAACGCGGCCGCC
TCGCCCGTTACCGCCTCGAAATCTAACTCAATGACCTTTAACAACACAAA
AACGAGACGACATCTTTATCACTTGATGGGGACAGTGTCAGCGATGAAGA
TGATATCGAAGGATTGGCCATGGGAAGCTCTGTCAAAGTACAGGACGATA
CTGATGATGACGGTTTATTTTTCGAAGTGGAATGTCACACTTTGATTGGC
GTCGCCACAGTCTGGTTGGAATGTCTGTATCAAAACGTCCCCTTGGATTA
TTCAGCTCCGGTCATTAGTCAGCAGGGTGAAGTCTGTGGACGCATGTCTG
TTGAGATTAGGAGGATACAAGTTTGGTCTGTGGACAAGCTTGGTAATAAA
ATTTATGACATGCGAGATGCTTATCAAACCATCACAGAAAACCCACTAGA
GGCTAACCTGATCCCAACAGCTACACTATCACAAGCCGCCAGTCAAGGGC
CGTTGACAAGCGAAGTAGCGGTCGTAGTGAAACACAAAACGCGTGGCACA
CAAGATGAAAAAGGACGCTGATTTCGCTGTCACGCTTCAGGTAAAAACAA
CGGTACAGTTCAAGGAGTTAGTTATTTCAATTGCGATCCAAATCATGGGT
TATTCATACGCGCTGAAAAATTACTCAAAAGTTGAAACCGAAGCTCCAGT
CGTGCAAGTTCGGCGGGCGATTATTTGCGCGCGCGGCAAACAAACCAACG
AGCCAAATCACAAAACAATCGGTATAGCGTCGGCGCATTCAACAGTCCCT
CCCAATCCCCGCGTATGGCTTTACGACAATACGATATTGATATTGACGGC
GAATCGGCGGGTCGCACGACACCTCCGCGTGACCGCTTGGTCCCGCGTAA
TAACACCACACCTGTGTTACCATCTTTAGTGGAAAGCTCTCCGACAACGA
CTGAGCCACCACAGATGGAACTATTAACCGCGAAACAGAATTTGAGCCGA
ACGAATTCCAAATCGAGTAATGCCGACACTGATGACGATGAGAAACCGAC
CATCATTGTCGGTGACGAAGAAATCCCGAGCCCTCGATTAAAAGTCGGTG
ATGTTGTCAAGATTACCGAAAACTTGGAAGGGCAAGTCCGATTCTACGGG
AAAACTCAATTCGCTGATGGCACTTGGGTCGGAATCGCCTTAACTGTACC
CGAAGTCGAATAGTGATTTGAACAACAGTGAACTTGCACCGTCCAGTGGT
CTCAATGGAATGAACGGAGAACTAAACAAGCCGAGTATGTCAAATTTATG
GCGATCACAAGCGTATCCAGGATTTCACACGTCGAGAATATTTTGAATCT
TCACAAACTTCGTCAAGAAGTCTTGGTCAAAGAGAAGCTGGCAGCTGTTG
GAAGGTCCAGTAAATCACTGACCAATCGGAACATGAGAAAATACGCAAGC
ACACCTAATCTTTTCAACGCTCAATCGGGAGAACAGACGGAAGAACGTGA
ATCACTGGCGCAAAAAGCAGCAGAAGCAATGCATGTCGGGACAGATGGGG
AAGAACTCATGGATGGTGAAGCTATCGATAAATATAATAAAGTTAACACT
ACGATTGAGCAGCCCGGCTTTGGTGAACATTGTATTACGGAAACGTATCT
GTGTCCGTATGTACAAACGCCCAAGTTTGAAGGACTCCTTAAGGCGGAAG
TTTTGGCGTCAAACCAATGTGCCCACCCGTTGTGGCGTACGTTTCGAATT
GATCTCGCACATACCAAGGACAATGCATTGAGCGGGTGTGGAGACATTGA
TGCTGAACCAGCCGGTCATCATTCCTTCCTCTCTTTCGAACAATCCGACT
CAATCATTGGTCTCCCGATTATGAAATACGATCAGAAACGGGTCACAGCA
ACTGCTTCTTGGGATTCGTCTATCCACGATTCTGTATATTTGAACCGGGT
GACACAGAATACGGAACGGGTCTACATTATTTTGAAGGAACCCGTTACCG
GGAATGGAAACGCACATCCCTGTCATCTTTTTGGACCTGGACGACAAATC
CCAAGAGGACAAAGAACACGAGGGAATGTTGATCGACCAATGGGTGTCCT
TAACTGAAGAACGAAACGCCATCTTGTGTCCGAATACTGGAAGTGGCGTG
CCTGGTGCTACCAGTGAATGCTTGCGAGATCGTTTTTCGAATTCAGTGAT
GAAAAAGCGAGAATATTTGGATCAACAAATCCAAGAGATGATAAATAAAC
CAAATGGAGAGAGTTATCGCGGCAACTCGAATTATGGGTCGAAATCCACG
AGTTGAATGAACAAGGTTTTTACTCGCCTGTCGAGTTACTCCAACGTGAG
GGACAAGAGGCCGGCGGTGTGTTTATGTTACGTCAAGGGTATTCACGCCG
TGTCGTGACACAAGTCGTCGTCCCCAAACATAACAGTCAAGGATCGCAAG
GACTTTTGCCAGTTGTTATCGAGTCCATTTCGAACGTTGCTGTTGGAAGT
GTCACCGTCCGAAATAAAACACAAAAGGGACTTGACAGTTATCAAGAACG
AGATTTACAGACTGAAATGCTTGACCGGGTTAACCAGTACAGAACCAGAC
ATTCACTGTCGAAGTTGACGAAGATTTTTTAGATTACGTCACTGACGGTT
CATTGGCTATTGAAGTTTACGGTAACCGAAGTAGAGGATATGACACCAAA
CCAGCTCCGTTGCAATTGCCTCAGGAAATGGATAATAGTAAATCACTTGT
CGACAGATTACAATCAAAGAAGCTCATGGTTTACCTCTCTCCCTCTGCAA
TTACGTGTTTGGTCAATACACTTTTTTCGATCAAGAACTGTCCGTCATCC
CGCCCTTGAACGCGGCCGCCTCGCCCGTTACCGCCTCGAAATCTAACTCA
ATGACCTTTAACAACACAAAAACGAGACGACATCTTTATCACTTGATGGG
GACAGTGTCAGCGATGAAGATGATATCGAAGGATTGGCCATGGGAAGCTC
TGTCAAAGTACAGGACGATACTGATGATGACGGTTTATTTTTCGAAGTGG
AATGTCACACTTTGATTGGCGTCGCCACAGTCTGGTTGGAATGTCTGTAT
CAAAACGTCCCCTTGGATTATTCAGCTCCGGTCATTAGTCAGCAGGGTGA
AGTCTGTGGACGCATGTCTGTTGAGATTAGGAGGATACAAGTTTGGTCTG
TGGACAAGCTTGGTAATAAAATTTATGACATGCGAGATGCTTATCAAACC
ATCACAGAAAACCCACTAGAGGCTAACCTGATCCCAACAGCTACACTATC
ACAAGCCGCCAGTCAAGGGCCGTTGACAAGCGAAGTAGCGGTCGTAGTGA
AACACAAAACGCGTGGCACACAAGATGAAAAAGGACGCTGATTTCGCTGT
CACGCTTCAGGTAAAAACAACGGTACAGTTCAAGGAGTTAGTTATTTCAA
TTGCGATCCAAATCATGGGTTATTCATACGCGCTGAAAAATTACTCAAAA
GTTGAAACCGAAGCTCCAGTCGTGCAAGTTCGGCGGGCGATTATTTGCGC
GCGCGGCAAACAAACCAACGAGCCAAATCACAAAACAATCGGTATAGCGT
CGGCGCATTCAACAGTCCCTCCCAATCCCCGCGTATGGCTTTACGACAAT
ACGATATTGATATTGACGGCGAATCGGCGGGTCGCACGACACCTCCGCGT
GACCGCTTGGTCCCGCGTAATAACACCACACCTGTGTTACCATCTTTAGT
GGAAAGCTCTCCGACAACGACTGAGCCACCACAGATGGAACTATTAACCG
CGAAACAGAATTTGAGCCGAACGAATTCCAAATCGAGTAATGCCGACACT
GATGACGATGAGAAACCGACCATCATTGTCGGTGACGAAGAAATCCCGAG
CCCTCGATTAAAAGTCGGTGATGTTGTCAAGATTACCGAAAACTTGGAAG
GGCAAGTCCGATTCTACGGGAAAACTCAATTCGCTGATGGCACTTGGGTC
GGAATCGCCTTAACTGTACCCGAAGTCGAATAGTGATTTGAACAACAGTG
AACTTGCACCGTCCAGTGGTCTCAATGGAATGAACGGAGAACTAAACAAG
CCGAGTATGTCAAATTTATGGCGATCACAAGCGTATCCAGGATTTCACAC
GTCGAGAATATTTTGAATCTTCACAAACTTCGTCAAGAAGTCTTGGTCAA
AGAGAAGCTGGCAGCTGTTGGAAGGTCCAGTAAATCACTGACCAATCGGA
ACATGAGAAAATACGCAAGCACACCTAATCTTTTCAACGCTCAATCGGGA
GAACAGACGGAAGAACGTGAATCACTGGCGCAAAAAGCAGCAGAAGCAAT
GCATGTCGGGACAGATGGGGAAGAACTCATGGATGGTGAAGCTATCGATA
AATATAATAAAGTTAACACTACGATTGAGCAGCCCGGCTTTGGTGAACAT
TGTATTACGGAAACGTATCTGTGTCCGTATGTACAAACGCCCAAGTTTGA
AGGACTCCTTAAGGCGGAAGTTTTGGCGTCAAACCAATGTGCCCACCCGT
TGTGGCGTACGTTTCGAATTGATCTCGCACATACCAAGGACAATGCATTG
AGCGGGTGTGGAGACATTGATGCTGAACCAGCCGGTCATCATTCCTTCCT
CTCTTTCGAACAATCCGACTCAATCATTGGTCTCCCGATTATGAAATACG
ATCAGAAACGGGTCACAGCAACTGCTTCTTGGGATTCGTCTATCCACGAT
TCTGTATATTTGAACCGGGTGACACAGAATACGGAACGGGTCTACATTAT
TTTGAAGGAACCCGTTACCGGGAATGGAAACGCACATCCCTGTCATCTTT
TTGGACCTGGACGACAAATCCCAAGAGGACAAAGAACACGAGGGAATGTT
GATCGACCAATGGGTGTCCTTAACTGAAGAACGAAACGCCATCTTGTGTC
CGAATACTGGAAGTGGCGTGCCTGGTGCTACCAGTGAATGCTTGCGAGAT
CGTTTTTCGAATTCAGTGATGAAAAAGCGAGAATATTTGGATCAACAAAT
CCAAGAGATGATAAATAAACCAAATGGAGAGAGTTATCGCGGCAACTCGA
ATTATGGGTCGAAATCCACGAGTTGAATGAACAAGGTTTTTACTCGCCTG
TCGAGTTACTCCAACGTGAGGGACAAGAGGCCGGCGGTGTGTTTATGTTA
CGTCAAGGGTATTCACGCCGTGTCGTGACACAAGTCGTCGTCCCCAAACA
TAACAGTCAAGGATCGCAAGGACTTTTGCCAGTTGTTATCGAGTCCATTT
