Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000129 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000129
Unique NameTCONS_00000129
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length392

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000129 ID=TCONS_00000129|Name=TCONS_00000129|organism=Clytia hemisphaerica|type=transcript|length=392bp
GAAGCAAACGGTTCAAAAGTGTTCAACCTTATTGCGACAGACAAGACCAT
AGTAGCCACCCCTTTTCAATCGACGACGGCGCATTATGGGCAATGCTTTA
GTATCTGCTCCTTAAATCTTAAATGTCTTTCTTTCGACCATTCCTACACA
TCTGACATTGGAGAATGCAGTTTCTATGACGTTGGAGTAGCAGTTTTTAA
CCAGACAACTAAATTCCAAGAAAAAATCGGTAGCAAGTATCATTCCATTC
ATATGGCCACTGATTGTGCTGACTGGTACAGACTGGGTCACCGTGAAAAT
GGCGTCTATGAGGTTCATCTGTTGTCTAAGTATAAGCGCCGTGTTTATTG
TCATATGGGGGCGGCTGAGGGCGGTTGGATGGCCTTTCAACG
Run BLAST on NCBI

protein sequence of TCONS_00000129-protein

>TCONS_00000129-protein ID=TCONS_00000129-protein|Name=TCONS_00000129-protein|organism=Clytia hemisphaerica|type=polypeptide|length=130bp
EANGSKVFNLIATDKTIVATPFQSTTAHYGQCFSICSLNLKCLSFDHSYT
SDIGECSFYDVGVAVFNQTTKFQEKIGSKYHSIHMATDCADWYRLGHREN
GVYEVHLLSKYKRRVYCHMGAAEGGWMAFQ
Run BLAST on NCBI

transcript from alignment at sc0000001:2656579..2666332+

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000129 ID=TCONS_00000129|Name=TCONS_00000129|organism=Clytia hemisphaerica|type=transcript|length=9754bp|location=Sequence derived from alignment at sc0000001:2656579..2666332+ (Clytia hemisphaerica)
GAAGCAAACGGTTCAAAAGTGTTCAACCTTATTGCGACAGACAAGACCAT AGTAGCCACCCCTTTTCAATCGACGACGGCGCATTATGGGCAATGCTTTA GTATCTGCTCCTTAAATCTTAAATGTCTTTCTTTCGACCATTCCTACACA TCTGACATTGGAGAATGTAGTTTCTATGATTTGTATCAGACAAATAATTT GAAGGAAAAGCCAGGGGTTAAGTTTTATTCCCAAACTTTACTTACTGCCA CTGATTGCGTTGATTGGTTTAATCTCGGCTACCGTAAAAATGGCATCTAT GAAGTCAATTTGTTGGGAAAATACATGCGCCGTGTTTATTGTCATATGCA GGCGGCCGAGGGCGGTTGGATGGCCTTTCAACGTCGATTTGATGGTAAGT TTTCGTAAAACCCGGGACACCCTCGTAAAATTCACTGAAAATGCTGAAGG ACTATTACAATATAGTATTAGCATTAAATAATTGGTATTAAAAGTGTATT TCAATAGCAGAAATGGAAAGTTTCGTAGATACAGATACAAAATCTCCAGG AAATGTATCCTCAAAATAGAGACCTTAGGAAACCATTACAACTACGCGGA TAGGTTCTATCGCGAAGTTTAACCTTATTCAAGAAAAGGGAAAGGTATCG CTAGAAGCGTCGGAAGATATTAATCAGGTTCAGCCTCGCAAAAAATCCTT CCCCCAGTGTCTTTTGATTGTCAAGGTAGACAATGACATTCTAGAACTCC CTTTCCgagaaggggggggggcacgcagttactacaagacagtatgacac ttactaccgtggtggtactgtattcagaagttatgaaaacagttactaNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNtttcaaaatttttcacaaaaa