Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000140 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000140
Unique NameTCONS_00000140
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2389

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000140 ID=TCONS_00000140|Name=TCONS_00000140|organism=Clytia hemisphaerica|type=transcript|length=2389bp
CTAATTCTtcggaaaatagaaaaaatctttcagaAACACTTCGGAATCGA
TCTTAATCGATAATTCCCGTTTGTTTTTGACCAATCAGAGCAGACCACGA
AATCgaacgaattttcaaaaaaatttaagacGTCATCACTGATCACGGTA
CGACAACACGCATTCAGAAGAAAACACAAGCAAAACACTGATACTAAAAC
GAAAGTAGgatattttttggggaaaatgcaATATTTCTATGCCATTACGT
TATTGGCATGTGCCTGCTCAATTCAGGCCTTATACGATAGCTCTGATGAT
GTTGTGGAGCTCACCGGAGGAAATTTCAATCACAAAGTTATAAACAGTGA
TCAAATCTGGCTTGTAGAATTTTATGCACCATGGTGTGGTCATTGCAAAA
GTCTTGCTCCAGAATGGAAGAAAGCTGCCAAAGCCTTGAAAGGAGTTGTT
TCAGTTGGTGCTGTCGATATGGATGTCCATGGTTCTGTAGGTGGACCATA
CAATGTTCGTGGATTCCCAACCATCAAAGTTTTTGGTGCCAATAAAAATT
CCCCACAAGATTACAATGGTGCAAGAACCGCACAAGCTTTAGTTGATGAG
GCTTTGAAAGCTGTACAACGCTCAGTGAAAGATAAATTGAATGGTCGTGG
TGGTTCAAGCCGTGGTGGAAGTGGTGGAAGCGGCGGCGGTAGCAGCGGTG
ATGCCGTTGTTGAATTAACCGACGCCAACTTCGAGAAAGAAGTTTTGAAC
GCCAAAGAACCTGTTCTCGTTGAATTCTTTGCACCATGGTGTGGACATTG
TCAAAGATTAGAGCCTGAATGGAAGAAAGCTGCAGCTGAGCTCAAAGGAA
AAGTCAAACTCGGAGCACTCGATGCTACTGCTCACCCAAATATGGCACAA
CGATTCCAAGTTCAAGGATATCCAACCATCAAATACTTCCGAGCCGGCGT
CAAAGATTTCAACTCCGCCCAAGATTTTCAGGGTGGGCGTACCGCCAGTG
ATATCATTGCATTTGCTTTGGAACTCCACTCCGAATCCGTTGAACCACCA
GAGATCATGGAATTGACTTCAAACAAGATCTTAGAAGATAACTGCAACGA
GAAACCACTCTGCATTGTGTCTTTCTTACCTGATATCTTAGACACCCAAG
CGTCCGGACGTAACAACTTTTTGACCGTCTTACGTGAATTAGGAGACAAA
TACAAAGCTAAGCTATGGGGATGGGTTTGGACTTCAGCTGCCACTCACCA
GAAATTAGAACAAGCTCTTGGCATCGGTGGATTCGGATATCCAGCCATGG
CTGTCGTCAATATTAGAAAGAAGGTTTTCGTTGGACTTCGGGGATCATTC
AGTAAAGACGGTATCGACGAATTACTCCGTTCGATCGCTGTCGGCCGTGG
ACGCACTGAGAAATTAACAAACGGGTTACCGTCAATCAAGGCCGTTGAAT
CATGGGACGGGTTAGATGGAAAAATGCCTGAAGAAGAAGATATTGATTTG
AGCGATATTGAATTGGATGATCTCGATGATGAACCAAAGAAGAAAAACGA
TgaattgtaaaaatataaacttttttaaactttctaaCTCTTGACATATA
CGTAAGATTGATCACGTCATTCGTCATCGCGTCATTAAACACCCAAAAAA
CAAGGAATCCCTTTttaacttaaaggttttgtttttaaataagagtgata
tcgtttgcttattcatcaattttgattcacaagcGTTTTCACATTGGACT
AACACAAAtgcggagcaagattggtcagaaagaggaaaagaaaaagattt
tttgcttaTCTCAGCATAATCtgacaataggaagacactgtcctgatatt
tAAAATGTGTCTGATTTGAAACGgggacacttatgtaaaaataaaacctt
taaagtcacTAAATTGGCTGAATTCCGTGTTATcgatatgaaaaatgacg
taatcttaacTTGCGTGTGTCGAGAACAGTACACTCTCTATTGTTCATTT
TTTTGTGTCTCCTTGATGCTCTAGAGTTGTAGAGAGTTTGCTGCTTTTTA
GGaagttttttgttcattttttcattcatttattaGGCCACCTTTTTAAA
TTATTTCGACTAACCGTCCCATCTTTTCAAGGAGTTGAAAACAATTTACA
GAGTTATTTTATCGATCGATGAAAGTTTTTACTGTTACAATCTCTTGTAG
AGCGGGGTTTCAAAATAGTTGTAGATCATTCACTCTTCGTATGTattaaa
tgtttttcaaatttgcTTGTGGGCactatttttagtattttgcccAAAGT
TTTATGTAGGTTTTTTGACCTTTTAATGTTGTCAATTGTAAccaaaaatg
atataaaattcaGAAATAACAGTTTTATAAATGCTGGAC
Run BLAST on NCBI

protein sequence of TCONS_00000140-protein

>TCONS_00000140-protein ID=TCONS_00000140-protein|Name=TCONS_00000140-protein|organism=Clytia hemisphaerica|type=polypeptide|length=444bp
MQYFYAITLLACACSIQALYDSSDDVVELTGGNFNHKVINSDQIWLVEFY
APWCGHCKSLAPEWKKAAKALKGVVSVGAVDMDVHGSVGGPYNVRGFPTI
KVFGANKNSPQDYNGARTAQALVDEALKAVQRSVKDKLNGRGGSSRGGSG
GSGGGSSGDAVVELTDANFEKEVLNAKEPVLVEFFAPWCGHCQRLEPEWK
KAAAELKGKVKLGALDATAHPNMAQRFQVQGYPTIKYFRAGVKDFNSAQD
FQGGRTASDIIAFALELHSESVEPPEIMELTSNKILEDNCNEKPLCIVSF
LPDILDTQASGRNNFLTVLRELGDKYKAKLWGWVWTSAATHQKLEQALGI
GGFGYPAMAVVNIRKKVFVGLRGSFSKDGIDELLRSIAVGRGRTEKLTNG
LPSIKAVESWDGLDGKMPEEEDIDLSDIELDDLDDEPKKKNDEL
Run BLAST on NCBI

transcript from alignment at sc0000001:89321..102636-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000140 ID=TCONS_00000140|Name=TCONS_00000140|organism=Clytia hemisphaerica|type=transcript|length=13316bp|location=Sequence derived from alignment at sc0000001:89321..102636- (Clytia hemisphaerica)