CGAACGTTGCTGTTGGAAGTGTCACCGTCCGAAATAAAACACAAAAGGGA
CTTGACAGTTATCAAGAACGAGATTTACAGACTGAAATGCTTGACCGGGT
TAACCAGTACAGAACCAGACATTCACTGTCGAAGTTGACGAAGATTTTTT
AGATTACGTCACTGACGGTTCATTGGCTATTGAAGTTTACGGTAACCGAA
GTAGAGGATATGACACCAAACCAGCTCCGTTGCAATTGCCTCAGGAAATG
GATAATAGTAAATCACTTGTCGACAGATTACAATCAAAGAAGCTCATGGT
TTACCTCTCTCCCTCTGCAATTACGTGTTTGGTCAATACACTTTTTTCGA
TCAAGAACTGTCCGTCATCCCGCCCTTGAACGCGGCCGCCTCGCCCGTTA
CCGCCTCGAAATCTAACTCAATGACCTTTAACAACACAAAAACGAGACGA
CATCTTTATCACTTGATGGGGACAGTGTCAGCGATGAAGATGATATCGAA
GGATTGGCCATGGGAAGCTCTGTCAAAGTACAGGACGATACTGATGATGA
CGGTTTATTTTTCGAAGTGGAATGTCACACTTTGATTGGCGTCGCCACAG
TCTGGTTGGAATGTCTGTATCAAAACGTCCCCTTGGATTATTCAGCTCCG
GTCATTAGTCAGCAGGGTGAAGTCTGTGGACGCATGTCTGTTGAGATTAG
GAGGATACAAGTTTGGTCTGTGGACAAGCTTGGTAATAAAATTTATGACA
TGCGAGATGCTTATCAAACCATCACAGAAAACCCACTAGAGGCTAACCTG
ATCCCAACAGCTACACTATCACAAGCCGCCAGTCAAGGGCCGTTGACAAG
CGAAGTAGCGGTCGTAGTGAAACACAAAACGCGTGGCACACAAGATGAAA
AAGGACGCTGATTTCGCTGTCACGCTTCAGGTAAAAACAACGGTACAGTT
CAAGGAGTTAGTTATTTCAATTGCGATCCAAATCATGGGTTATTCATACG
CGCTGAAAAATTACTCAAAAGTTGAAACCGAAGCTCCAGTCGTGCAAGTT
CGGCGGGCGATTATTTGCGCGCGCGGCAAACAAACCAACGAGCCAAATCA
CAAAACAATCGGTATAGCGTCGGCGCATTCAACAGTCCCTCCCAATCCCC
GCGTATGGCTTTACGACAATACGATATTGATATTGACGGCGAATCGGCGG
GTCGCACGACACCTCCGCGTGACCGCTTGGTCCCGCGTAATAACACCACA
CCTGTGTTACCATCTTTAGTGGAAAGCTCTCCGACAACGACTGAGCCACC
ACAGATGGAACTATTAACCGCGAAACAGAATTTGAGCCGAACGAATTCCA
AATCGAGTAATGCCGACACTGATGACGATGAGAAACCGACCATCATTGTC
GGTGACGAAGAAATCCCGAGCCCTCGATTAAAAGTCGGTGATGTTGTCAA
GATTACCGAAAACTTGGAAGGGCAAGTCCGATTCTACGGGAAAACTCAAT
TCGCTGATGGCACTTGGGTCGGAATCGCCTTAACTGTACCCGAAGTCGAA
TAGTGATTTGAACAACAGTGAACTTGCACCGTCCAGTGGTCTCAATGGAA
TGAACGGAGAACTAAACAAGCCGAGTATGTCAAATTTATGGCGATCACAA
GCGTATCCAGGATTTCACACGTCGAGAATATTTTGAATCTTCACAAACTT
CGTCAAGAAGTCTTGGTCAAAGAGAAGCTGGCAGCTGTTGGAAGGTCCAG
TAAATCACTGACCAATCGGAACATGAGAAAATACGCAAGCACACCTAATC
TTTTCAACGCTCAATCGGGAGAACAGACGGAAGAACGTGAATCACTGGCG
CAAAAAGCAGCAGAAGCAATGCATGTCGGGACAGATGGGGAAGAACTCAT
GGATGGTGAAGCTATCGATAAATATAATAAAGTTAACACTACGATTGAGC
AGCCCGGCTTTGGTGAACATTGTATTACGGAAACGTATCTGTGTCCGTAT
GTACAAACGCCCAAGTTTGAAGGACTCCTTAAGGCGGAAGTTTTGGCGTC
AAACCAATGTGCCCACCCGTTGTGGCGTACGTTTCGAATTGATCTCGCAC
ATACCAAGGACAATGCATTGAGCGGGTGTGGAGACATTGATGCTGAACCA
GCCGGTCATCATTCCTTCCTCTCTTTCGAACAATCCGACTCAATCATTGG
TCTCCCGATTATGAAATACGATCAGAAACGGGTCACAGCAACTGCTTCTT
GGGATTCGTCTATCCACGATTCTGTATATTTGAACCGGGTGACACAGAAT
ACGGAACGGGTCTACATTATTTTGAAGGAACCCGTTACCGGGAATGGAAA
CGCACATCCCTGTCATCTTTTTGGACCTGGACGACAAATCCCAAGAGGAC
AAAGAACACGAGGGAATGTTGATCGACCAATGGGTGTCCTTAACTGAAGA
ACGAAACGCCATCTTGTGTCCGAATACTGGAAGTGGCGTGCCTGGTGCTA
CCAGTGAATGCTTGCGAGATCGTTTTTCGAATTCAGTGATGAAAAAGCGA
GAATATTTGGATCAACAAATCCAAGAGATGATAAATAAACCAAATGGAGA
GAGTTATCGCGGCAACTCGAATTATGGGTCGAAATCCACGAGTTGAATGA
ACAAGGTTTTTACTCGCCTGTCGAGTTACTCCAACGTGAGGGACAAGAGG
CCGGCGGTGTGTTTATGTTACGTCAAGGGTATTCACGCCGTGTCGTGACA
CAAGTCGTCGTCCCCAAACATAACAGTCAAGGATCGCAAGGACTTTTGCC
AGTTGTTATCGAGTCCATTTCGAACGTTGCTGTTGGAAGTGTCACCGTCC
GAAATAAAACACAAAAGGGACTTGACAGTTATCAAGAACGAGATTTACAG
ACTGAAATGCTTGACCGGGTTAACCAGTACAGAACCAGACATTCACTGTC
GAAGTTGACGAAGATTTTTTAGATTACGTCACTGACGGTTCATTGGCTAT
TGAAGTTTACGGTAACCGAAGTAGAGGATATGACACCAAACCAGCTCCGT
TGCAATTGCCTCAGGAAATGGATAATAGTAAATCACTTGTCGACAGATTA
CAATCAAAGAAGCTCATGGTTTACCTCTCTCCCTCTGCAATTACGTGTTT
GGTCAATACACTTTTTTCGATCAAGAACTGTCCGTCATCCCGCCCTTGAA
CGCGGCCGCCTCGCCCGTTACCGCCTCGAAATCTAACTCAATGACCTTTA
ACAACACAAAAACGAGACGACATCTTTATCACTTGATGGGGACAGTGTCA
GCGATGAAGATGATATCGAAGGATTGGCCATGGGAAGCTCTGTCAAAGTA
CAGGACGATACTGATGATGACGGTTTATTTTTCGAAGTGGAATGTCACAC
TTTGATTGGCGTCGCCACAGTCTGGTTGGAATGTCTGTATCAAAACGTCC
CCTTGGATTATTCAGCTCCGGTCATTAGTCAGCAGGGTGAAGTCTGTGGA
CGCATGTCTGTTGAGATTAGGAGGATACAAGTTTGGTCTGTGGACAAGCT
TGGTAATAAAATTTATGACATGCGAGATGCTTATCAAACCATCACAGAAA
ACCCACTAGAGGCTAACCTGATCCCAACAGCTACACTATCACAAGCCGCC
AGTCAAGGGCCGTTGACAAGCGAAGTAGCGGTCGTAGTGAAACACAAAAC
GCGTGGCACACAAGATGAAAAAGGACGCTGATTTCGCTGTCACGCTTCAG
GTAAAAACAACGGTACAGTTCAAGGAGTTAGTTATTTCAATTGCGATCCA
AATCATGGGTTATTCATACGCGCTGAAAAATTACTCAAAAGTTGAAACCG
AAGCTCCAGTCGTGCAAGTTCGGCGGGCGATTATTTGCGCGCGCGGCAAA
CAAACCAACGAGCCAAATCACAAAACAATCGGTATAGCGTCGGCGCATTC
AACAGTCCCTCCCAATCCCCGCGTATGGCTTTACGACAATACGATATTGA
TATTGACGGCGAATCGGCGGGTCGCACGACACCTCCGCGTGACCGCTTGG
TCCCGCGTAATAACACCACACCTGTGTTACCATCTTTAGTGGAAAGCTCT
CCGACAACGACTGAGCCACCACAGATGGAACTATTAACCGCGAAACAGAA
TTTGAGCCGAACGAATTCCAAATCGAGTAATGCCGACACTGATGACGATG
AGAAACCGACCATCATTGTCGGTGACGAAGAAATCCCGAGCCCTCGATTA
AAAGTCGGTGATGTTGTCAAGATTACCGAAAACTTGGAAGGGCAAGTCCG
ATTCTACGGGAAAACTCAATTCGCTGATGGCACTTGGGTCGGAATCGCCT
TAACTGTACCCGAAGTCGAATAGTGATTTGAACAACAGTGAACTTGCACC
GTCCAGTGGTCTCAATGGAATGAACGGAGAACTAAACAAGCCGAGTATGT
CAAATTTATGGCGATCACAAGCGTATCCAGGATTTCACACGTCGAGAATA
TTTTGAATCTTCACAAACTTCGTCAAGAAGTCTTGGTCAAAGAGAAGCTG
GCAGCTGTTGGAAGGTCCAGTAAATCACTGACCAATCGGAACATGAGAAA
ATACGCAAGCACACCTAATCTTTTCAACGCTCAATCGGGAGAACAGACGG
AAGAACGTGAATCACTGGCGCAAAAAGCAGCAGAAGCAATGCATGTCGGG
ACAGATGGGGAAGAACTCATGGATGGTGAAGCTATCGATAAATATAATAA
AGTTAACACTACGATTGAGCAGCCCGGCTTTGGTGAACATTGTATTACGG
AAACGTATCTGTGTCCGTATGTACAAACGCCCAAGTTTGAAGGACTCCTT
AAGGCGGAAGTTTTGGCGTCAAACCAATGTGCCCACCCGTTGTGGCGTAC
GTTTCGAATTGATCTCGCACATACCAAGGACAATGCATTGAGCGGGTGTG
GAGACATTGATGCTGAACCAGCCGGTCATCATTCCTTCCTCTCTTTCGAA
CAATCCGACTCAATCATTGGTCTCCCGATTATGAAATACGATCAGAAACG
GGTCACAGCAACTGCTTCTTGGGATTCGTCTATCCACGATTCTGTATATT
TGAACCGGGTGACACAGAATACGGAACGGGTCTACATTATTTTGAAGGAA
CCCGTTACCGGGAATGGAAACGCACATCCCTGTCATCTTTTTGGACCTGG
ACGACAAATCCCAAGAGGACAAAGAACACGAGGGAATGTTGATCGACCAA
TGGGTGTCCTTAACTGAAGAACGAAACGCCATCTTGTGTCCGAATACTGG