atgattttttttgtgaaaaaattctttgttaaaaaaaatatttttgttat aaatggacgaaaaaaaatttttctcagacccaactttccctaatttatca ttaaaatgttctcaacagctgttaaccaagtaaattaaaagaaaatctag cacaaaaatggctttaggttgaaaaataatcgcaatttagggtaatttcg agcatgtttttgatgatatcactcaaaaacaggggtggtacctggaaatc tttctgaaaacagttactaccaaggtgaaGTAACTGCAAAAGGTGGTGGT cctaaaaaaagtgttgaaaaagcactaactacacatcatgtcttgtagta actgcgtgcccccccccctgttccGAGACGTTAAAGATCGTATAATTGAG TGTGAAGGCAGTAGAGGCTTTAAGACTCGAATACGCACGAGGAACACAAA TTTATTCgggttaaggaaatttcgagttatggagtaaggtttataaagtA TTGTTAAATGAAGGGACCATAaatcttgttcgagttaagtagacttataa aggttcgagttaaagagactccactttACTAGACACCATGGCATTCTAGA AGTGTCTGTTTATTTCAACTCCCTTTCTGAGAGGTAAGAGGTCGTATAAT ACAGTGAAGTCtacataactcgaacacgcacgaaCAATATAGAGATATAC TTTTTGTTTATCCAACACACAGGgagtgtcaatttttttggtcGAAATTG GGAAGAATTCAAGAATGGTTTCGGGAATCCCGAGGGCGAATATTATCTTG GAAACGAACTTTTACATTTGCTGACAACCTCTGAAGACTATGATTATTTA GTAGAAGCACGAAGGCATGAGTCTGGGACTAGTGCTAGAAGAAAGTTGAT CCACAAGGTCCACATCGAGAGCGAAGAAGAAGATTACAAGATCCAATACA GATTGGAGGATATTAGTAATGTATTAcaatttatgtttttatttaaacCG TCGATCAAGTTAATTCCAATTAAGGGAACCAGAAGCCTCAAACACActtt caaaagcatttttttaatcttttaggTGTGGCTTTTTCTCTAAGATAATA TATCAATACATTTCTTTAGCCAACTTTTACAATTATGAGCTAAGCGTGAA GCTGCACTTCTACCCGACATTTGTGAcgaaattccgcgaaaatttcttct cgcgaaaatttcttcccttaaggtatttagATAACAAATATGTTTTCCTT TCCATAATAAACAGCTAAGAgaagcatttttttcatttatttacagAGCT ACGGTGGATCTTCGGCTTACGGAACTAATATGAGAGGCCAAAGGTTCTCC ACTTTTGACCGTGACCGGGGTAACGATAATTGTGCAAAAAAGTATGGGGC GTGGTGGCACGAGAGATGTCATACAGACGCAATGAATGGTCAATATTCCC ACAAAAAAGAACCAGTGTCTTTTGCCAACGGCATCATTTGGTATGATTGG ACAGGACATCAAGAGTCGCTCAAAAGTAGTTTGTTAATGGTACGACGTTC TTCGTTCAAACAGAGAATTCCATGAACAATTTATTATCATTTATTAAATG TTAACACTAGCCTGTTAGAGAAACACTGCTTATTTATTGTGTACgttaaa taaacaaataaaaatttggtcAGCGTTGTTGGTGGGTAGTTATTGGCTAC TGTCATCAGTGTTAAGTAGTCATAAActagaatgggctcttccagaaaaa attcgttcataggggggtggaggatattatttttttcatgaattacccct ggacattttgacttttaaccccctggacacgggttatacccctcgacaaa catcaaatcaacctcGTGGACGCAAAAaaatacccctggacattggaatt taccccctggacattgcgatttttttggtattttttcaatacccctggac aattcattcttcaccccccatgaacggattttttctggaagagtccaATA CCCATGTCTCAGTCTGGAGATATTATTTGATACGgtttacacgttgtttt ttataaaaacatccaaaaatttaaaagccttcgggtgttcttaacttttt aggttttaagcctaaaaatgttcttaaaatgttgttattttctcCGTTTT GTGACCTTTCATAcccattttcctgaaaaaatcgGGTTTTCAGTTGGAAA