CTAATTCTTCGGAAAATAGAAAAAATCTTTCAGAAACACTTCGGAATCGA TCTTAATCGATAATTCCCGTTTGTTTTTGACCAATCAGAGCAGACCACGA AATCGAACGAATTTTCAAAAAAATTTAAGACGTCATCACTGATCACGGTA CGACAACACGCATTCAGAAGAAAACACAAGCAAAACACTGATACTAAAAC GAAAGTAGGATATTTTTTGGGGAAAATGCAATATTTCTATGCCAGTAAGT ATAGTAATTTTATTAATCTCAGCGGGAGGGGGTAGAATCTTCCACTCTTG ATGTCAATTTTAAGCTCGATTTTTATTTAAAAAAATTACTGTTTAAAAAA AGAAAATAGTCAACTGGCCCAGGACGTCCGCGCTCGATCGATAGGATCGA TCATCGGAACGGCTCGATGACGGATCGATATGTGATCAATGGATATTTAA CGATCCGGATAGGAGATCGATGGAAGATTCAGCCATTAAAAAGTCTTGAG TATCGATCCTTCGTTGATCCATTATCGAGCTAGTATTTCAATCGAGTATA CCGATTCATCGACCGTTAATCGATTTGTCATCGATCGTAAATCTATAAAT AAAGTATGAGTCGATAGGGTCGATAAGATCGATAAAAGATCGATGATGAT AGATCGATAAATAATCGATAACTAATCATAAGCTTAAAAAAATCTTGAGT ATCGATCCTCTATTGATCTCCTATCCGGATCGTTAAGTAATCCATCGATC ACATATCGATCCGTCATCGAGCCGTTCCTATGATCGATCCTATCGAGCAC GGACGTCTGGACTGGCCATTCAAAGATCAAAGAAATTTACTGTGTTTAAT TTCAATTCACCTCCCGTAGCCGTAATTCAAACTTCTCAGAAAAGAGCCAG GAAACTGTGTGCACTGTTGTGAATAAAATTGTTTGGGTAGTCTAGGTTGT TTCGTCAGCCATCTTTAAGCTCGTTTAAGGGGAGCCGTCCATATTTAATT TGACAACGCAAAAAATCGCAAATATTTGTTTTACCACCGACCACACTGCC GACCACACTATACTTTTTAAGCTGTCGAAAATATATTTGTATATATATGA ATTACATGAAAATTTGCTCGCATAATCCCATTGGTTCACGCTATGACATA TCATTACATCATATTTTCATTGTTTTCACGATCCACAAGTGTTTCAACCG GTATTCCAACGAAGCCATATTTTGGTTTGTACAGAATAAATTTCGCCCGC TCAAATCAAAACAACAAAATGGTCAAACTTACTAAAGAAAAACATTGCCG CCACGGCATTTCCCTGAGATAAAAATTCTGGTCACGTGACCATCCGTGAT TTTAGACCAATGAAAACCCTTCATTTCCCCGGATTAAAATTGTTAGCGAC TCCAGAAGTCGTGCAACTTTCGGAACGCTTAACCAAATGTTTCATTTTTT CGTGAACTTTGAACCCTTCAAACTTTTTTTCTATGTATGCTAAAGCGTTC CAAAAGTTTTTACTAAATGAAAGCCCATGCGTGATCTTAGCTTTACAGCG GTATATAGCACTGTGGACACGGGCTAGACGGCAAATTGGTAAAATGCCAA ACGTTTTGCAACATTTTGAAAATTGTTTGCCAACGGGAGAAAAAAAAATT GCAGCTATCGATGAACAAATGTGTCTGGAAACGGAGGAAAATGTATTTGA AGGCTGAAACTTTGTATGTTTTTCAGAAAAAGGGTGAGGAATTCAAAAAT CACATTTGCTAATTTTAGTTCTTTCATTTTCATGTAGTTTTTTTCACTTT TTTGCTTCTTTTGCATGGGAATGTCCCAAAAAAAGTTTTTATTTCTGCCG AAATGGAATTTCTCTTCATTTGGGGTTTCTCCTTTCAGAAAAACTTATTC TTTACTCATAAGTTTTTGTTCCTCCATTTCCAGAGACCCCTTGAAAATGG GTCCTACCATCTTTTTTGACTAATTTCAACCTTTTCCAAGTTACTTTTCT TCAAAAACAAAAATAAAACAATGCAATGTCTTCTTTTAAAAAATATATCG TTCGTTATTTTGCTAAATATACTAAATATTAAGTTATTTTCCTAAACTTT TTTTGACATTTTTAGTCAAATTTGTTTCTTTCTTTTTCAAAGCTCTACAA GATAGGATAGGTTTTGAAAAAAGAATTAAAATTTGAAAAATCTTCTGGAG TTGCTAAAGTTGTGTCTACACTAACACGCGGGAACTAGCTAGAAAAAGAG AGAAAAAACCGGGGGTCAAATTAAATTTTTCTCCCTTCTTGCGGCAAACA TAAAAGACTTTAAGAGCCTATTTATTTAAGCAAGGGGTGTTATATCATAA ATAAATTATGTAAGTAAGTGATATTTTAAAGTAATAAGTTCATTAACAAT TTTATTTTGAAGTTTGTTTTTAAAAACAAAACCCCCGTGCTAGATGATAA TATTTTCATCTTCTTAACTTATGGACCCATTTGGAAGTCTAAAGACTATT ACAAAGTTATAATACAGATCATTTGGCAGTGTAGTTGCAGCCTATACAAG AATTGGAATCTAAAGTCTGAAGTCGTAACTCCTTGCCAGTGACCCCGCAG AGAAATTTTTAGTCAGCAGACACTGACTTTAGGTTGGTTTGGAAATCGTT TTATTTTGAAATGTAATCTTCACTTTAGATGAATACTTTATTAATTCGGA TTCATGAAAGGTTCAAGGTTTGTTAACTTTTTATTTCAAATTATTTCATT GATTTATTGAGCTGCAATAGCTGATTGAAAAACGAAAATTTTTGATAGTT ATCAGCGTGGGCTTGGCCGCCATTTTGAATTTCGATTTTTTTCTCCTGTA CTCTGCAATTTAGAGGTTGTTCGTAATACGCGATTTGGCTCACGCGTAAC ACTGGTGGATCGAGCAAACCACATTGCACAAGTGGGCAAAGAAGGTGGTA CGCCTAAAACACGGCACAGACCTAGCGCCAAGTGAAGCTTTTTATTTATG TAAAAAAAAAAGGTAATCAGTTCTTTTTAAATAAAGGTAATTAGTTAAAA GAGCGCATACGTGCACGTGTACAACCAAGTATGGACTTTGCGACGGGAAA ACTTTGATGGAAAAATGCAACAATTTTGGTATACATCACTTCACGTTATC TGTGAGGGGTTGGGGGGTTCAGAGGATAACGTCAATTTGACGTTATGAGT TGTCAAATGAATGTGGACAGGTCCCCTAACTTTTTTCGGAAAGTTGATCA ACAGAATAGCGGCATTTCACAAAAAAAGACTGACCGTCAGCGAAATTTAA GGGCCCCGTGGATCGTCTAAACAAAAGGAACACAAGACATAAACATCAGG CCGTTTGTTTTGATGAAAATTGTTATATAAAAAAGTGAAGCGAGCGAATA CTTACGTTTATAAAATGAGGAAAATAAATATGGAAAGTAACATTTGTCAC GGATAAAACGTCTCAAAAATCGATATTTGTGGTAAAATTTCTTAGTGTCG CACACTCTAACCCGCCACCCCTTTGTGTCAATTTGACATTAGTTGTGAGA AGAATCGATATGTGATCGAGTGACCCCTAAAACAAAAAATGAAACTTTTC TTTATGTTTAACTTTTTTGCACCAATTCTTCAAAATGAAAATATATATTT AAGATTTTAAGTTCTTTCTTTTAAGATTTTTTAGGGCACTATGTTGACAA TCTAACTCTTGCATCAAATTCCTGTCTTCTTCAGTAAATTGAAGATGAGA AAAAACCTAAGCCTTATGATCACGACGGATTGAAACAAATGGGCTCTTCC AGAAAAAATTTGATATAGGGGGTGAACAACGGGAACTTTCGATAAAAAAA GACTTTTCAAAGTACTTTGGAAATTCTGCTCAATTTTATTCTTGAACCCT TGGAAATTCCACATTTTGTCAAAATTTTGAAAAAAGTATCAGAAATTCCA GATTTTTTGTTTTTGTTGCAGATTTCAATATAAAGTTCTCTCAGGGATTA TGTGTTGTGTCAACTTTTCAGTATTGTATTATTGTTAAGGGAAAGATAAA AGAGGTAAGACTAGCCTAGTTTAGCCTAATCCTGATATAGGAGTTTTAAG TTTAGACTGCTAGTCTTACCGCTTTTATCTTTCCATTTTTGTTTTTGTTG CATTTATTTAGATTTATTAAACGAAAGTGGTTTCTTCTACTGATTGCTTT GTGGTGCTCCTTTGTGGACTGTCCACCATTAAGATTGCCGTATTTCACAT AGCCCTTCTTTTCGGCGTCCGTACCGTGGCCTTTCACAAAGTACCTTGCA CAACAGGGGGCTGTTAAATCTCACCCTTCATATCAGCTCTTTTATTTGTT TCAATCCTAGAACTTAAGGTGTAGACTATTTCTCATCTTAAATTCTCTGA AGAAAATCTTTGAATAATAGAAGAACTTAAAATCTTCAACAATCATTCAG AATTAGTGCAAACAAATGAAACATTTAAAATAAAAGTTTCATTTTATCAT GAAAAGGAGAACATACTAAAATTTTTTTGAAAGGTTTTCTCGCACTGATT CTAAAAAACATCACAACATATATCTGAAAATGGACTTGGTCCGAGTTATG