AAGTGGCGTGCCTGGTGCTACCAGTGAATGCTTGCGAGATCGTTTTTCGA
ATTCAGTGATGAAAAAGCGAGAATATTTGGATCAACAAATCCAAGAGATG
ATAAATAAACCAAATGGAGAGAGTTATCGCGGCAACTCGAATTATGGGTC
GAAATCCACGAGTTGAATGAACAAGGTTTTTACTCGCCTGTCGAGTTACT
CCAACGTGAGGGACAAGAGGCCGGCGGTGTGTTTATGTTACGTCAAGGGT
ATTCACGCCGTGTCGTGACACAAGTCGTCGTCCCCAAACATAACAGTCAA
GGATCGCAAGGACTTTTGCCAGTTGTTATCGAGTCCATTTCGAACGTTGC
TGTTGGAAGTGTCACCGTCCGAAATAAAACACAAAAGGGACTTGACAGTT
ATCAAGAACGAGATTTACAGACTGAAATGCTTGACCGGGTTAACCAGTAC
AGAACCAGACATTCACTGTCGAAGTTGACGAAGATTTTTTAGATTACGTC
ACTGACGGTTCATTGGCTATTGAAGTTTACGGTAACCGAAGTAGAGGATA
TGACACCAAACCAGCTCCGTTGCAATTGCCTCAGGAAATGGATAATAGTA
AATCACTTGTCGACAGATTACAATCAAAGAAGCTCATGGTTTACCTCTCT
CCCTCTGCAATTACGTGTTTGGTCAATACACTTTTTTCGATCAAGAACTG
TCCGTCATCCCGCCCTTGAACGCGGCCGCCTCGCCCGTTACCGCCTCGAA
ATCTAACTCAATGACCTTTAACAACACAAAAACGAGACGACATCTTTATC
ACTTGATGGGGACAGTGTCAGCGATGAAGATGATATCGAAGGATTGGCCA
TGGGAAGCTCTGTCAAAGTACAGGACGATACTGATGATGACGGTTTATTT
TTCGAAGTGGAATGTCACACTTTGATTGGCGTCGCCACAGTCTGGTTGGA
ATGTCTGTATCAAAACGTCCCCTTGGATTATTCAGCTCCGGTCATTAGTC
AGCAGGGTGAAGTCTGTGGACGCATGTCTGTTGAGATTAGGAGGATACAA
GTTTGGTCTGTGGACAAGCTTGGTAATAAAATTTATGACATGCGAGATGC
TTATCAAACCATCACAGAAAACCCACTAGAGGCTAACCTGATCCCAACAG
CTACACTATCACAAGCCGCCAGTCAAGGGCCGTTGACAAGCGAAGTAGCG
GTCGTAGTGAAACACAAAACGCGTGGCACACAAGATGAAAAAGGACGCTG
ATTTCGCTGTCACGCTTCAGGTAAAAACAACGGTACAGTTCAAGGAGTTA
GTTATTTCAATTGCGATCCAAATCATGGGTTATTCATACGCGCTGAAAAA
TTACTCAAAAGTTGAAACCGAAGCTCCAGTCGTGCAAGTTCGGCGGGCGA
TTATTTGCGCGCGCGGCAAACAAACCAACGAGCCAAATCACAAAACAATC
GGTATAGCGTCGGCGCATTCAACAGTCCCTCCCAATCCCCGCGTATGGCT
TTACGACAATACGATATTGATATTGACGGCGAATCGGCGGGTCGCACGAC
ACCTCCGCGTGACCGCTTGGTCCCGCGTAATAACACCACACCTGTGTTAC
CATCTTTAGTGGAAAGCTCTCCGACAACGACTGAGCCACCACAGATGGAA
CTATTAACCGCGAAACAGAATTTGAGCCGAACGAATTCCAAATCGAGTAA
TGCCGACACTGATGACGATGAGAAACCGACCATCATTGTCGGTGACGAAG
AAATCCCGAGCCCTCGATTAAAAGTCGGTGATGTTGTCAAGATTACCGAA
AACTTGGAAGGGCAAGTCCGATTCTACGGGAAAACTCAATTCGCTGATGG
CACTTGGGTCGGAATCGCCTTAACTGTACCCGAAGTCGAATAGTGATTTG
AACAACAGTGAACTTGCACCGTCCAGTGGTCTCAATGGAATGAACGGAGA
ACTAAACAAGCCGAGTATGTCAAATTTATGGCGATCACAAGCGTATCCAG
GATTTCACACGTCGAGAATATTTTGAATCTTCACAAACTTCGTCAAGAAG
TCTTGGTCAAAGAGAAGCTGGCAGCTGTTGGAAGGTCCAGTAAATCACTG
ACCAATCGGAACATGAGAAAATACGCAAGCACACCTAATCTTTTCAACGC
TCAATCGGGAGAACAGACGGAAGAACGTGAATCACTGGCGCAAAAAGCAG
CAGAAGCAATGCATGTCGGGACAGATGGGGAAGAACTCATGGATGGTGAA
GCTATCGATAAATATAATAAAGTTAACACTACGATTGAGCAGCCCGGCTT
TGGTGAACATTGTATTACGGAAACGTATCTGTGTCCGTATGTACAAACGC
CCAAGTTTGAAGGACTCCTTAAGGCGGAAGTTTTGGCGTCAAACCAATGT
GCCCACCCGTTGTGGCGTACGTTTCGAATTGATCTCGCACATACCAAGGA
CAATGCATTGAGCGGGTGTGGAGACATTGATGCTGAACCAGCCGGTCATC
ATTCCTTCCTCTCTTTCGAACAATCCGACTCAATCATTGGTCTCCCGATT
ATGAAATACGATCAGAAACGGGTCACAGCAACTGCTTCTTGGGATTCGTC
TATCCACGATTCTGTATATTTGAACCGGGTGACACAGAATACGGAACGGG
TCTACATTATTTTGAAGGAACCCGTTACCGGGAATGGAAACGCACATCCC
TGTCATCTTTTTGGACCTGGACGACAAATCCCAAGAGGACAAAGAACACG
AGGGAATGTTGATCGACCAATGGGTGTCCTTAACTGAAGAACGAAACGCC
ATCTTGTGTCCGAATACTGGAAGTGGCGTGCCTGGTGCTACCAGTGAATG
CTTGCGAGATCGTTTTTCGAATTCAGTGATGAAAAAGCGAGAATATTTGG
ATCAACAAATCCAAGAGATGATAAATAAACCAAATGGAGAGAGTTATCGC
GGCAACTCGAATTATGGGTCGAAATCCACGAGTTGAATGAACAAGGTTTT
TACTCGCCTGTCGAGTTACTCCAACGTGAGGGACAAGAGGCCGGCGGTGT
GTTTATGTTACGTCAAGGGTATTCACGCCGTGTCGTGACACAAGTCGTCG
TCCCCAAACATAACAGTCAAGGATCGCAAGGACTTTTGCCAGTTGTTATC
GAGTCCATTTCGAACGTTGCTGTTGGAAGTGTCACCGTCCGAAATAAAAC
ACAAAAGGGACTTGACAGTTATCAAGAACGAGATTTACAGACTGAAATGC
TTGACCGGGTTAACCAGTACAGAACCAGACATTCACTGTCGAAGTTGACG
AAGATTTTTTAGATTACGTCACTGACGGTTCATTGGCTATTGAAGTTTAC
GGTAACCGAAGTAGAGGATATGACACCAAACCAGCTCCGTTGCAATTGCC
TCAGGAAATGGATAATAGTAAATCACTTGTCGACAGATTACAATCAAAGA
AGCTCATGGTTTACCTCTCTCCCTCTGCAATTACGTGTTTGGTCAATACA
CTTTTTTCGATCAAGAACTGTCCGTCATCCCGCCCTTGAACGCGGCCGCC
TCGCCCGTTACCGCCTCGAAATCTAACTCAATGACCTTTAACAACACAAA
AACGAGACGACATCTTTATCACTTGATGGGGACAGTGTCAGCGATGAAGA
TGATATCGAAGGATTGGCCATGGGAAGCTCTGTCAAAGTACAGGACGATA
CTGATGATGACGGTTTATTTTTCGAAGTGGAATGTCACACTTTGATTGGC
GTCGCCACAGTCTGGTTGGAATGTCTGTATCAAAACGTCCCCTTGGATTA
TTCAGCTCCGGTCATTAGTCAGCAGGGTGAAGTCTGTGGACGCATGTCTG
TTGAGATTAGGAGGATACAAGTTTGGTCTGTGGACAAGCTTGGTAATAAA
ATTTATGACATGCGAGATGCTTATCAAACCATCACAGAAAACCCACTAGA
GGCTAACCTGATCCCAACAGCTACACTATCACAAGCCGCCAGTCAAGGGC
CGTTGACAAGCGAAGTAGCGGTCGTAGTGAAACACAAAACGCGTGGCACA
CAAGATGAAAAAGGACGCTGATTTCGCTGTCACGCTTCAGGTAAAAACAA
CGGTACAGTTCAAGGAGTTAGTTATTTCAATTGCGATCCAAATCATGGGT
TATTCATACGCGCTGAAAAATTACTCAAAAGTTGAAACCGAAGCTCCAGT
CGTGCAAGTTCGGCGGGCGATTATTTGCGCGCGCGGCAAACAAACCAACG
AGCCAAATCACAAAACAATCGGTATAGCGTCGGCGCATTCAACAGTCCCT
CCCAATCCCCGCGTATGGCTTTACGACAATACGATATTGATATTGACGGC
GAATCGGCGGGTCGCACGACACCTCCGCGTGACCGCTTGGTCCCGCGTAA
TAACACCACACCTGTGTTACCATCTTTAGTGGAAAGCTCTCCGACAACGA
CTGAGCCACCACAGATGGAACTATTAACCGCGAAACAGAATTTGAGCCGA
ACGAATTCCAAATCGAGTAATGCCGACACTGATGACGATGAGAAACCGAC
CATCATTGTCGGTGACGAAGAAATCCCGAGCCCTCGATTAAAAGTCGGTG
ATGTTGTCAAGATTACCGAAAACTTGGAAGGGCAAGTCCGATTCTACGGG
AAAACTCAATTCGCTGATGGCACTTGGGTCGGAATCGCCTTAACTGTACC
CGAAGTCGAATAGTGATTTGAACAACAGTGAACTTGCACCGTCCAGTGGT
CTCAATGGAATGAACGGAGAACTAAACAAGCCGAGTATGTCAAATTTATG
GCGATCACAAGCGTATCCAGGATTTCACACGTCGAGAATATTTTGAATCT
TCACAAACTTCGTCAAGAAGTCTTGGTCAAAGAGAAGCTGGCAGCTGTTG
GAAGGTCCAGTAAATCACTGACCAATCGGAACATGAGAAAATACGCAAGC
ACACCTAATCTTTTCAACGCTCAATCGGGAGAACAGACGGAAGAACGTGA
ATCACTGGCGCAAAAAGCAGCAGAAGCAATGCATGTCGGGACAGATGGGG
AAGAACTCATGGATGGTGAAGCTATCGATAAATATAATAAAGTTAACACT
ACGATTGAGCAGCCCGGCTTTGGTGAACATTGTATTACGGAAACGTATCT
GTGTCCGTATGTACAAACGCCCAAGTTTGAAGGACTCCTTAAGGCGGAAG
TTTTGGCGTCAAACCAATGTGCCCACCCGTTGTGGCGTACGTTTCGAATT
