Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000151 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000151
Unique NameTCONS_00000151
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1053

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000151 ID=TCONS_00000151|Name=TCONS_00000151|organism=Clytia hemisphaerica|type=transcript|length=1053bp
TTTTACAGAATATTTAGAACACAAAACAAACGTCATAATGATTCTTGGAC
ATTTAGCTTCCTTCTGCGCATGCGTTATTGCATTCGTCCTATTAACCCTT
GGATGTGCTGGTAACAACTGGATTACACAAACGGTTGGAGATCAAGAAGC
AAGCATGGGATTATGGAAAGCATGTTTTGTTCACGTGTGCAAAGAATTTT
CAACTGACGGTCACTCATTCTACGATAGTTGCAAAGCACTCTCGACTTTA
GCTGTCATCGTCAGTGGAGTTGCTATGTTAGGATATGTTATTAATTGGTA
TAGTCCAGATAGTACTATTGGTATGTTGGGTGGTATACCGTATATTTCAT
CTGGCCTATTGTTTATATCAGGTTCTCTAATGGCTGGAGCAGCTCGAGTT
TATGGAAGCAATATCTTTGATCAATTTAGCATAATTGAATTTGGTTGGTC
ATATTTCATGGCGTATGCTTCGGCCGCTTTTTGTTACTTGGTCACAGCTG
CTACAGCAATAAGCTATAAATGTGCTTATGATAGGTGTTGTGCAAATGAG
TATCAAGCAATTTAAACTGATgaaatttttatattaaatCCTTACATCGC
AGATCTGGTGAAGCTTCCCAgttggcacataacgttgttccaacgtttaa
ataacgttcacaacgtccatataacgttaaatgaacgttgaaacaacgtt
gtgtgccagctgggttaagATTCCATAAGCACGCAGCAGCCCAGGGTGGG
GGGGGTAATAGGGTTGGTGGATGAGGGGTATGTACGgatgggacctccaa
aaacTGACCTTtaaagagactgatttttgctgaaaaggcgACCCTTGCTG
AGacttttatgaaaaatctttttcgatttttgaaaaactcccTACTCTTA
GATTTCCCAAGTAAAAATCtagaattttccgacccttagagagactgatt
taaatttttctaatttttgcgacccttagagagactttgaagggTGAAAA
AATCGCCCCttaccgtctgcacataccTAGCACCAATTTTTGCctaatta
ccc
Run BLAST on NCBI

protein sequence of TCONS_00000151-protein

>TCONS_00000151-protein ID=TCONS_00000151-protein|Name=TCONS_00000151-protein|organism=Clytia hemisphaerica|type=polypeptide|length=187bp
FTEYLEHKTNVIMILGHLASFCACVIAFVLLTLGCAGNNWITQTVGDQEA
SMGLWKACFVHVCKEFSTDGHSFYDSCKALSTLAVIVSGVAMLGYVINWY
SPDSTIGMLGGIPYISSGLLFISGSLMAGAARVYGSNIFDQFSIIEFGWS
YFMAYASAAFCYLVTAATAISYKCAYDRCCANEYQAI
Run BLAST on NCBI

transcript from alignment at sc0000001:287834..289382-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000151 ID=TCONS_00000151|Name=TCONS_00000151|organism=Clytia hemisphaerica|type=transcript|length=1549bp|location=Sequence derived from alignment at sc0000001:287834..289382- (Clytia hemisphaerica)
TTTTACAGAATATTTAGAACACAAAACAAACGTCATAATGATTCTTGGAC ATTTAGCTTCCTTCTGCGCATGCGTTATTGCATTCGTCCTATTAACCCTT GGATGTGCTGGTAACAACTGGATTACACAAACGGTTGGAGATCAAGAAGC AAGCATGGGATTATGGAAAGCATGTTTTGTTCACGTGTGCAAAGAATTTT CAACTGACGGTCACTCATTCTACGATAGTTGCAAAGCACTCTCGACTTTA GCTGTCATCGTCAGTGGAGTTGCTATGTTAGGATATGTTATTAATTGGTA TAGTCCAGATAGTACTATTGGTATGTTGGGTGGTATACCGTATATTTCAT CTGGCCTATTGTTTATATCAGGTAATTTTTGTGACTCTGGTTTTTCCACT CCATGCCATGTCACGGACTCGGAAAAACCCACTACACGTTTTTTATAAGA AAATTCAAAAATTTTGAAGCTTTTGGATGTTCTTAACTATCTGGGGTTAA AGGTGTTTTAGCATGTTCTTATTTTCACCATTTTGTGAGTATTTTGCTAT AGAAGCATGAGTGTGCATTAAGTCTGTGATAAATGGGTGTCTTATGCCAT TTGGGCTGTCTGACCCACCTGAAACTTTTTAAAAGGGGGACCATTTTCAA GGGGGCTGGGGCTAACACAAGAATCCGGATAATAATTCTAAGAATTTTTG ATAAGAATGATAATTTGGAAACAACATTCTGATGAGTATCAGAAAAGTAT CAAAAAAAAAGACCTTTTGATGTTTTAACCATCTCAAAACGAACCTTTCC AGATTCAAAGTATAGAAATCAATTCCCAATTAAAAACATTTGGTATCTTT TCTTTTCATCTTTACAGGTTCTCTAATGGCTGGAGCAGCTCGAGTTTATG GAAGCAATATCTTTGATCAATTTAGCATAATTGAATTTGGTTGGTCATAT TTCATGGCGTATGCTTCGGCCGCTTTTTGTTACTTGGTCACAGCTGCTAC AGCAATAAGCTATAAATGTGCTTATGATAGGTGTTGTGCAAATGAGTATC AAGCAATTTAAACTGATGAAATTTTTATATTAAATCCTTACATCGCAGAT CTGGTGAAGCTTCCCAGTTGGCACATAACGTTGTTCCAACGTTTAAATAA CGTTCACAACGTCCATATAACGTTAAATGAACGTTGAAACAACGTTGTGT GCCAGCTGGGTTAAGATTCCATAAGCACGCAGCAGCCCAGGGTGGGGGGG GTAATAGGGTTGGTGGATGAGGGGTATGTACGGATGGGACCTCCAAAAAC TGACCTTTAAAGAGACTGATTTTTGCTGAAAAGGCGACCCTTGCTGAGAC TTTTATGAAAAATCTTTTTCGATTTTTGAAAAACTCCCTACTCTTAGATT TCCCAAGTAAAAATCTAGAATTTTCCGACCCTTAGAGAGACTGATTTAAA TTTTTCTAATTTTTGCGACCCTTAGAGAGACTTTGAAGGGTGAAAAAATC GCCCCTTACCGTCTGCACATACCTAGCACCAATTTTTGCCTAATTACCC