AGCTACGGAAGTAATTTACAGACCAGTCTTCATCCCCGAAAAAAAAAATA TTTTTGTCCCAAAACATGTCATATCATATACGGTTGGAAAGGTTTTTTCA CACTGATTCTAAAAATCATCATGATATGTATCTCAAAATGGACTGAGTCC AAGTTATAGGCCATGTGAGTATTTTACAGACCAGAATGGCTGATAAAAAT CCAGACGCCTGAGCCAAATAGGCTGATGAACAGAAAAACATAGAGAAGCA AAAGGCAGAAAACAACATACCAGGTAGCCAGTATGTGAGAAAACTGAAAA AATGTGCACTAGAGTTGAAAAGTGGATAGAATTTGATTTATGAATAAAGT TTAGACCAAAACTGACTAACTCCATATTGATTGATGTAACCTCGCACAAA GCTTCTCATAGCTTGATTGATGATTCATGAAAATCAACGGAAAAATATCC ATAAGGGAACAAAACTAGACAATTGCCTTTGTGTGAATAAACTAATTATA CGACAAAAATGATACAAAAGAACCTAAAATGACTATGTAGAATTAATTGT CAAGGAAAAAGGGTGATGTAAGACAAAAACAAATCCATCATGCATTACTA CAGATATGGGGTGTTGAAGTCAAAAAACACATGTTTTGATTGGAAGTGCA CGAACCTGATTGGTTTTTTTATGCATGAAATGGATCTCCAGTCTACTGTT ACTCAACTGGCTATAACCATGAAAATTGTTACAGATAGGGTAGATTGCCA AATATCAAAGTAAAAAAAACTCATTATGGACTATTCTTCTTTAGGAAGAA ACACTCAAGCTGAGTCAAAACATTGTGTTTTAGAATGAAGTACAATTCCA TAATGGCAGATTTTGGCCCAGTTCAGATCAAAAAAAATTCAGGATCACAT TTGAAACCATTTTTGAGATTTTAGTTTTAGAAAATTAGACTTTAACTCTA AGTATTGTGTTTTAGTTGGAAATACAATTCCATAATGGCGGACTTTGGCA ATTTCTGACCCAAACCATTTTGGTTTTTCCATAATATTTCCAGAATACTT TCAACATTCAAAGATTTTACATTTAAAATCATTTTTGAGATTTTGGCCCA AGAAAACCAGATTTTAGCTTCAAATATTGGCGTTTAGCATGGATTTACAG AAACATTTTGAAAACTCAATTGGTTTTTACTAGAGCCCTCCTTGAAGTGT TTCATTGCTGAAAATTTCAAATGTGTACCTTGAAAAGTTTTGGGTCCTCT CAAGAATGCTACTTTCATGCATTTTGCTACCCTGAATATCATTGAGTAAT CTCTCTGGGCTTATTTTGTCTTTTTGTGTTAAATATTATTACAAACACCA TTTGGAAACCATTTAGACCCTCGTCTTTATCCCTTTCTTTTCTTTCTTTA CATTCATGAAAATACAATTCTTTGAAAAGTCTCTTGTTTATCCATCGCCC CGTAGAAGTTTATCAACTGACCAACTCGTATGCAATAAAATAAAAGATTC TGTGTCAAAAAGCAACAGAAGTGTTCTATTTTTGTCCTTTATTCTTATTT AAATCAGAAATCTGGAAAATATTCGTGTTATGGTTTTTTGCCGCCCTTTA TTGCTAAAAAAATGTACTATAATATTTTTTAGGGTAGTTTTTTTTTGCTC TTCCTAGTAGATTTGCCATGATTTTACTATTCCAGACTATTCTCAGGTAT TGTTTCACAATGATATCTCGATAAAATTGATAAGAATTGAACCTAATCTG TTATTTTCTTTTGCATTTCAGTTACGTTATTGGCATGTGCCTGCTCAATT CAGGCCTTATACGATAGCTCTGATGATGTTGTGGAGCTCACCGGAGGAAA TTTCAATCACAAAGTTATAAACAGTGATCAAATCTGGCTTGTAGAATTTT ATGCACCATGGTAGGAATATTTTTTCTGAATAGTTTTGTTTGCTTCTTTT AATCTCGTATTTGCAGGTCTTTGTTACTTTATTTGCAAAAAACAATAAAA TTTAGCCAATCTGAATGGGCAAGTTCTATATATACTTCTCAAATAAGAAT TTTTACTTAAATCTTTATAAAAAAAAGAACAGAACAGAATATGCTTTTAA TTTACACAAAAATTATAGTTCTGTTTTTTTGGACCTACCCCGGTGGGCTG TAGGTCCTATAAATTAACCTCTGTTCGTTCGTTCGTTCGTTCGTCCGTTC GTCGGTTCGTCCGTTCGTCCGTTCGTTACTAGCTTTTCTCGGGATTGGCT CATTAGTTTTTCCTAATTTTTGGCACAAAGATGCAAAATCGTAATGCCCA AAATGTGACGGAGCCCGATTTTTGAAAAAAATTCATTTCCGGCCGAAAAT GCCGGAAATATGCCGGAAAAACCGGTTATTTGGCATTTTCTCGAGATTTC ATCATTAGTTTTTTCTGATTTTTTGCACAAAGATGCGTATTAGCAATGCC TAAAACATGGATTAATCCGATTTTTGAGAAAAATTCTATTCCGGCTGAAA ATGCCGGAAATTACCCGGAAATCGCCGTTTTTGCAGATTTTCATTGGACT TTTTCACACAAAAACATTATTTATAGCAATGCCCACCATCAAGCATGGTT TAATTGTCAATAAAAGTGATTTTTGAAACCGGAACTTTCTAAAAATCGCC GGAACAGCCTATTTTCGCCGGAAAAACGGTATTCTTGGATTTCTCGAGCT GTACTTTATATTTTTTCATGAAATTTTGCACACTGATGCAAAATGGCAAT ACCTAAAATATGACAGAGCCTGATTTTCAATTAACGTACTTTTCCGGCCG AAAATGCCGGAAATATGCCGGAAAACAGGTTTTTTGGCATTTTCTCGAGA TTTCATCATTAGTTTTTTCTGACTTTTTGCTCAAAGATGCGTATTAACAA TGTCTAAAACATGGCCTAGTCCGATTTTTGAGAAAAATTCTATTCCGGCT GAGAATGCTGGAAATATTCCGGAAATCGCCGTTTTTGCAGATTTTCATCG GACTTTTTCCTTATATTTCGTTGTTTTTTCACACAAAAACATTATTGATA GCAATGCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNTATTTCTATGTTCTTCACACAAAAACATTA TTGATAACAATGCTCACCATCAAGCATGATTCAATTGTCAATAAAACTGA TTTTTGCGACCATAACTTTCTATTAATTTTTTCCTCCAACCCTTCCCTCT CCCCCCATCAACAATCAATGATGAATTTATTGCGTTATGCATTTTCGCTA AACGATATATTTTCTGACTGATTTTTTTCTCCTCGCATTGCTATCTAACT TTCATCATCAGGTAGGTCCATTCAGCATCTAGCTTGTTTTTAATCTTCTT TCTTTCATTACATATTGTTGATATTTTTTCTTAACCCAGGTGTGGTCATT GCAAAAGTCTTGCTCCAGAATGGAAGAAAGCTGCCAAAGCCTTGAAAGGA GTTGTTTCAGTTGGTGCTGTCGATATGGATGTCCATGGTTCTGTAGGTGG ACCATACAATGTTCGTGGATTCCCAACCATCAAAGTTTTTGGTGCCAATA AAAATTCCCCACAAGATTACAATGGTATGTTATTGTTCTGGTCTTCGTAC AGGCAATTATCTTTCATGTTTACATTACAGACATTGATATAANATGCTGG TTTTCATACAGGCAATTATCTTTCGTGGTTACATTACAGACATTGATATA AAGTTCTTCCGCCCCAGACAGATTTCTGTCTCAGTGAAACAAAGTCAATA GATTTGTCTGTCTCAAAATTCTGAATAGAATTTACCAAAATTTAAGACTA AATGCTATTTAATGTGTAAAATTCATTGAATGTATTGCTTTGAACACTGT TTAGATAATTGATCTAAATAAGGCATTTAATGGAGTTTTAATTAAGAATA CACCTTTTCGACCGTAGTCGCGCGGTGAGACGCGTTCCACTTAATCATTT ATTAATTATCCCCCTAAACTCAATCCAATCCTTTTTGACACATTTTTCTA TTGTCTATAGTTTCGAAAAAAGCACTGGGACGGTTTTAGTGGGATAAAGC GGACAAAAAAATGCCCGAAAAAATGTCTAAAGAAATAATCTTCATATCAT