GATCTCGCACATACCAAGGACAATGCATTGAGCGGGTGTGGAGACATTGA
TGCTGAACCAGCCGGTCATCATTCCTTCCTCTCTTTCGAACAATCCGACT
CAATCATTGGTCTCCCGATTATGAAATACGATCAGAAACGGGTCACAGCA
ACTGCTTCTTGGGATTCGTCTATCCACGATTCTGTATATTTGAACCGGGT
GACACAGAATACGGAACGGGTCTACATTATTTTGAAGGAACCCGTTACCG
GGAATGGAAACGCACATCCCTGTCATCTTTTTGGACCTGGACGACAAATC
CCAAGAGGACAAAGAACACGAGGGAATGTTGATCGACCAATGGGTGTCCT
TAACTGAAGAACGAAACGCCATCTTGTGTCCGAATACTGGAAGTGGCGTG
CCTGGTGCTACCAGTGAATGCTTGCGAGATCGTTTTTCGAATTCAGTGAT
GAAAAAGCGAGAATATTTGGATCAACAAATCCAAGAGATGATAAATAAAC
CAAATGGAGAGAGTTATCGCGGCAACTCGAATTATGGGTCGAAATCCACG
AGTTGAATGAACAAGGTTTTTACTCGCCTGTCGAGTTACTCCAACGTGAG
GGACAAGAGGCCGGCGGTGTGTTTATGTTACGTCAAGGGTATTCACGCCG
TGTCGTGACACAAGTCGTCGTCCCCAAACATAACAGTCAAGGATCGCAAG
GACTTTTGCCAGTTGTTATCGAGTCCATTTCGAACGTTGCTGTTGGAAGT
GTCACCGTCCGAAATAAAACACAAAAGGGACTTGACAGTTATCAAGAACG
AGATTTACAGACTGAAATGCTTGACCGGGTTAACCAGTACAGAACCAGAC
ATTCACTGTCGAAGTTGACGAAGATTTTTTAGATTACGTCACTGACGGTT
CATTGGCTATTGAAGTTTACGGTAACCGAAGTAGAGGATATGACACCAAA
CCAGCTCCGTTGCAATTGCCTCAGGAAATGGATAATAGTAAATCACTTGT
CGACAGATTACAATCAAAGAAGCTCATGGTTTACCTCTCTCCCTCTGCAA
TTACGTGTTTGGTCAATACACTTTTTTCGATCAAGAACTGTCCGTCATCC
CGCCCTTGAACGCGGCCGCCTCGCCCGTTACCGCCTCGAAATCTAACTCA
ATGACCTTTAACAACACAAAAACGAGACGACATCTTTATCACTTGATGGG
GACAGTGTCAGCGATGAAGATGATATCGAAGGATTGGCCATGGGAAGCTC
TGTCAAAGTACAGGACGATACTGATGATGACGGTTTATTTTTCGAAGTGG
AATGTCACACTTTGATTGGCGTCGCCACAGTCTGGTTGGAATGTCTGTAT
CAAAACGTCCCCTTGGATTATTCAGCTCCGGTCATTAGTCAGCAGGGTGA
AGTCTGTGGACGCATGTCTGTTGAGATTAGGAGGATACAAGTTTGGTCTG
TGGACAAGCTTGGTAATAAAATTTATGACATGCGAGATGCTTATCAAACC
ATCACAGAAAACCCACTAGAGGCTAACCTGATCCCAACAGCTACACTATC
ACAAGCCGCCAGTCAAGGGCCGTTGACAAGCGAAGTAGCGGTCGTAGTGA
AACACAAAACGCGTGGCACACAAGATGAAAAAGGACGCTGATTTCGCTGT
CACGCTTCAGGTAAAAACAACGGTACAGTTCAAGGAGTTAGTTATTTCAA
TTGCGATCCAAATCATGGGTTATTCATACGCGCTGAAAAATTACTCAAAA
GTTGAAACCGAAGCTCCAGTCGTGCAAGTTCGGCGGGCGATTATTTGCGC
GCGCGGCAAACAAACCAACGAGCCAAATCACAAAACAATCGGTATAGCGT
CGGCGCATTCAACAGTCCCTCCCAATCCCCGCGTATGGCTTTACGACAAT
ACGATATTGATATTGACGGCGAATCGGCGGGTCGCACGACACCTCCGCGT
GACCGCTTGGTCCCGCGTAATAACACCACACCTGTGTTACCATCTTTAGT
GGAAAGCTCTCCGACAACGACTGAGCCACCACAGATGGAACTATTAACCG
CGAAACAGAATTTGAGCCGAACGAATTCCAAATCGAGTAATGCCGACACT
GATGACGATGAGAAACCGACCATCATTGTCGGTGACGAAGAAATCCCGAG
CCCTCGATTAAAAGTCGGTGATGTTGTCAAGATTACCGAAAACTTGGAAG
GGCAAGTCCGATTCTACGGGAAAACTCAATTCGCTGATGGCACTTGGGTC
GGAATCGCCTTAACTGTACCCGAAGTCGAATAGTGATTTGAACAACAGTG
AACTTGCACCGTCCAGTGGTCTCAATGGAATGAACGGAGAACTAAACAAG
CCGAGTATGTCAAATTTATGGCGATCACAAGCGTATCCAGGATTTCACAC
GTCGAGAATATTTTGAATCTTCACAAACTTCGTCAAGAAGTCTTGGTCAA
AGAGAAGCTGGCAGCTGTTGGAAGGTCCAGTAAATCACTGACCAATCGGA
ACATGAGAAAATACGCAAGCACACCTAATCTTTTCAACGCTCAATCGGGA
GAACAGACGGAAGAACGTGAATCACTGGCGCAAAAAGCAGCAGAAGCAAT
GCATGTCGGGACAGATGGGGAAGAACTCATGGATGGTGAAGCTATCGATA
AATATAATAAAGTTAACACTACGATTGAGCAGCCCGGCTTTGGTGAACAT
TGTATTACGGAAACGTATCTGTGTCCGTATGTACAAACGCCCAAGTTTGA
AGGACTCCTTAAGGCGGAAGTTTTGGCGTCAAACCAATGTGCCCACCCGT
TGTGGCGTACGTTTCGAATTGATCTCGCACATACCAAGGACAATGCATTG
AGCGGGTGTGGAGACATTGATGCTGAACCAGCCGGTCATCATTCCTTCCT
CTCTTTCGAACAATCCGACTCAATCATTGGTCTCCCGATTATGAAATACG
ATCAGAAACGGGTCACAGCAACTGCTTCTTGGGATTCGTCTATCCACGAT
TCTGTATATTTGAACCGGGTGACACAGAATACGGAACGGGTCTACATTAT
TTTGAAGGAACCCGTTACCGGGAATGGAAACGCACATCCCTGTCATCTTT
TTGGACCTGGACGACAAATCCCAAGAGGACAAAGAACACGAGGGAATGTT
GATCGACCAATGGGTGTCCTTAACTGAAGAACGAAACGCCATCTTGTGTC
CGAATACTGGAAGTGGCGTGCCTGGTGCTACCAGTGAATGCTTGCGAGAT
CGTTTTTCGAATTCAGTGATGAAAAAGCGAGAATATTTGGATCAACAAAT
CCAAGAGATGATAAATAAACCAAATGGAGAGAGTTATCGCGGCAACTCGA
ATTATGGGTCGAAATCCACGAGTTGAATGAACAAGGTTTTTACTCGCCTG
TCGAGTTACTCCAACGTGAGGGACAAGAGGCCGGCGGTGTGTTTATGTTA
CGTCAAGGGTATTCACGCCGTGTCGTGACACAAGTCGTCGTCCCCAAACA
TAACAGTCAAGGATCGCAAGGACTTTTGCCAGTTGTTATCGAGTCCATTT
CGAACGTTGCTGTTGGAAGTGTCACCGTCCGAAATAAAACACAAAAGGGA
CTTGACAGTTATCAAGAACGAGATTTACAGACTGAAATGCTTGACCGGGT
TAACCAGTACAGAACCAGACATTCACTGTCGAAGTTGACGAAGATTTTTT
AGATTACGTCACTGACGGTTCATTGGCTATTGAAGTTTACGGTAACCGAA
GTAGAGGATATGACACCAAACCAGCTCCGTTGCAATTGCCTCAGGAAATG
GATAATAGTAAATCACTTGTCGACAGATTACAATCAAAGAAGCTCATGGT
TTACCTCTCTCCCTCTGCAATTACGTGTTTGGTCAATACACTTTTTTCGA
TCAAGAACTGTCCGTCATCCCGCCCTTGAACGCGGCCGCCTCGCCCGTTA
CCGCCTCGAAATCTAACTCAATGACCTTTAACAACACAAAAACGAGACGA
CATCTTTATCACTTGATGGGGACAGTGTCAGCGATGAAGATGATATCGAA
GGATTGGCCATGGGAAGCTCTGTCAAAGTACAGGACGATACTGATGATGA
CGGTTTATTTTTCGAAGTGGAATGTCACACTTTGATTGGCGTCGCCACAG
TCTGGTTGGAATGTCTGTATCAAAACGTCCCCTTGGATTATTCAGCTCCG
GTCATTAGTCAGCAGGGTGAAGTCTGTGGACGCATGTCTGTTGAGATTAG
GAGGATACAAGTTTGGTCTGTGGACAAGCTTGGTAATAAAATTTATGACA
TGCGAGATGCTTATCAAACCATCACAGAAAACCCACTAGAGGCTAACCTG
ATCCCAACAGCTACACTATCACAAGCCGCCAGTCAAGGGCCGTTGACAAG
CGAAGTAGCGGTCGTAGTGAAACACAAAACGCGTGGCACACAAGATGAAA
AAGGACGCTGATTTCGCTGTCACGCTTCAGGTAAAAACAACGGTACAGTT
CAAGGAGTTAGTTATTTCAATTGCGATCCAAATCATGGGTTATTCATACG
CGCTGAAAAATTACTCAAAAGTTGAAACCGAAGCTCCAGTCGTGCAAGTT
CGGCGGGCGATTATTTGCGCGCGCGGCAAACAAACCAACGAGCCAAATCA
CAAAACAATCGGTATAGCGTCGGCGCATTCAACAGTCCCTCCCAATCCCC
GCGTATGGCTTTACGACAATACGATATTGATATTGACGGCGAATCGGCGG
GTCGCACGACACCTCCGCGTGACCGCTTGGTCCCGCGTAATAACACCACA
CCTGTGTTACCATCTTTAGTGGAAAGCTCTCCGACAACGACTGAGCCACC
ACAGATGGAACTATTAACCGCGAAACAGAATTTGAGCCGAACGAATTCCA
AATCGAGTAATGCCGACACTGATGACGATGAGAAACCGACCATCATTGTC
GGTGACGAAGAAATCCCGAGCCCTCGATTAAAAGTCGGTGATGTTGTCAA
GATTACCGAAAACTTGGAAGGGCAAGTCCGATTCTACGGGAAAACTCAAT
TCGCTGATGGCACTTGGGTCGGAATCGCCTTAACTGTACCCGAAGTCGAA
TAGTGATTTGAACAACAGTGAACTTGCACCGTCCAGTGGTCTCAATGGAA
TGAACGGAGAACTAAACAAGCCGAGTATGTCAAATTTATGGCGATCACAA
GCGTATCCAGGATTTCACACGTCGAGAATATTTTGAATCTTCACAAACTT
CGTCAAGAAGTCTTGGTCAAAGAGAAGCTGGCAGCTGTTGGAAGGTCCAG