Coding sequence (CDS) from alignment at sc0000001:287834..289382-

>TCONS_00000151 ID=TCONS_00000151|Name=TCONS_00000151|organism=Clytia hemisphaerica|type=CDS|length=1128bp|location=Sequence derived from alignment at sc0000001:287834..289382- (Clytia hemisphaerica)
GTTCTCTAATGGCTGGAGCAGCTCGAGTTTATGGAAGCAATATCTTTGAT
CAATTTAGCATAATTGAATTTGGTTGGTCATATTTCATGGCGTATGCTTC
GGCCGCTTTTTGTTACTTGGTCACAGCTGCTACAGCAATAAGCTATAAAT
GTGCTTATGATAGGTGTTGTGCAAATGAGTATCAAGCAATTTAATTTACA
GAATATTTAGAACACAAAACAAACGTCATAATGATTCTTGGACATTTAGC
TTCCTTCTGCGCATGCGTTATTGCATTCGTCCTATTAACCCTTGGATGTG
CTGGTAACAACTGGATTACACAAACGGTTGGAGATCAAGAAGCAAGCATG
GGATTATGGAAAGCATGTTTTGTTCACGTGTGCAAAGAATTTTCAACTGA
CGGTCACTCATTCTACGATAGTTGCAAAGCACTCTCGACTTTAGCTGTCA
TCGTCAGTGGAGTTGCTATGTTAGGATATGTTATTAATTGGTATAGTCCA
GATAGTACTATTGGTATGTTGGGTGGTATACCGTATATTTCATCTGGCCT
ATTGTTTATATCAGGTTCTCTAATGGCTGGAGCAGCTCGAGTTTATGGAA
GCAATATCTTTGATCAATTTAGCATAATTGAATTTGGTTGGTCATATTTC
ATGGCGTATGCTTCGGCCGCTTTTTGTTACTTGGTCACAGCTGCTACAGC
AATAAGCTATAAATGTGCTTATGATAGGTGTTGTGCAAATGAGTATCAAG
CAATTTAATTTACAGAATATTTAGAACACAAAACAAACGTCATAATGATT
CTTGGACATTTAGCTTCCTTCTGCGCATGCGTTATTGCATTCGTCCTATT
AACCCTTGGATGTGCTGGTAACAACTGGATTACACAAACGGTTGGAGATC
AAGAAGCAAGCATGGGATTATGGAAAGCATGTTTTGTTCACGTGTGCAAA
GAATTTTCAACTGACGGTCACTCATTCTACGATAGTTGCAAAGCACTCTC
GACTTTAGCTGTCATCGTCAGTGGAGTTGCTATGTTAGGATATGTTATTA
ATTGGTATAGTCCAGATAGTACTATTGGTATGTTGGGTGGTATACCGTAT
ATTTCATCTGGCCTATTGTTTATATCAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000086XLOC_000086Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000151-proteinTCONS_00000151-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000151-exon-sc0000001-1575043694:289012..289382TCONS_00000151-exon-sc0000001-1575043694:289012..289382Clytia hemisphaericaexon
TCONS_00000151-exon-sc0000001-1575043694:287834..288515TCONS_00000151-exon-sc0000001-1575043694:287834..288515Clytia hemisphaericaexon
TCONS_00000151-exon-sc0000001-1510915933:289012..289382TCONS_00000151-exon-sc0000001-1510915933:289012..289382Clytia hemisphaericaexon
TCONS_00000151-exon-sc0000001-1510915933:287834..288515TCONS_00000151-exon-sc0000001-1510915933:287834..288515Clytia hemisphaericaexon
TCONS_00000151-exon-sc0000001-1491911889:289012..289382TCONS_00000151-exon-sc0000001-1491911889:289012..289382Clytia hemisphaericaexon
TCONS_00000151-exon-sc0000001-1491911889:287834..288515TCONS_00000151-exon-sc0000001-1491911889:287834..288515Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:287834..289382 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
49.1999 48.0559 49.0458 56.7523 34.2312 25.909 43.1565 50.0001 71.9154 151.458 64.4399 30.9384 32.9402 25.9706 16.8157 16.9012 14.9715 10.9608 13.9327 31.3423 4.69873 6.16195 19.4235 18.1155 10.0763 20.1762 41.5563 37.0111 135.438 107.737
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR004031PMP22/EMP/MP20/Claudin
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000151 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top