TCGTAAATTTCAGGTGCAAGAACCGCACAAGCTTTAGTTGATGAGGCTTT GAAAGCTGTACAACGCTCAGTGAAAGATAAATTGAATGGTCGTGGTGGTG TAAGTTAAAATATGCTTTTATAATTAAGCACTTTGTACTACGGAGCACCA CATGTTTGAATTTGAATTTGAAGAGGACTGTTGTACTTATTTGAGGAATT ACTTTACATTTTATTCGTTCTAAAATTCGTGATCAATTATGAAAAACTTT TTCATTTTGTATATTACAAATCTTTGAATTATTTATGTAGAGTTACCGTG TTTTTTCGAATAAACACCCTTTTTTTAACGCCTCCCCTGCTCCAATAAAC GCCACTCCTTGTAACCTAAAAAATTTGATAAGTGCCTGTTATCCGAAGTA ATACAGTATTAGTAGACTATACCGAGATATGCTATAGTAGACTAACTTCT AAGACGAATCCGAATAATAAAGAATAACCTCAAACACGCAAATCAGCAGT GGGGCGGAAATTTTGTCCACGCGGGCAAAAAATAGTCGGTGGGGCTCAAT GTCGTAAACACAGACTCGCAACATATTACGTTTTATAATATACAACTATG CTAATATCATAATATCATAATATATTACACGGACGATAGCATCGTCTACG GTATTATTGGATGGTCGTGTTGCTCTATTTCTTTTTTTGCCAGTAACTAA TTGTTATTGAAGGTTTTTCTATTTGATATTTCCAGTCAAGCCGTGGTGGA AGTGGTGGAAGCGGCGGCGGTAGCAGCGGTGATGCCGTTGTTGAATTAAC CGACGCCAACTTCGAGAAAGAAGTTTTGAACGCCAAAGAACCTGTTCTCG TTGAATTCTTTGCACCATGGTAAGATAGATCTTTCTGGGGGTTGACCGTA TAGGGCAAAAAAGGCTTGCCGCTAAGGTTCAAGAATTGGATTTGTATGTT TCATTCTTTCATATATTTATGTTGAATATTGTGAAAAAAGTTGGCGTTAA ATAAATTCGTCAGACCAAAGATGATTTTTGATCGGTTACCTTAAGGGGGC TAATTTTAGCAAGAAAACTGATAAAAAACGGAAACTAATTTTCGTGGTCG AAAAAAATCCAAAAAAAGCAATTTTGGACTTATTTCTTTCATTCTTCTAT GGGTTTTTCAGATTTTTGATGAAAAATCGCAAAATTTGTAATTCGCGGGT TCTGATTTTTTGCCGTTTTGCCGAAAAAAGCGAATATTTTTCCCACGATA ATTAGTATAAGTGCATTTCGAGANGCCGTTTTGCCGAAAAAAGCGAATAT TTTTCCCACGATAATTAGTATAAGTGCAATTCGAGAGTAATTACTTTCTA CAGAATACAACTAACAATTTATTGCTCTCTTTGAAGGCGCGCCAAATAAG AAAAAATAACTCATCTTGATTAGTGTATGTAAACACGTGGTAGCGAGTGC GATTCGTGAATAATTGCATGAGTCTTTTTTTAAATATGGAGACAAAAAAT CACGAGAGAGCTATCATGTGATTCCCAGCTAATCGCACTATGGGTTTGGC TACTTTTATACCGTTAAGAAAGAAAATTACACTGAAAGTATTTTTTTCTC TTCTCTTTATGTTTTTCTTTTATTGTTGTTCATAGTTTTTCTCTCTCACA AAGTGAATTTCGAATGAAATTATAACGTTCGATTGAAATTATAACGTTCG ATAAAAAAACGAACAAAAAACGATTAATTGCTCTCTTTGAAGGTGCGCCA AATGAGAAAAAAATAGCTCATCGTGTGATTAGTTCGCTTAATAAGGGATT GATTTTGAAATGCTAAGGATTTATCTTATTTATCTTATTTTACCAGGTGT GGACATTGTCAAAGATTAGAGCCTGAATGGAAGAAAGCTGCAGCTGAGCT CAAAGGAAAAGTCAAACTCGGAGCACTCGATGCTACTGCTCACCCAAATA TGGCACAACGGTAAGTGTATGTAAAGTTGCTAGGAGTTATGGACACAAGT TTCCAATGGGTTAATTGACCAAAAGCTTCAAAAAAAGTAAAAAGAGGGAA AATGAAAAACAATGTATCTCTACAGTAGTAATTGTAGAACCCATTATTAT TTGAAATGGATTAAAACTTTTCGACTCAATTCAAATAGACCGTCTTTCCA TTCATAGAATATAATTTTTCATTTCCAGATTCCAAGTTCAAGGATATCCA ACCATCAAATACTTCCGAGCCGGCGTCAAAGATTTCAACTCCGCCCAAGA TTTTCAGGGTGGGCGTACCGCCAGTGATATCATTGCATTTGCTTTGGAAC TCCACTCCGAATCCGTTGAACCACCAGAGATCATGGAATTGACTTCAAAC AAGATCTTAGAAGATAACTGCAACGAGAAACCACTCTGCATTGTGTCTTT CTTACCTGATATCTTAGACACCCAAGCGTCCGGACGTAACAACTTTTTGA CCGTCTTACGTGAATTAGGAGACAAATACAAAGCTAAGCTATGGGGATGG GTTTGGACTTCAGCTGCCACTCACCAGAAATTAGAACAAGCTCTTGGCAT CGGTGGATTCGGATATCCAGCCATGGCTGTCGTCAATATTAGAAAGAAGG TTAGAAAATGTATTTGTTTTGAAATTATTATTTGCAATGATAATAATCGA GTCTTCGTCACTCTGGCACACAGGTCTGTAAAGCCCGAAGGGCTAGATAG GCAACTTTAAGCTTTCTCCAGCAAAAAAAAGTTAAGCAAAAATTTGACTT TTTAAATTTCGTGCCGATGGATAGGATCTAGCATTTTAATTGTTTTCGGA GCGCGAGATCAAATTAAGTAGGCGGCAAACGCTATTTCGCATCTATCAAG CCAGTGAAATTGCTTGTTGTCACGTAATTTCCTTGGTAGGAAATCCTAAG AAAACTTGCTTCACTTTTTGATAAAGGCCGTGGATCTAGCCCTGCTCTGG CATCCAATGAGGAACATACCAGCCAATCTCTATTCCGGAGCTCATTTTTT GAAGGCACTAGTAAACTTTGTTCGTGTTAAAAGTTTCTATGTATGTAAGA CTCCAATGTTAAGTGACACGAAGCCTCCAAATTTATCCATTTTTTATTGC GTTTAGAAGCTTTACTACTCCCCCATATTGAAATTTGAAAGATTTGTCTC TATTAAGATCAGAAATTAACCTTTTCCGCTATTAACTTTTTTTCTGTTAG GTTTTCGTTGGACTTCGGGGATCATTCAGTAAAGACGGTATCGACGAATT ACTCCGTTCGATCGCTGTCGGCCGTGGACGCACTGAGAAATTAACAAACG GGTTACCGTCAATCAAGGCCGTTGAATCATGGGACGGGTTAGATGGAAAA ATGCCTGAAGAAGAAGATATTGATTTGAGCGATATTGAATTGGATGATCT CGATGATGAACCAAAGAAGAAAAACGATGAATTGTAAAAATATAAACTTT TTTAAACTTTCTAACTCTTGACATATACGTAAGATTGATCACGTCATTCG TCATCGCGTCATTAAACACCCAAAAAACAAGGAATCCCTTTTTAACTTAA AGGTTTTGTTTTTAAATAAGAGTGATATCGTTTGCTTATTCATCAATTTT GATTCACAAGCGTTTTCACATTGGACTAACACAAATGCGGAGCAAGATTG GTCAGAAAGAGGAAAAGAAAAAGATTTTTTGCTTATCTCAGCATAATCTG ACAATAGGAAGACACTGTCCTGATATTTAAAATGTGTCTGATTTGAAACG GGGACACTTATGTAAAAATAAAACCTTTAAAGTCACTAAATTGGCTGAAT TCCGTGTTATCGATATGAAAAATGACGTAATCTTAACTTGCGTGTGTCGA GAACAGTACACTCTCTATTGTTCATTTTTTTGTGTCTCCTTGATGCTCTA GAGTTGTAGAGAGTTTGCTGCTTTTTAGGAAGTTTTTTGTTCATTTTTTC ATTCATTTATTAGGCCACCTTTTTAAATTATTTCGACTAACCGTCCCATC TTTTCAAGGAGTTGAAAACAATTTACAGAGTTATTTTATCGATCGATGAA AGTTTTTACTGTTACAATCTCTTGTAGAGCGGGGTTTCAAAATAGTTGTA GATCATTCACTCTTCGTATGTATTAAATGTTTTTCAAATTTGCTTGTGGG CACTATTTTTAGTATTTTGCCCAAAGTTTTATGTAGGTTTTTTGACCTTT TAATGTTGTCAATTGTAACCAAAAATGATATAAAATTCAGAAATAACAGT TTTATAAATGCTGGAC