TAAATCACTGACCAATCGGAACATGAGAAAATACGCAAGCACACCTAATC
TTTTCAACGCTCAATCGGGAGAACAGACGGAAGAACGTGAATCACTGGCG
CAAAAAGCAGCAGAAGCAATGCATGTCGGGACAGATGGGGAAGAACTCAT
GGATGGTGAAGCTATCGATAAATATAATAAAGTTAACACTACGATTGAGC
AGCCCGGCTTTGGTGAACATTGTATTACGGAAACGTATCTGTGTCCGTAT
GTACAAACGCCCAAGTTTGAAGGACTCCTTAAGGCGGAAGTTTTGGCGTC
AAACCAATGTGCCCACCCGTTGTGGCGTACGTTTCGAATTGATCTCGCAC
ATACCAAGGACAATGCATTGAGCGGGTGTGGAGACATTGATGCTGAACCA
GCCGGTCATCATTCCTTCCTCTCTTTCGAACAATCCGACTCAATCATTGG
TCTCCCGATTATGAAATACGATCAGAAACGGGTCACAGCAACTGCTTCTT
GGGATTCGTCTATCCACGATTCTGTATATTTGAACCGGGTGACACAGAAT
ACGGAACGGGTCTACATTATTTTGAAGGAACCCGTTACCGGGAATGGAAA
CGCACATCCCTGTCATCTTTTTGGACCTGGACGACAAATCCCAAGAGGAC
AAAGAACACGAGGGAATGTTGATCGACCAATGGGTGTCCTTAACTGAAGA
ACGAAACGCCATCTTGTGTCCGAATACTGGAAGTGGCGTGCCTGGTGCTA
CCAGTGAATGCTTGCGAGATCGTTTTTCGAATTCAGTGATGAAAAAGCGA
GAATATTTGGATCAACAAATCCAAGAGATGATAAATAAACCAAATGGAGA
GAGTTATCGCGGCAACTCGAATTATGGGTCGAAATCCACGAGTTGAATGA
ACAAGGTTTTTACTCGCCTGTCGAGTTACTCCAACGTGAGGGACAAGAGG
CCGGCGGTGTGTTTATGTTACGTCAAGGGTATTCACGCCGTGTCGTGACA
CAAGTCGTCGTCCCCAAACATAACAGTCAAGGATCGCAAGGACTTTTGCC
AGTTGTTATCGAGTCCATTTCGAACGTTGCTGTTGGAAGTGTCACCGTCC
GAAATAAAACACAAAAGGGACTTGACAGTTATCAAGAACGAGATTTACAG
ACTGAAATGCTTGACCGGGTTAACCAGTACAGAACCAGACATTCACTGTC
GAAGTTGACGAAGATTTTTTAGATTACGTCACTGACGGTTCATTGGCTAT
TGAAGTTTACGGTAACCGAAGTAGAGGATATGACACCAAACCAGCTCCGT
TGCAATTGCCTCAGGAAATGGATAATAGTAAATCACTTGTCGACAGATTA
CAATCAAAGAAGCTCATGGTTTACCTCTCTCCCTCTGCAATTACGTGTTT
GGTCAATACACTTTTTTCGATCAAGAACTGTCCGTCATCCCGCCCTTGAA
CGCGGCCGCCTCGCCCGTTACCGCCTCGAAATCTAACTCAATGACCTTTA
ACAACACAAAAACGAGACGACATCTTTATCACTTGATGGGGACAGTGTCA
GCGATGAAGATGATATCGAAGGATTGGCCATGGGAAGCTCTGTCAAAGTA
CAGGACGATACTGATGATGACGGTTTATTTTTCGAAGTGGAATGTCACAC
TTTGATTGGCGTCGCCACAGTCTGGTTGGAATGTCTGTATCAAAACGTCC
CCTTGGATTATTCAGCTCCGGTCATTAGTCAGCAGGGTGAAGTCTGTGGA
CGCATGTCTGTTGAGATTAGGAGGATACAAGTTTGGTCTGTGGACAAGCT
TGGTAATAAAATTTATGACATGCGAGATGCTTATCAAACCATCACAGAAA
ACCCACTAGAGGCTAACCTGATCCCAACAGCTACACTATCACAAGCCGCC
AGTCAAGGGCCGTTGACAAGCGAAGTAGCGGTCGTAGTGAAACACAAAAC
GCGTGGCACACAAGATGAAAAAGGACGCTGATTTCGCTGTCACGCTTCAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000098XLOC_000098Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000167-exon-sc0000001-1575043694:590757..591162TCONS_00000167-exon-sc0000001-1575043694:590757..591162Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:580847..580922TCONS_00000167-exon-sc0000001-1575043694:580847..580922Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:579638..579698TCONS_00000167-exon-sc0000001-1575043694:579638..579698Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:578496..578588TCONS_00000167-exon-sc0000001-1575043694:578496..578588Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:577307..577493TCONS_00000167-exon-sc0000001-1575043694:577307..577493Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:577001..577088TCONS_00000167-exon-sc0000001-1575043694:577001..577088Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:576268..576402TCONS_00000167-exon-sc0000001-1575043694:576268..576402Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:573417..573575TCONS_00000167-exon-sc0000001-1575043694:573417..573575Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:572933..573056TCONS_00000167-exon-sc0000001-1575043694:572933..573056Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:572234..572331TCONS_00000167-exon-sc0000001-1575043694:572234..572331Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:570972..571145TCONS_00000167-exon-sc0000001-1575043694:570972..571145Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:570438..570572TCONS_00000167-exon-sc0000001-1575043694:570438..570572Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:566535..566576TCONS_00000167-exon-sc0000001-1575043694:566535..566576Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:565962..566062TCONS_00000167-exon-sc0000001-1575043694:565962..566062Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:565364..565482TCONS_00000167-exon-sc0000001-1575043694:565364..565482Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:564688..564765TCONS_00000167-exon-sc0000001-1575043694:564688..564765Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:564005..564061TCONS_00000167-exon-sc0000001-1575043694:564005..564061Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:563257..563469TCONS_00000167-exon-sc0000001-1575043694:563257..563469Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:562881..563010TCONS_00000167-exon-sc0000001-1575043694:562881..563010Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:561808..561901TCONS_00000167-exon-sc0000001-1575043694:561808..561901Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:561001..561089TCONS_00000167-exon-sc0000001-1575043694:561001..561089Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:560363..560540TCONS_00000167-exon-sc0000001-1575043694:560363..560540Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:559764..559855TCONS_00000167-exon-sc0000001-1575043694:559764..559855Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:558749..558913TCONS_00000167-exon-sc0000001-1575043694:558749..558913Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:558030..558187TCONS_00000167-exon-sc0000001-1575043694:558030..558187Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:556492..556527TCONS_00000167-exon-sc0000001-1575043694:556492..556527Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