GCACACACTGAACCGCTGGGAAAAGGTTGATACGACTTTCCTATTTATTG AATATCGAACTTTGTTAATAATATAAGGCTGGCCTTAAAAAGATGTTGAT TCGCCGTCAGCCGACCAACTCTTCTTTAAACTTGCCGACTTTATTTTATT GCTATTTGatgaagagaattttttttcttcaaaaattaaaaaatgtgaac aaaaattcaatgaatgaccaaaaattccgaccgaccgacccacctccaaa atctagggtggggtgacggcaaaccaagaattttttaagtccagcctaac AAATATCTAAATAtatggaaaaatcaaaatataatagccgcattcttttt caccgtccaacataAATATATGGAATATGTACAGTAAACTGCAACGCCCA TGTCAAATGATATTATGTTGGAAAAAACATTGCAAGTTAGTTATTTGTGG ACACTTTATTTAGAGTAGTGAGTAAGACAtgaataattcatgatattcat gatgtaatcttttatacggaagcacacaaaataatccggaactagtggta aaatttgccactagtcttttgttattttgccactagttccgggttatctc gggtgcttccgtataaaagattacgtcatgaatatcatgaatacaccttt cccgtaattcgtaaaactaatgcgcaCGCATTATTTctatgctctccacc gtttggtctctggaggtaaacaaacccgtttttccCTGCGTTTCcttaga aaaagtttttttttgagcttttcttaagttctgtcgaacaaaacccccta aaattttagtatgttcaatctattcatgatattataccaccctgaaaatc ttttgccaaaagaagatcactatcaaaagttagaggctgaaaacccactt tccctaacccctcacaggcaaaaacgcgtttctTTATATGTATTCATATG ATCCAGCGACAAAGCACTCCGTttttgagcactctggtgacaGCAATGAT GCGTCCTTAAACACGTGACTGCGATATGCTCATCGATTTGATGATTTCTA ATAATATTCAATGGGGGTATCCTATTCTAGTTATGAATTTCATACCATAA Aactgggacgagatggagtttttacaagctcttatttggttttgttggtc gttaaccagtaataaaacaattttgttactttttctaaagaacgcgtaat ttttattacttcaaatgaccaattattgaccaagtatcttataaaaactc catctcatctgagtGTAATTGTATCTCTTCTGATAAAACTGATGACAAGC GCTCAGTGTTCTTTGGGCGTTTTCATATAAAAGATAACGTCATAAATATC AAGAATAACGCGAGGGTTGATAAGTTTGTCAACTTTAAAGATGAAGGGCG GTCTTAATGTAAAGAGTAGGAACATTCGGCGGGGTCATCATGACATCACA CACCTATACAccattttggattttgaaattcccatcgataattttttttt tactatgcAATAATCTAAATATTAAATCAAAACGTTACAATATATGATTT GCTTAAAATACGTACAGCTAGGaaatataattcaaaaataaaaaaaataa aacacacGACACAAATAAATATAGTATGTCAATACTATCGTTGTGGATGC TCAAAACAATTTCTCCATGCTTGAAGTTaccacaggaaaaaattattgat accCAAACCCATATGGAAATTTCAATTTACCCAtacggaaatttcaaatt atttttagtttgcgATTTTGACTTATGGATTTCAAGAGGTTTTGAAATAT TGCTTCCATTTCATTGTTTCTCCTTTATCATCGACAAAAtcatggaaaaa atttcaaaaaacttaataagcaggggggttggaataagaatgtcctgggt ggaaaattttcgaaaaattaatcagcggggggggggcggctgttaggtac ccgagagtacacaATCATCTATTTCaatcatataggaggatattttcaca aatggcGAAAATCCTGTGTATATCAAAAGCTGAGGATCAGATtgtgtgtt ttcttgaaatttctttGACTCGTATtgagatttagaacgccattgTTACT TCTTTTTATCTTGACTCATATCGAGGTACTTTCTTCCTTGTGGTCgtttt agatcactagtttttcATTGATGGATTTCGATgtcatcaaattttctttt tcaattccaACCTGATGATTCTATGTGAATATTCATTCTTTCTAGACTTT GTTGTTAAATCATGTATGTCCTTTTGTTAAATATACAGTATGCAGatctg