Coding sequence (CDS) from alignment at sc0000001:89321..102636-

>TCONS_00000140 ID=TCONS_00000140|Name=TCONS_00000140|organism=Clytia hemisphaerica|type=CDS|length=10680bp|location=Sequence derived from alignment at sc0000001:89321..102636- (Clytia hemisphaerica)
GTTTTCGTTGGACTTCGGGGATCATTCAGTAAAGACGGTATCGACGAATT
ACTCCGTTCGATCGCTGTCGGCCGTGGACGCACTGAGAAATTAACAAACG
GGTTACCGTCAATCAAGGCCGTTGAATCATGGGACGGGTTAGATGGAAAA
ATGCCTGAAGAAGAAGATATTGATTTGAGCGATATTGAATTGGATGATCT
CGATGATGAACCAAAGAAGAAAAACGATGAATTGTAAATTCCAAGTTCAA
GGATATCCAACCATCAAATACTTCCGAGCCGGCGTCAAAGATTTCAACTC
CGCCCAAGATTTTCAGGGTGGGCGTACCGCCAGTGATATCATTGCATTTG
CTTTGGAACTCCACTCCGAATCCGTTGAACCACCAGAGATCATGGAATTG
ACTTCAAACAAGATCTTAGAAGATAACTGCAACGAGAAACCACTCTGCAT
TGTGTCTTTCTTACCTGATATCTTAGACACCCAAGCGTCCGGACGTAACA
ACTTTTTGACCGTCTTACGTGAATTAGGAGACAAATACAAAGCTAAGCTA
TGGGGATGGGTTTGGACTTCAGCTGCCACTCACCAGAAATTAGAACAAGC
TCTTGGCATCGGTGGATTCGGATATCCAGCCATGGCTGTCGTCAATATTA
GAAAGAAGGTGTGGACATTGTCAAAGATTAGAGCCTGAATGGAAGAAAGC
TGCAGCTGAGCTCAAAGGAAAAGTCAAACTCGGAGCACTCGATGCTACTG
CTCACCCAAATATGGCACAACGTCAAGCCGTGGTGGAAGTGGTGGAAGCG
GCGGCGGTAGCAGCGGTGATGCCGTTGTTGAATTAACCGACGCCAACTTC
GAGAAAGAAGTTTTGAACGCCAAAGAACCTGTTCTCGTTGAATTCTTTGC
ACCATGGTGCAAGAACCGCACAAGCTTTAGTTGATGAGGCTTTGAAAGCT
GTACAACGCTCAGTGAAAGATAAATTGAATGGTCGTGGTGGTGTGTGGTC
ATTGCAAAAGTCTTGCTCCAGAATGGAAGAAAGCTGCCAAAGCCTTGAAA
GGAGTTGTTTCAGTTGGTGCTGTCGATATGGATGTCCATGGTTCTGTAGG
TGGACCATACAATGTTCGTGGATTCCCAACCATCAAAGTTTTTGGTGCCA
ATAAAAATTCCCCACAAGATTACAATGTTACGTTATTGGCATGTGCCTGC
TCAATTCAGGCCTTATACGATAGCTCTGATGATGTTGTGGAGCTCACCGG
AGGAAATTTCAATCACAAAGTTATAAACAGTGATCAAATCTGGCTTGTAG
AATTTTATGCACCATGATGCAATATTTCTATGCCAGTTTTCGTTGGACTT
CGGGGATCATTCAGTAAAGACGGTATCGACGAATTACTCCGTTCGATCGC
TGTCGGCCGTGGACGCACTGAGAAATTAACAAACGGGTTACCGTCAATCA
AGGCCGTTGAATCATGGGACGGGTTAGATGGAAAAATGCCTGAAGAAGAA
GATATTGATTTGAGCGATATTGAATTGGATGATCTCGATGATGAACCAAA
GAAGAAAAACGATGAATTGTAAATTCCAAGTTCAAGGATATCCAACCATC
AAATACTTCCGAGCCGGCGTCAAAGATTTCAACTCCGCCCAAGATTTTCA
GGGTGGGCGTACCGCCAGTGATATCATTGCATTTGCTTTGGAACTCCACT
CCGAATCCGTTGAACCACCAGAGATCATGGAATTGACTTCAAACAAGATC
TTAGAAGATAACTGCAACGAGAAACCACTCTGCATTGTGTCTTTCTTACC
TGATATCTTAGACACCCAAGCGTCCGGACGTAACAACTTTTTGACCGTCT
TACGTGAATTAGGAGACAAATACAAAGCTAAGCTATGGGGATGGGTTTGG
ACTTCAGCTGCCACTCACCAGAAATTAGAACAAGCTCTTGGCATCGGTGG
ATTCGGATATCCAGCCATGGCTGTCGTCAATATTAGAAAGAAGGTGTGGA
CATTGTCAAAGATTAGAGCCTGAATGGAAGAAAGCTGCAGCTGAGCTCAA
AGGAAAAGTCAAACTCGGAGCACTCGATGCTACTGCTCACCCAAATATGG
CACAACGTCAAGCCGTGGTGGAAGTGGTGGAAGCGGCGGCGGTAGCAGCG
GTGATGCCGTTGTTGAATTAACCGACGCCAACTTCGAGAAAGAAGTTTTG
AACGCCAAAGAACCTGTTCTCGTTGAATTCTTTGCACCATGGTGCAAGAA
CCGCACAAGCTTTAGTTGATGAGGCTTTGAAAGCTGTACAACGCTCAGTG
AAAGATAAATTGAATGGTCGTGGTGGTGTGTGGTCATTGCAAAAGTCTTG
CTCCAGAATGGAAGAAAGCTGCCAAAGCCTTGAAAGGAGTTGTTTCAGTT
GGTGCTGTCGATATGGATGTCCATGGTTCTGTAGGTGGACCATACAATGT
TCGTGGATTCCCAACCATCAAAGTTTTTGGTGCCAATAAAAATTCCCCAC
AAGATTACAATGTTACGTTATTGGCATGTGCCTGCTCAATTCAGGCCTTA
TACGATAGCTCTGATGATGTTGTGGAGCTCACCGGAGGAAATTTCAATCA
CAAAGTTATAAACAGTGATCAAATCTGGCTTGTAGAATTTTATGCACCAT
GATGCAATATTTCTATGCCAGTTTTCGTTGGACTTCGGGGATCATTCAGT
AAAGACGGTATCGACGAATTACTCCGTTCGATCGCTGTCGGCCGTGGACG
CACTGAGAAATTAACAAACGGGTTACCGTCAATCAAGGCCGTTGAATCAT
GGGACGGGTTAGATGGAAAAATGCCTGAAGAAGAAGATATTGATTTGAGC
GATATTGAATTGGATGATCTCGATGATGAACCAAAGAAGAAAAACGATGA
ATTGTAAATTCCAAGTTCAAGGATATCCAACCATCAAATACTTCCGAGCC
GGCGTCAAAGATTTCAACTCCGCCCAAGATTTTCAGGGTGGGCGTACCGC
CAGTGATATCATTGCATTTGCTTTGGAACTCCACTCCGAATCCGTTGAAC
CACCAGAGATCATGGAATTGACTTCAAACAAGATCTTAGAAGATAACTGC
AACGAGAAACCACTCTGCATTGTGTCTTTCTTACCTGATATCTTAGACAC
CCAAGCGTCCGGACGTAACAACTTTTTGACCGTCTTACGTGAATTAGGAG
ACAAATACAAAGCTAAGCTATGGGGATGGGTTTGGACTTCAGCTGCCACT
CACCAGAAATTAGAACAAGCTCTTGGCATCGGTGGATTCGGATATCCAGC
CATGGCTGTCGTCAATATTAGAAAGAAGGTGTGGACATTGTCAAAGATTA
GAGCCTGAATGGAAGAAAGCTGCAGCTGAGCTCAAAGGAAAAGTCAAACT
CGGAGCACTCGATGCTACTGCTCACCCAAATATGGCACAACGTCAAGCCG
TGGTGGAAGTGGTGGAAGCGGCGGCGGTAGCAGCGGTGATGCCGTTGTTG
AATTAACCGACGCCAACTTCGAGAAAGAAGTTTTGAACGCCAAAGAACCT
GTTCTCGTTGAATTCTTTGCACCATGGTGCAAGAACCGCACAAGCTTTAG
TTGATGAGGCTTTGAAAGCTGTACAACGCTCAGTGAAAGATAAATTGAAT
GGTCGTGGTGGTGTGTGGTCATTGCAAAAGTCTTGCTCCAGAATGGAAGA
AAGCTGCCAAAGCCTTGAAAGGAGTTGTTTCAGTTGGTGCTGTCGATATG