:554682..554990TCONS_00000167-exon-sc0000001-1575043694:554682..554990Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:553989..554071TCONS_00000167-exon-sc0000001-1575043694:553989..554071Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:553660..553786TCONS_00000167-exon-sc0000001-1575043694:553660..553786Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:553167..553222TCONS_00000167-exon-sc0000001-1575043694:553167..553222Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:552173..552390TCONS_00000167-exon-sc0000001-1575043694:552173..552390Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:548967..549143TCONS_00000167-exon-sc0000001-1575043694:548967..549143Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:548314..548434TCONS_00000167-exon-sc0000001-1575043694:548314..548434Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:547699..547850TCONS_00000167-exon-sc0000001-1575043694:547699..547850Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:547199..547237TCONS_00000167-exon-sc0000001-1575043694:547199..547237Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:546668..546742TCONS_00000167-exon-sc0000001-1575043694:546668..546742Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:545960..546479TCONS_00000167-exon-sc0000001-1575043694:545960..546479Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1575043694:544789..545444TCONS_00000167-exon-sc0000001-1575043694:544789..545444Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:590757..591162TCONS_00000167-exon-sc0000001-1510915933:590757..591162Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:580847..580922TCONS_00000167-exon-sc0000001-1510915933:580847..580922Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:579638..579698TCONS_00000167-exon-sc0000001-1510915933:579638..579698Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:578496..578588TCONS_00000167-exon-sc0000001-1510915933:578496..578588Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:577307..577493TCONS_00000167-exon-sc0000001-1510915933:577307..577493Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:577001..577088TCONS_00000167-exon-sc0000001-1510915933:577001..577088Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:576268..576402TCONS_00000167-exon-sc0000001-1510915933:576268..576402Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:573417..573575TCONS_00000167-exon-sc0000001-1510915933:573417..573575Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:572933..573056TCONS_00000167-exon-sc0000001-1510915933:572933..573056Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:572234..572331TCONS_00000167-exon-sc0000001-1510915933:572234..572331Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:570972..571145TCONS_00000167-exon-sc0000001-1510915933:570972..571145Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:570438..570572TCONS_00000167-exon-sc0000001-1510915933:570438..570572Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:566535..566576TCONS_00000167-exon-sc0000001-1510915933:566535..566576Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:565962..566062TCONS_00000167-exon-sc0000001-1510915933:565962..566062Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:565364..565482TCONS_00000167-exon-sc0000001-1510915933:565364..565482Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:564688..564765TCONS_00000167-exon-sc0000001-1510915933:564688..564765Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:564005..564061TCONS_00000167-exon-sc0000001-1510915933:564005..564061Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:563257..563469TCONS_00000167-exon-sc0000001-1510915933:563257..563469Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:562881..563010TCONS_00000167-exon-sc0000001-1510915933:562881..563010Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:561808..561901TCONS_00000167-exon-sc0000001-1510915933:561808..561901Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:561001..561089TCONS_00000167-exon-sc0000001-1510915933:561001..561089Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:560363..560540TCONS_00000167-exon-sc0000001-1510915933:560363..560540Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:559764..559855TCONS_00000167-exon-sc0000001-1510915933:559764..559855Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:558749..558913TCONS_00000167-exon-sc0000001-1510915933:558749..558913Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:558030..558187TCONS_00000167-exon-sc0000001-1510915933:558030..558187Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:556492..556527TCONS_00000167-exon-sc0000001-1510915933:556492..556527Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:554682..554990TCONS_00000167-exon-sc0000001-1510915933:554682..554990Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:553989..554071TCONS_00000167-exon-sc0000001-1510915933:553989..554071Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:553660..553786TCONS_00000167-exon-sc0000001-1510915933:553660..553786Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:553167..553222TCONS_00000167-exon-sc0000001-1510915933:553167..553222Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:552173..552390TCONS_00000167-exon-sc0000001-1510915933:552173..552390Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:548967..549143TCONS_00000167-exon-sc0000001-1510915933:548967..549143Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:548314..548434TCONS_00000167-exon-sc0000001-1510915933:548314..548434Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:547699..547850TCONS_00000167-exon-sc0000001-1510915933:547699..547850Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:547199..547237TCONS_00000167-exon-sc0000001-1510915933:547199..547237Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:546668..546742TCONS_00000167-exon-sc0000001-1510915933:546668..546742Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:545960..546479TCONS_00000167-exon-sc0000001-1510915933:545960..546479Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1510915933:544789..545444TCONS_00000167-exon-sc0000001-1510915933:544789..545444Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:590757..591162TCONS_00000167-exon-sc0000001-1491911889:590757..591162Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:580847..580922TCONS_00000167-exon-sc0000001-1491911889:580847..580922Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:579638..579698TCONS_00000167-exon-sc0000001-1491911889:579638..579698Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:578496..578588TCONS_00000167-exon-sc0000001-1491911889:578496..578588Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:577307..577493TCONS_00000167-exon-sc0000001-1491911889:577307..577493Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:577001..577088TCONS_00000167-exon-sc0000001-1491911889:577001..577088Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:576268..576402TCONS_00000167-exon-sc0000001-1491911889:576268..576402Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:573417..573575TCONS_00000167-exon-sc0000001-1491911889:573417..573575Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:572933..573056TCONS_00000167-exon-sc0000001-1491911889:572933..573056Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:572234..572331TCONS_00000167-exon-sc0000001-1491911889:572234..572331Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:570972..571145TCONS_00000167-exon-sc0000001-1491911889:570972..571145Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:570438..570572TCONS_00000167-exon-sc0000001-1491911889:570438..570572Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:566535..566576TCONS_00000167-exon-sc0000001-1491911889:566535..566576Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:565962..566062TCONS_00000167-exon-sc0000001-1491911889:565962..566062Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:565364..565482TCONS_00000167-exon-sc0000001-1491911889:565364..565482Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:564688..564765TCONS_00000167-exon-sc0000001-1491911889:564688..564765Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:564005..564061TCONS_00000167-exon-sc0000001-1491911889:564005..564061Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:563257..563469TCONS_00000167-exon-sc0000001-1491911889:563257..563469Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:562881..563010TCONS_00000167-exon-sc0000001-1491911889:562881..563010Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:561808..561901TCONS_00000167-exon-sc0000001-1491911889:561808..561901Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:561001..561089TCONS_00000167-exon-sc0000001-1491911889:561001..561089Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:560363..560540TCONS_00000167-exon-sc0000001-1491911889:560363..560540Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:559764..559855TCONS_00000167-exon-sc0000001-1491911889:559764..559855Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:558749..558913TCONS_00000167-exon-sc0000001-1491911889:558749..558913Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:558030..558187TCONS_00000167-exon-sc0000001-1491911889:558030..558187Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:556492..556527TCONS_00000167-exon-sc0000001-1491911889:556492..556527Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:554682..554990TCONS_00000167-exon-sc0000001-1491911889:554682..554990Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:553989..554071TCONS_00000167-exon-sc0000001-1491911889:553989..554071Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:553660..553786TCONS_00000167-exon-sc0000001-1491911889:553660..553786Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:553167..553222TCONS_00000167-exon-sc0000001-1491911889:553167..553222Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:552173..552390TCONS_00000167-exon-sc0000001-1491911889:552173..552390Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:548967..549143TCONS_00000167-exon-sc0000001-1491911889:548967..549143Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:548314..548434TCONS_00000167-exon-sc0000001-1491911889:548314..548434Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:547699..547850TCONS_00000167-exon-sc0000001-1491911889:547699..547850Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:547199..547237TCONS_00000167-exon-sc0000001-1491911889:547199..547237Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:546668..546742TCONS_00000167-exon-sc0000001-1491911889:546668..546742Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:545960..546479TCONS_00000167-exon-sc0000001-1491911889:545960..546479Clytia hemisphaericaexon