acgagtcctaataaggacgaaatgtaTATGCTGCTCTGCTATAATCCTAT TTCAATCGAGCTTGGGAAAGTGGGTGTCAAAAGATAAACTCGTGAAAGCA GCTAAACGAGTTGGTATAACAGACACTGGTTTGAATGTTCACTGGATGAA ATTTCAGTCCGCTGCCAGTTTGCTTCACAGCACACCTATTGTACAAAAAC CAACACAGTCGAATTCGTCTATTCAATCACCGTTAAACGTGAGGAAAGGA ACCGCACGTCATATCataaatacaaatatgaacagtCGATGAAAAGGATA CAAGAGCTCGAAAATTCGATACCTTCACTCGACGAAATAGATCTTCTGTG CATCTAAATCAAACCTAAGGAAGCTTCATCAAAGAAACATAAAATCACAC AAGTACACGGTTCGATGCGTGCAAATGACATCATCAAAGCTGCCGAGAAA ATACCTGCCGATAAAGAAGAGAAAGGAAACAAGAAAAAACAGTTGATCGA GAAAAAGCAGCACGAAAAAGAACCCTTTTACCGATGCAAGACAAAGTGTG TCTGTATTGGAAAATGTGCTGCGGCTGTCTTCAATGAATGTTCCGTGTGT CATAACATTCTAAAATCACAATGTACCAAGGAGCCTGGTGAAAAGCCAGT TATGTTACAAGTAGAGGGGGGGGGTAGAAAAAGGGGCAAAACCAGCAAAA GGATAATATTTGCAGAGGACTCGTCAGACGATGATTTCGAATGATGTATT TATTATCCTTCGTTATTTTGAATTAAATATTACATCGATACTTTttaaag tccattcgctttaagGGTGCACTCTCTTGCGCTACCATGTGGAAACCATG TCAGTGTCTAATTTCCCACTTTGCTTTACTACCATGTAGAAACCACATGG TAGTAAAGCaaagtgcacacttaaagcaaaTGGACTTTCTAAACTACATT ATACATTGCgttagtttgaaaattgattgaTTCTTGTTTTGCTCCTTAtt cattcatttttcaatttgagtaatttaacGTAAATAAAGTTATGATAGAG TTTGATCTGGgtctttcaatgtttttatgtGCTTTTTAGTTGGAGTTAAA TGGTTTTTATGTTCTTTACCtcttattttccaaaaatttaccGCTTTTCA ACATTCGAGAtttgaacaagtgatactttgatgaacctacctggattatg catttaacacgtttataattgatatctacgtgacgtgaccattaaacaat cattcagaacacaaatagtgatgatgtattaaaattagtcgtttgtttct tataaaaaaaacgtttagaaaccaaaatttcatgctcttgttctttcata ttcaagatttcgtgagcaaaaaaacatctccaaaaaatttagtaatttgg ctaagaacattgatgtatgtttattaatagtgattcttattgatcaagat gctttttttgagctgaaaaattcattttttacaaaagtctgctcgagcca tcttttatctactttcatacaaaaaatcagtcCAAAAAACAATTGTCCAA TATTTcgctaagtccaaaaaacccttttatggccgtttttttagctgaaa tttactcaaattttttttctcaaaaaatcgggTTCCTNttttttagctga aatttaccccaaagttttccccaaaaaaatcgagctccttcacattcgag gatttatagttatgcatctttgtgcaaaaaatcgtaaaaaatgaaagagc caatcaatctaatacctaagcaattgataatgtgctcataaaaaatatcg aatttggccagtttttctataaaaacacgccaaacaaccaaatttcctgt ctaaacactcgtgagaaaaaaaaacatctatctcataaaaaaattgagta atttgactgagaacattgatgtatgcttattaatagtgattcttgtagtt aaacatgcgttttttgagccaacaaaatttttttgcaaaaatctgcttga gccatcttatacctatgatggtaccctactttcgtgcaaaaaatcagaaa aaattaatgatccaattttttagccgttttttggcccaaatttgccccca aaatttttttttcgaaaatcgggctccgtcacattttgggcattgccatt ttgcatcattgtgcaaaaaatcagaaaaaactaatgagccaatcatgaga aaagctggtaactaacggacggacagacggacggacggacaaaggttaat