GATGTCCATGGTTCTGTAGGTGGACCATACAATGTTCGTGGATTCCCAAC
CATCAAAGTTTTTGGTGCCAATAAAAATTCCCCACAAGATTACAATGTTA
CGTTATTGGCATGTGCCTGCTCAATTCAGGCCTTATACGATAGCTCTGAT
GATGTTGTGGAGCTCACCGGAGGAAATTTCAATCACAAAGTTATAAACAG
TGATCAAATCTGGCTTGTAGAATTTTATGCACCATGATGCAATATTTCTA
TGCCAGTTTTCGTTGGACTTCGGGGATCATTCAGTAAAGACGGTATCGAC
GAATTACTCCGTTCGATCGCTGTCGGCCGTGGACGCACTGAGAAATTAAC
AAACGGGTTACCGTCAATCAAGGCCGTTGAATCATGGGACGGGTTAGATG
GAAAAATGCCTGAAGAAGAAGATATTGATTTGAGCGATATTGAATTGGAT
GATCTCGATGATGAACCAAAGAAGAAAAACGATGAATTGTAAATTCCAAG
TTCAAGGATATCCAACCATCAAATACTTCCGAGCCGGCGTCAAAGATTTC
AACTCCGCCCAAGATTTTCAGGGTGGGCGTACCGCCAGTGATATCATTGC
ATTTGCTTTGGAACTCCACTCCGAATCCGTTGAACCACCAGAGATCATGG
AATTGACTTCAAACAAGATCTTAGAAGATAACTGCAACGAGAAACCACTC
TGCATTGTGTCTTTCTTACCTGATATCTTAGACACCCAAGCGTCCGGACG
TAACAACTTTTTGACCGTCTTACGTGAATTAGGAGACAAATACAAAGCTA
AGCTATGGGGATGGGTTTGGACTTCAGCTGCCACTCACCAGAAATTAGAA
CAAGCTCTTGGCATCGGTGGATTCGGATATCCAGCCATGGCTGTCGTCAA
TATTAGAAAGAAGGTGTGGACATTGTCAAAGATTAGAGCCTGAATGGAAG
AAAGCTGCAGCTGAGCTCAAAGGAAAAGTCAAACTCGGAGCACTCGATGC
TACTGCTCACCCAAATATGGCACAACGTCAAGCCGTGGTGGAAGTGGTGG
AAGCGGCGGCGGTAGCAGCGGTGATGCCGTTGTTGAATTAACCGACGCCA
ACTTCGAGAAAGAAGTTTTGAACGCCAAAGAACCTGTTCTCGTTGAATTC
TTTGCACCATGGTGCAAGAACCGCACAAGCTTTAGTTGATGAGGCTTTGA
AAGCTGTACAACGCTCAGTGAAAGATAAATTGAATGGTCGTGGTGGTGTG
TGGTCATTGCAAAAGTCTTGCTCCAGAATGGAAGAAAGCTGCCAAAGCCT
TGAAAGGAGTTGTTTCAGTTGGTGCTGTCGATATGGATGTCCATGGTTCT
GTAGGTGGACCATACAATGTTCGTGGATTCCCAACCATCAAAGTTTTTGG
TGCCAATAAAAATTCCCCACAAGATTACAATGTTACGTTATTGGCATGTG
CCTGCTCAATTCAGGCCTTATACGATAGCTCTGATGATGTTGTGGAGCTC
ACCGGAGGAAATTTCAATCACAAAGTTATAAACAGTGATCAAATCTGGCT
TGTAGAATTTTATGCACCATGATGCAATATTTCTATGCCAGTTTTCGTTG
GACTTCGGGGATCATTCAGTAAAGACGGTATCGACGAATTACTCCGTTCG
ATCGCTGTCGGCCGTGGACGCACTGAGAAATTAACAAACGGGTTACCGTC
AATCAAGGCCGTTGAATCATGGGACGGGTTAGATGGAAAAATGCCTGAAG
AAGAAGATATTGATTTGAGCGATATTGAATTGGATGATCTCGATGATGAA
CCAAAGAAGAAAAACGATGAATTGTAAATTCCAAGTTCAAGGATATCCAA
CCATCAAATACTTCCGAGCCGGCGTCAAAGATTTCAACTCCGCCCAAGAT
TTTCAGGGTGGGCGTACCGCCAGTGATATCATTGCATTTGCTTTGGAACT
CCACTCCGAATCCGTTGAACCACCAGAGATCATGGAATTGACTTCAAACA
AGATCTTAGAAGATAACTGCAACGAGAAACCACTCTGCATTGTGTCTTTC
TTACCTGATATCTTAGACACCCAAGCGTCCGGACGTAACAACTTTTTGAC
CGTCTTACGTGAATTAGGAGACAAATACAAAGCTAAGCTATGGGGATGGG
TTTGGACTTCAGCTGCCACTCACCAGAAATTAGAACAAGCTCTTGGCATC
GGTGGATTCGGATATCCAGCCATGGCTGTCGTCAATATTAGAAAGAAGGT
GTGGACATTGTCAAAGATTAGAGCCTGAATGGAAGAAAGCTGCAGCTGAG
CTCAAAGGAAAAGTCAAACTCGGAGCACTCGATGCTACTGCTCACCCAAA
TATGGCACAACGTCAAGCCGTGGTGGAAGTGGTGGAAGCGGCGGCGGTAG
CAGCGGTGATGCCGTTGTTGAATTAACCGACGCCAACTTCGAGAAAGAAG
TTTTGAACGCCAAAGAACCTGTTCTCGTTGAATTCTTTGCACCATGGTGC
AAGAACCGCACAAGCTTTAGTTGATGAGGCTTTGAAAGCTGTACAACGCT
CAGTGAAAGATAAATTGAATGGTCGTGGTGGTGTGTGGTCATTGCAAAAG
TCTTGCTCCAGAATGGAAGAAAGCTGCCAAAGCCTTGAAAGGAGTTGTTT
CAGTTGGTGCTGTCGATATGGATGTCCATGGTTCTGTAGGTGGACCATAC
AATGTTCGTGGATTCCCAACCATCAAAGTTTTTGGTGCCAATAAAAATTC
CCCACAAGATTACAATGTTACGTTATTGGCATGTGCCTGCTCAATTCAGG
CCTTATACGATAGCTCTGATGATGTTGTGGAGCTCACCGGAGGAAATTTC
AATCACAAAGTTATAAACAGTGATCAAATCTGGCTTGTAGAATTTTATGC
ACCATGATGCAATATTTCTATGCCAGTTTTCGTTGGACTTCGGGGATCAT
TCAGTAAAGACGGTATCGACGAATTACTCCGTTCGATCGCTGTCGGCCGT
GGACGCACTGAGAAATTAACAAACGGGTTACCGTCAATCAAGGCCGTTGA
ATCATGGGACGGGTTAGATGGAAAAATGCCTGAAGAAGAAGATATTGATT
TGAGCGATATTGAATTGGATGATCTCGATGATGAACCAAAGAAGAAAAAC
GATGAATTGTAAATTCCAAGTTCAAGGATATCCAACCATCAAATACTTCC
GAGCCGGCGTCAAAGATTTCAACTCCGCCCAAGATTTTCAGGGTGGGCGT
ACCGCCAGTGATATCATTGCATTTGCTTTGGAACTCCACTCCGAATCCGT
TGAACCACCAGAGATCATGGAATTGACTTCAAACAAGATCTTAGAAGATA
ACTGCAACGAGAAACCACTCTGCATTGTGTCTTTCTTACCTGATATCTTA
GACACCCAAGCGTCCGGACGTAACAACTTTTTGACCGTCTTACGTGAATT
AGGAGACAAATACAAAGCTAAGCTATGGGGATGGGTTTGGACTTCAGCTG
CCACTCACCAGAAATTAGAACAAGCTCTTGGCATCGGTGGATTCGGATAT
CCAGCCATGGCTGTCGTCAATATTAGAAAGAAGGTGTGGACATTGTCAAA
GATTAGAGCCTGAATGGAAGAAAGCTGCAGCTGAGCTCAAAGGAAAAGTC
AAACTCGGAGCACTCGATGCTACTGCTCACCCAAATATGGCACAACGTCA
AGCCGTGGTGGAAGTGGTGGAAGCGGCGGCGGTAGCAGCGGTGATGCCGT
TGTTGAATTAACCGACGCCAACTTCGAGAAAGAAGTTTTGAACGCCAAAG
AACCTGTTCTCGTTGAATTCTTTGCACCATGGTGCAAGAACCGCACAAGC
TTTAGTTGATGAGGCTTTGAAAGCTGTACAACGCTCAGTGAAAGATAAAT
TGAATGGTCGTGGTGGTGTGTGGTCATTGCAAAAGTCTTGCTCCAGAATG
GAAGAAAGCTGCCAAAGCCTTGAAAGGAGTTGTTTCAGTTGGTGCTGTCG
ATATGGATGTCCATGGTTCTGTAGGTGGACCATACAATGTTCGTGGATTC
CCAACCATCAAAGTTTTTGGTGCCAATAAAAATTCCCCACAAGATTACAA