TCONS_00000167-exon-sc0000001-1491911889:544789..545444TCONS_00000167-exon-sc0000001-1491911889:544789..545444Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000167-proteinTCONS_00000167-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:544789..591162 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.442551 0.376748 0.000509167 1.46759 1.75911 0.412368 7.62809 9.15345 2.31002 5.27018 7.52001 6.37128 14.548 19.5808 13.2615 17.4524 10.6414 10.721 7.57785 13.0553 3.24767 7.09977 3.2342e-05 4.17696 6.64941 6.81568 0.000482752 4.55609 14.9261 11.4535
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000938CAP-Gly_domain
IPR022140Kinesin-like_KIF1-typ
IPR000008C2_dom
IPR022164Kinesin-like
Blast
BLAST of TCONS_00000167 vs. Swiss-Prot (Human)
Match: KI13A (Kinesin-like protein KIF13A OS=Homo sapiens GN=KIF13A PE=1 SV=2)

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 366/595 (61.51%), Postives = 460/595 (77.31%), Query Frame = 3
Query:  480 KTFAYDHCFWSMDPNNKEKFSSQEYVFSCLGNDVLDNAFNGYNACIFAYGQTGSGKSYTMMGAPGQKGLIPRICDTLFDKISAAVEKDKSTTFKVEVSYMEIYNEKVRDLLCPKSDKHNLKVREHKILGTYVDGLSKLLVHGYNDIENLMSEGNKSRTIAATSMNAESSRSHAVFSVVMTQSQSDEATGLVGEKAAKISLVDLAGSERASKTNASGDRLKEGSNINKSLTTLGLVISALADQASGKSKKSNFVPYRDSVLTWILKDNLGGNSKTVMVATISPAGDNYEETLSTLRYADRAKRIENHAVINEDPNATLIRELRGEVEKLRAQLLKHGIAQDTESLQEALDQNEKLMEEASLTWEQKEKQTERIHQERHKILKEMGISVQDAGIAVEKGRYYLVNLNADPSLNEMLVYYLKDHTKIGKSDASDPQDIQLNGLGLQPQHCVIDIDNEEDTSYIVPFEGARTCVNGQVITERTQLRHGDRILWGNNHFFRINCP-------------HSPPP-------PGTQSEEKLDFDFAQNELMLNEFDSLGEPLQNIIQQLENQHEKEKQGALDQQKEMYEQKLEELRRERTPD 2204
            K FA+D+CFWSMD +N  K++ QE VF CLG  +L+ AF GYNACIFAYGQTGSGKS++MMG   Q GLIPR+C  LF +IS  +E+++S TFKVEVSYMEIYNEKVRDLL PK  + +LKVREHK+LG YVDGLS+L V  + DIE+LMSEGNKSRT+AAT+MN ESSRSHAVF++++TQ+  D  +G  GEK +K+SLVDLAGSER SKT A+G+RLKEGSNINKSLTTLGLVIS+LADQA+GK  KS FVPYRDSVLTW+LKDNLGGNS+T M+ATISPA DNYEETLSTLRYADRAKRI NHAV+NEDPNA +IRELR EVEKLR Q L    A     L+E L+++EKL++E ++TWE+K ++TE I QER + L+ MGIS++ +GI V   + YLVNLNADP+LNE+LVYYLKDHT++G   A   QDIQL G+G+QPQHC IDI ++ D + + P E AR+CVNG ++   TQL HGDRILWGNNHFFRIN P              + PP           SE   +++FAQ E+++   +S  +P+QN++Q LE Q+ +EK+ AL++Q+ MYE++LE+LR++ +PD
Sbjct:   53 KVFAFDYCFWSMDESNTTKYAGQEVVFKCLGEGILEKAFQGYNACIFAYGQTGSGKSFSMMGHAEQLGLIPRLCCALFKRIS--LEQNESQTFKVEVSYMEIYNEKVRDLLDPKGSRQSLKVREHKVLGPYVDGLSQLAVTSFEDIESLMSEGNKSRTVAATNMNEESSRSHAVFNIIITQTLYDLQSGNSGEKVSKVSLVDLAGSERVSKTGAAGERLKEGSNINKSLTTLGLVISSLADQAAGKG-KSKFVPYRDSVLTWLLKDNLGGNSQTSMIATISPAADNYEETLSTLRYADRAKRIVNHAVVNEDPNAKVIRELREEVEKLREQ-LSQAEAMKAPELKEKLEESEKLIKELTVTWEEKLRKTEEIAQERQRQLESMGISLEMSGIKVGDDKCYLVNLNADPALNELLVYYLKDHTRVG---ADTSQDIQLFGIGIQPQHCEIDIASDGDVT-LTPKENARSCVNGTLVCSTTQLWHGDRILWGNNHFFRINLPKRKRRDWLKDFEKETGPPEHDLDAASEASSEPDYNYEFAQMEVIMKTLNS-NDPVQNVVQVLEKQYLEEKRSALEEQRLMYERELEQLRQQLSPD 638          

HSP 2 Score: 559.296 bits (1440), Expect = 2.165e-166
Identity = 322/745 (43.22%), Postives = 454/745 (60.94%), Query Frame = 2
Query: 2399 ANVLVREANQLSSEMKKDADFAVTLQIPTATLSQAASQGPLTSEVAVVVKHKTRGTQVWSVDKLGNKIYDMRDAYQTITENPLEAN-LDDTDDDGLFFEVECHTLIGVATVWLECLYQNVPLDYSAPVISQQGEVCGRMSVEIRRI-----------QDETTSLSLDGDSVSDEDDIEGLAMGSSVKVQITIKEAHGLPLSLCNYVFGQYTFFDQ-ELSVIPPL--NAAASPVTASKSNSMTFNNTKTFTVEVDEDFLDYVTDGSLAIEVYGNRSRGYDTKPAPLQLPQEMDNSKSLVDSEMLD-RVNQYRTRWRELSRQLELWVEIHELNEQGFYSPVELLQREGQEAGGVFMLRQGYSRRVVTQVVVPKHNSQGSQGLLPVVIESISNVAVGSVTVRN-KTQKGLDSYQ-------------ERDLQTLRDRFSNSVMKKREYLDQQIQEMINKPNKSQEDKEHEGMLIDQWVSLTEERNAILCPNTGSGVPGATSEWNPLPGMETHIPVIFLDLDDNALSGCGD-IDAEPAGHHSFLSFEQSDSIIGLPIMKYDQKRVTATASWDSSIHDSVYLNRVTQNTERVYIILKLTLRLSSPALVNIVLRKRICVRMYKRPSLKDSLRRKFWRQTNVPTRCGVRFELISHIPRQSGEQTEERESLAQKAAEAMHVGTDGEELMDGEA-IDKYNKGISHVENILNLHKLRQEVLVKEKLAAVGRSSKSLTNRNMRKYASTPNLFNAPS 4537
            AN LVREAN L+ EM K  D+ VTLQIP A LS    +G + SE A+ V+ K + TQVW+++KL NK+ DMRD YQ   E   EA  L     D  +   E H LIGVA V+LECL+ +V L Y+ P+ISQQGEV GR+ VE+ R+                S       V D    E +     +  ++ IKEA GLPL+L N+VF QYTF+DQ E +V  P+      SP +     ++TF++ K + V V E+FL++++DG+LAIEV+G+R  G               N  S+ + + L  +      RW E++R++E+W+ I ELNE G Y+ VEL Q +    GG+F LRQG+SRRV   V   +H+     G LP+++E+I +V++G VT R+ K Q+GLDSYQ             E DL  +R+R+S++++K+REYLD+QI+++ NK  K+++D E E  L++QWV LTEERNA+L P  GSG+PGA ++W P PGMETHIPV+FLDL+ + LS     +    +G +S L  E       LPI+K+    V+ATASWDSS+HDSV+LNRVT   ER+Y+I+K T++LS PA + +VLRKRI   +Y + S   SL+R+     N+   CGV +E++S+IP+ + E+ E+RE+LA  AA + + GT      DGE  I+KY +G+  VENIL+L +LRQ V VKE L        S   R++R+  STPN+ N  S
Sbjct:  685 ANTLVREANFLAEEMSKLTDYQVTLQIPAANLSANRKRGAIVSEPAIQVRRKGKSTQVWTIEKLENKLIDMRDLYQEWKEKVPEAKRLYGKRGDPFYEAQENHNLIGVANVFLECLFCDVKLQYAVPIISQQGEVAGRLHVEVMRVTGAVPERVVEDDSSENSSESGSLEVVDSSG-EIIHRVKKLTCRVKIKEATGLPLNLSNFVFCQYTFWDQCESTVAAPVVDPEVPSPQSKDAQYTVTFSHCKDYVVNVTEEFLEFISDGALAIEVWGHRCAG---------------NGSSIWEVDSLHAKTRTLHDRWNEVTRRIEMWISILELNELGEYAAVELHQAKDVNTGGIFQLRQGHSRRVQVTVKPVQHS-----GTLPLMVEAILSVSIGCVTARSTKLQRGLDSYQRDDEDGDDMDSYQEEDLNCVRERWSDALIKRREYLDEQIKKVSNKTEKTEDDVEREAQLVEQWVGLTEERNAVLVPAPGSGIPGAPADWIPPPGMETHIPVLFLDLNADDLSANEQLVGPHASGVNSILPKEHGSQFFYLPIIKHSDDEVSATASWDSSVHDSVHLNRVTPQNERIYLIVKTTVQLSHPAAMELVLRKRIAANIYNKQSFTQSLKRRI-SLKNIFYSCGVTYEIVSNIPKAT-EEIEDRETLALLAARSENEGTS-----DGETYIEKYTRGVLQVENILSLERLRQAVTVKEAL--------STKARHIRRSLSTPNVHNVSS 1393          
The following BLAST results are available for this feature:
BLAST of TCONS_00000167 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KI13A2.165e-16661.51Kinesin-like protein KIF13A OS=Homo sapiens GN=KIF... [more]
back to top