ttataggacctccaccggggtaggtccaacaataaTGAGTTCTTATCGTC ATTTAGATCAAAATTGGCCCACGGAATGCTGGTCATATAAAATTtgatgt agtttttttcacagATTTGTCAAGCTTTTATGTTTCTTGAAATAAGCAGC TTTAAGGATATATTATAATTATTGTACCACCTTTTATCGAGTtgattttt atagttttttttatatagacGAAGTTATTGGAAGAAACTGTATTTTTACG TTTCGTACGTCAAATACATCACCCGAATTTCATCCAAAACACGCTTGCTT ACTCTTTCTTTTTATATTGTGATGTATCTTACATGCTTTTTGACCAAACT AATTCAAATGTGCAATGTTGTTGACATTAGTTCAAACTTTAcagccaatt ttcgaaaaacctgCATTCTGTGGGCCACCTGCATTCTGTGGGCCAGGAAC TGTGTaggagaatatttttttttctcgggGAGTATAAAAAATGACCTTCA AACACAAGTTCTAAATAATGAATTGTTCAATAGATTGAATGGTTTCCCAT GGATAGATTGAATATGGTTTTCCCGTTATGGTTTCCCATGGGTTTTGAAA GATTTCATCATGCCagatctttttaaaatttgaaatctcaTTCAACTCCT TTTTCATTTCTTATCAAACGTATAATTCTTTTGCCTTGATAAGTCACAGT TCATTCGTTCTTTGATTGACACAACGCGATTGACCAATAAATTACAAATA AGTTGAGAAACGATAcatgttctttttttattagaacaatttaGAATAGc taaatatttagaaaaaaaaggcTCAAACAAGTCAAAACCTTAGCACAAAT TAGAAAATGATTCAAGTCTCTGATTCCAGAGAAGACTCAGAACATTCTGA TTTAAAAACAACAAGCAAATAGCAATACAGTCAACtatctctctttaatt cgaacctctattattcgaatcttcctataattcgaactcaaatACAAGTC CCGGGatgggatttaattttgcggttcacATCTCAAAATTCGGAAGTTTC GCGGAATTTGATTTTTGTACTTACTTTTTAAAGAATGTTTTACTTGAACt ttgttaagaacattttaagaataaagccagaaaaaaagaaaagtcaaGTC CAACTCAAATTCACtggttcttataataaaagcgTACGATTCTCGCTTCA AAATTTTGTCGACTTTGTTGACAAGATCACTAAATGTGAGAGTTTTTCTT CAAACGTTGCATAGTAATTGTTTCTATAGTTAAAGGAATTGAGATCATCC CCACGAAATAGTGAATTGTGACGGCCAAAATAAGACATTGAATATTCTCT GAATATAAATGGTCGATTGTGATGAATGAACGATAAAAGCATAGTTTCCA TTATTgactttttcaacaaaaataaatttaatttattttaaaaatatttt ttcaattgaaatGACACTTTTAGTGTGGTTCAGAGGAAATTGACACCAGA GTTTGACAGGTATGAAGATGTTTTTGTTCAATGCGGTGCTTGGGATTTTC TTCATAGCTAATGAAGCTAATGGTTCAAAAGTATTCAACCTTATTGCAAT AGACAAGGGCATTGTAGTCGCTCCTTTTCATTCGACGACGGCGCATTATC GTCAATGCTTTAGTATCTGCTCCTTAAATCCCAAATGTCTTTCTTTCGAC CACTCCTACACATCGGACATTGGAGAATGCAGTTTCTATGACGTTGGAGT AGCAGTTTTTAACCAGACAACTAAATTCCAAGAAAAAATCGGTAGCAAGT ATCATTCCATTCATATGGCCACTGATTGTGCTGACTGGTACAGACTGGGT CACCGTGAAAATGGCGTCTATGAGGTTCATCTGTTGTCTAAGTATAAGCG CCGTGTTTATTGTCATATGGGGGCGGCTGAGGGCGGTTGGATGGCCTTTC AACG

Coding sequence (CDS) from alignment at sc0000001:2656579..2666332+

>TCONS_00000129 ID=TCONS_00000129|Name=TCONS_00000129|organism=Clytia hemisphaerica|type=CDS|length=780bp|location=Sequence derived from alignment at sc0000001:2656579..2666332+ (Clytia hemisphaerica)
GAAGCAAACGGTTCAAAAGTGTTCAACCTTATTGCGACAGACAAGACCAT