TGTTACGTTATTGGCATGTGCCTGCTCAATTCAGGCCTTATACGATAGCT
CTGATGATGTTGTGGAGCTCACCGGAGGAAATTTCAATCACAAAGTTATA
AACAGTGATCAAATCTGGCTTGTAGAATTTTATGCACCATGATGCAATAT
TTCTATGCCAGTTTTCGTTGGACTTCGGGGATCATTCAGTAAAGACGGTA
TCGACGAATTACTCCGTTCGATCGCTGTCGGCCGTGGACGCACTGAGAAA
TTAACAAACGGGTTACCGTCAATCAAGGCCGTTGAATCATGGGACGGGTT
AGATGGAAAAATGCCTGAAGAAGAAGATATTGATTTGAGCGATATTGAAT
TGGATGATCTCGATGATGAACCAAAGAAGAAAAACGATGAATTGTAAATT
CCAAGTTCAAGGATATCCAACCATCAAATACTTCCGAGCCGGCGTCAAAG
ATTTCAACTCCGCCCAAGATTTTCAGGGTGGGCGTACCGCCAGTGATATC
ATTGCATTTGCTTTGGAACTCCACTCCGAATCCGTTGAACCACCAGAGAT
CATGGAATTGACTTCAAACAAGATCTTAGAAGATAACTGCAACGAGAAAC
CACTCTGCATTGTGTCTTTCTTACCTGATATCTTAGACACCCAAGCGTCC
GGACGTAACAACTTTTTGACCGTCTTACGTGAATTAGGAGACAAATACAA
AGCTAAGCTATGGGGATGGGTTTGGACTTCAGCTGCCACTCACCAGAAAT
TAGAACAAGCTCTTGGCATCGGTGGATTCGGATATCCAGCCATGGCTGTC
GTCAATATTAGAAAGAAGGTGTGGACATTGTCAAAGATTAGAGCCTGAAT
GGAAGAAAGCTGCAGCTGAGCTCAAAGGAAAAGTCAAACTCGGAGCACTC
GATGCTACTGCTCACCCAAATATGGCACAACGTCAAGCCGTGGTGGAAGT
GGTGGAAGCGGCGGCGGTAGCAGCGGTGATGCCGTTGTTGAATTAACCGA
CGCCAACTTCGAGAAAGAAGTTTTGAACGCCAAAGAACCTGTTCTCGTTG
AATTCTTTGCACCATGGTGCAAGAACCGCACAAGCTTTAGTTGATGAGGC
TTTGAAAGCTGTACAACGCTCAGTGAAAGATAAATTGAATGGTCGTGGTG
GTGTGTGGTCATTGCAAAAGTCTTGCTCCAGAATGGAAGAAAGCTGCCAA
AGCCTTGAAAGGAGTTGTTTCAGTTGGTGCTGTCGATATGGATGTCCATG
GTTCTGTAGGTGGACCATACAATGTTCGTGGATTCCCAACCATCAAAGTT
TTTGGTGCCAATAAAAATTCCCCACAAGATTACAATGTTACGTTATTGGC
ATGTGCCTGCTCAATTCAGGCCTTATACGATAGCTCTGATGATGTTGTGG
AGCTCACCGGAGGAAATTTCAATCACAAAGTTATAAACAGTGATCAAATC
TGGCTTGTAGAATTTTATGCACCATGATGCAATATTTCTATGCCAGTTTT
CGTTGGACTTCGGGGATCATTCAGTAAAGACGGTATCGACGAATTACTCC
GTTCGATCGCTGTCGGCCGTGGACGCACTGAGAAATTAACAAACGGGTTA
CCGTCAATCAAGGCCGTTGAATCATGGGACGGGTTAGATGGAAAAATGCC
TGAAGAAGAAGATATTGATTTGAGCGATATTGAATTGGATGATCTCGATG
ATGAACCAAAGAAGAAAAACGATGAATTGTAAATTCCAAGTTCAAGGATA
TCCAACCATCAAATACTTCCGAGCCGGCGTCAAAGATTTCAACTCCGCCC
AAGATTTTCAGGGTGGGCGTACCGCCAGTGATATCATTGCATTTGCTTTG
GAACTCCACTCCGAATCCGTTGAACCACCAGAGATCATGGAATTGACTTC
AAACAAGATCTTAGAAGATAACTGCAACGAGAAACCACTCTGCATTGTGT
CTTTCTTACCTGATATCTTAGACACCCAAGCGTCCGGACGTAACAACTTT
TTGACCGTCTTACGTGAATTAGGAGACAAATACAAAGCTAAGCTATGGGG
ATGGGTTTGGACTTCAGCTGCCACTCACCAGAAATTAGAACAAGCTCTTG
GCATCGGTGGATTCGGATATCCAGCCATGGCTGTCGTCAATATTAGAAAG
AAGGTGTGGACATTGTCAAAGATTAGAGCCTGAATGGAAGAAAGCTGCAG
CTGAGCTCAAAGGAAAAGTCAAACTCGGAGCACTCGATGCTACTGCTCAC
CCAAATATGGCACAACGTCAAGCCGTGGTGGAAGTGGTGGAAGCGGCGGC
GGTAGCAGCGGTGATGCCGTTGTTGAATTAACCGACGCCAACTTCGAGAA
AGAAGTTTTGAACGCCAAAGAACCTGTTCTCGTTGAATTCTTTGCACCAT
GGTGCAAGAACCGCACAAGCTTTAGTTGATGAGGCTTTGAAAGCTGTACA
ACGCTCAGTGAAAGATAAATTGAATGGTCGTGGTGGTGTGTGGTCATTGC
AAAAGTCTTGCTCCAGAATGGAAGAAAGCTGCCAAAGCCTTGAAAGGAGT
TGTTTCAGTTGGTGCTGTCGATATGGATGTCCATGGTTCTGTAGGTGGAC
CATACAATGTTCGTGGATTCCCAACCATCAAAGTTTTTGGTGCCAATAAA
AATTCCCCACAAGATTACAATGTTACGTTATTGGCATGTGCCTGCTCAAT
TCAGGCCTTATACGATAGCTCTGATGATGTTGTGGAGCTCACCGGAGGAA
ATTTCAATCACAAAGTTATAAACAGTGATCAAATCTGGCTTGTAGAATTT
TATGCACCATGATGCAATATTTCTATGCCA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000079XLOC_000079Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000140-exon-sc0000001-1575043694:102393..102636TCONS_00000140-exon-sc0000001-1575043694:102393..102636Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1575043694:96127..96265TCONS_00000140-exon-sc0000001-1575043694:96127..96265Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1575043694:94113..94297TCONS_00000140-exon-sc0000001-1575043694:94113..94297Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1575043694:93488..93573TCONS_00000140-exon-sc0000001-1575043694:93488..93573Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1575043694:92718..92851TCONS_00000140-exon-sc0000001-1575043694:92718..92851Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1575043694:91627..91740TCONS_00000140-exon-sc0000001-1575043694:91627..91740Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1575043694:90988..91408TCONS_00000140-exon-sc0000001-1575043694:90988..91408Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1575043694:89321..90386TCONS_00000140-exon-sc0000001-1575043694:89321..90386Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1510915933:102393..102636TCONS_00000140-exon-sc0000001-1510915933:102393..102636Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1510915933:96127..96265TCONS_00000140-exon-sc