AGTAGCCACCCCTTTTCAATCGACGACGGCGCATTATGGGCAATGCTTTA
GTATCTGCTCCTTAAATCTTAAATGTCTTTCTTTCGACCATTCCTACACA
TCTGACATTGGAGAATGCAGTTTCTATGACGTTGGAGTAGCAGTTTTTAA
CCAGACAACTAAATTCCAAGAAAAAATCGGTAGCAAGTATCATTCCATTC
ATATGGCCACTGATTGTGCTGACTGGTACAGACTGGGTCACCGTGAAAAT
GGCGTCTATGAGGTTCATCTGTTGTCTAAGTATAAGCGCCGTGTTTATTG
TCATATGGGGGCGGCTGAGGGCGGTTGGATGGCCTTTCAAGAAGCAAACG
GTTCAAAAGTGTTCAACCTTATTGCGACAGACAAGACCATAGTAGCCACC
CCTTTTCAATCGACGACGGCGCATTATGGGCAATGCTTTAGTATCTGCTC
CTTAAATCTTAAATGTCTTTCTTTCGACCATTCCTACACATCTGACATTG
GAGAATGCAGTTTCTATGACGTTGGAGTAGCAGTTTTTAACCAGACAACT
AAATTCCAAGAAAAAATCGGTAGCAAGTATCATTCCATTCATATGGCCAC
TGATTGTGCTGACTGGTACAGACTGGGTCACCGTGAAAATGGCGTCTATG
AGGTTCATCTGTTGTCTAAGTATAAGCGCCGTGTTTATTGTCATATGGGG
GCGGCTGAGGGCGGTTGGATGGCCTTTCAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000071XLOC_000071Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000129-proteinTCONS_00000129-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000129-exon-sc0000001-1491911889:2656579..2656734TCONS_00000129-exon-sc0000001-1491911889:2656579..2656734Clytia hemisphaericaexon
TCONS_00000129-exon-sc0000001-1510915933:2656579..2656734TCONS_00000129-exon-sc0000001-1510915933:2656579..2656734Clytia hemisphaericaexon
TCONS_00000129-exon-sc0000001-1575043694:2656579..2656734TCONS_00000129-exon-sc0000001-1575043694:2656579..2656734Clytia hemisphaericaexon
TCONS_00000129-exon-sc0000001-1491911889:2666097..2666332TCONS_00000129-exon-sc0000001-1491911889:2666097..2666332Clytia hemisphaericaexon
TCONS_00000129-exon-sc0000001-1510915933:2666097..2666332TCONS_00000129-exon-sc0000001-1510915933:2666097..2666332Clytia hemisphaericaexon
TCONS_00000129-exon-sc0000001-1575043694:2666097..2666332TCONS_00000129-exon-sc0000001-1575043694:2666097..2666332Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2656579..2666332 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.193867 0.378103 0.439013 0.644259 0 0.206594 0.249247 0 0.326737 0 0.392827 0 3.09444 1.339 0 0.236275 0 0.298339 7.41907 10.567 0.187442 1.37141 0.222285 0.606267 1.04073 1.6719 0.265831 0 0 0.219232
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR014716Fibrinogen_a/b/g_C_1
IPR002181Fibrinogen_a/b/g_C_dom
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000129 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top