0000001-1510915933:96127..96265Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1510915933:94113..94297TCONS_00000140-exon-sc0000001-1510915933:94113..94297Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1510915933:93488..93573TCONS_00000140-exon-sc0000001-1510915933:93488..93573Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1510915933:92718..92851TCONS_00000140-exon-sc0000001-1510915933:92718..92851Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1510915933:91627..91740TCONS_00000140-exon-sc0000001-1510915933:91627..91740Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1510915933:90988..91408TCONS_00000140-exon-sc0000001-1510915933:90988..91408Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1510915933:89321..90386TCONS_00000140-exon-sc0000001-1510915933:89321..90386Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1491911889:102393..102636TCONS_00000140-exon-sc0000001-1491911889:102393..102636Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1491911889:96127..96265TCONS_00000140-exon-sc0000001-1491911889:96127..96265Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1491911889:94113..94297TCONS_00000140-exon-sc0000001-1491911889:94113..94297Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1491911889:93488..93573TCONS_00000140-exon-sc0000001-1491911889:93488..93573Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1491911889:92718..92851TCONS_00000140-exon-sc0000001-1491911889:92718..92851Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1491911889:91627..91740TCONS_00000140-exon-sc0000001-1491911889:91627..91740Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1491911889:90988..91408TCONS_00000140-exon-sc0000001-1491911889:90988..91408Clytia hemisphaericaexon
TCONS_00000140-exon-sc0000001-1491911889:89321..90386TCONS_00000140-exon-sc0000001-1491911889:89321..90386Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000140-proteinTCONS_00000140-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:89321..102636 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
160.487 160.413 156.729 154.455 129.02 104.267 247.8 257.887 139.663 153.072 129.93 119.198 94.0568 77.7194 101.232 124.252 142.581 125.998 45.3305 73.5613 57.4005 59.5047 84.5397 82.8793 90.95 100.394 70.9512 50.0735 83.7782 65.4461
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013766Thioredoxin_domain
IPR005788Disulphide_isomerase
IPR017937Thioredoxin_CS
IPR012336Thioredoxin-like_fold
Vocabulary: Biological Process
TermDefinition
GO:0045454cell redox homeostasis
Vocabulary: Molecular Function
TermDefinition
GO:0016853isomerase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0045454 cell redox homeostasis
molecular_function GO:0016853 isomerase activity
Blast
BLAST of TCONS_00000140 vs. Swiss-Prot (Human)
Match: PDIA6 (Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1)

HSP 1 Score: 459.914 bits (1182), Expect = 1.211e-153
Identity = 228/422 (54.03%), Postives = 298/422 (70.62%), Query Frame = 1
Query:  235 FYAITLLACA--CSIQALYDSSDDVVELTGGNFNHKVINSDQIWLVEFYAPWCGHCKSLAPEWKKAAKALKGVVSVGAVDMDVHGSVGGPYNVRGFPTIKVFGANKNSPQDYNGARTAQALVDEALKAVQRSVKDKLNXXXXXXXXXXXXXXXXXXXDAVVELTDANFEKEVLNAKEPVLVEFFAPWCGHCQRLEPEWKKAAAEL----KGKVKLGALDATAHPNMAQRFQVQGYPTIKYFRAGVKDFNSAQDFQGGRTASDIIAFALELHSESVEPPEIMELTSNKILEDNCNEKPLCIVSFLPDILDTQASGRNNFLTVLRELGDKYKAKLWGWVWTSAATHQKLEQALGIGGFGYPAMAVVNIRKKVFVGLRGSFSKDGIDELLRSIAVGRGRTEKLTNG-LPSIKAVESWDGLDGKMP 1479
               + L++C    ++  LY SSDDV+ELT  NFN +VI SD +WLVEFYAPWCGHC+ L PEWKKAA ALK VV VGAVD D H S+GG Y V+GFPTIK+FG+NKN P+DY G RT +A+VD AL A+++ VKD+L GR G    G  G    SS   V+ELTD +F+K VL++++  +VEF+APWCGHC+ LEPEW  AA+E+    KGKVKL A+DAT +  +A R+ ++G+PTIK F+ G     S  D+ GGRT SDI++ AL+L S++  PPE++E+ +  I +  C E  LC+V+ LP ILDT A+GRN++L VL +L DKYK K+WGW+WT A    +LE ALGIGGFGYPAMA +N RK  F  L+GSFS+ GI+E LR ++ GRG T  +  G  P+I   E WDG DG++P
Sbjct:    3 LLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKG----ESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELP 420          
The following BLAST results are available for this feature:
BLAST of TCONS_00000140 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PDIA61.211e-15354.03Protein disulfide-isomerase A6 OS=Homo sapiens GN=... [more]
back to top