TCONS_00000108 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000108
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length941

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000108 ID=TCONS_00000108|Name=|organism=Clytia hemisphaerica|type=transcript|length=941bp
TGAAAAATCATCTGCAAACAGTTTCAAATTGTCAAGTTCAGTGTAAACAA
CAAGACAACAAACACTCTCAAAGATGAAGATTTGGAAAGCTTTGTTACTC
GTCTCGTTCTTGGTGTACACAGTTCACTGTGAAACAGAACAAGAGGCGAA
AGAAGCAAACATTGAAGCAGAGGAGGATGAACTTCCAGGAATGGAAATGA
GTGACGAAGAAACGATCAACCAACAAGAAGATGCAGATGAAGAAGAAATG
AAAGATGAACTTGAAGATCAAGATCTGAAAGAAGATGAAGACGCCAGCTA
CAAGCGATTTCTTTACGCCAAGAAGATCTTCATCTTCAAAGACAAACACC
CTGTTCAATGTCAACTCACCAAAAGCAGTAACAAACCAATCAGATGATAC
CTCAAGTACGCATACGTCAAACGTCATGGTAACAAATGCATCAAAAAGAA
AGTGTATAAATTTTGCGTTTTCAAATTCACAAAGACCTGTTTGTTCACAT
CCAAATTCATCATCAAGAAATGTTTCAGAATCAGACATGGTGGAGGCTAC
AAAGTCAAATGTCATAAAAGTGCACCACAGTtggtcaaaattcgaaaatc
tGCAGGTGTCATCAATAAAGCCAAATTGGTCAAAGTCTATTACATCAAAC
ACTAGATCTAGACTTTCAACCGAATCGGAGCAAATGAACTGACAAGATTT
CTAAACGGACAACAATTTTTAACTAGCtgctttttataatttttatgtgT
TTGTAAGCTTACATTTTTAAAATCGCTAAATAATATTTGCCAAAAAGGGA
ATTTACTCTTTCGTTTTAAACTATCCTTATTTGATCTTCGGGCATCTTAA
AGTTAAGGTTCTCACCCGTCTGATTTCCCTTCAATGACAGTAAATATAAG
TTTCACTTGGACTTGTGAGTCAAATCTtcctttcaattttc
Run BLAST on NCBI

protein sequence of TCONS_00000108-protein

>TCONS_00000108-protein ID=TCONS_00000108-protein|Name=TCONS_00000108-protein|organism=Clytia hemisphaerica|type=polypeptide|length=107bp
MKIWKALLLVSFLVYTVHCETEQEAKEANIEAEEDELPGMEMSDEETINQ
QEDADEEEMKDELEDQDLKEDEDASYKRFLYAKKIFIFKDKHPVQCQLTK
SSNKPIR
Run BLAST on NCBI

transcript from alignment at sc0000001:1974723..1975839+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000108 ID=TCONS_00000108|Name=TCONS_00000108|organism=Clytia hemisphaerica|type=transcript|length=1117bp|location=Sequence derived from alignment at sc0000001:1974723..1975839+ (Clytia hemisphaerica)
TGAAAAATCATCTGCAAACAGTTTCAAATTGTCAAGTTCAGTGTAAACAA CAAGACAACAAACACTCTCAAAGATGAAGATTTGGAAAGCTTTGTTACTC GTCTCGTTCTTGGTGTACACAGTTCACTGTGAAACAGAACAAGAGGCGAA AGAAGCAAACATTGAAGCAGAGGAGGATGAACTTCCAGGAATGGAAATGA GTGACGAAGAAACGATCAACCAACAAGAAGATGCAGATGAAGAAGAAATG AAAGATGAACTTGAAGATCAAGATCTGAAAGAAGGTGAGAATTTTACTTA AGCCTCTATATATTTTAGTTTACTTTATCTTCTTCTTTCACACCAAAGTA AAGCAAAAGCTTTACGTCTGAACTTtgaaccttttttttttaattcagaa TTTTTCTAATCATAAGCCAGTCAATTGAAATTTGAATAAGGCTTTTTACT CCGGTTTCAGATGAAGACGCCAGCTACAAGCGATTTCTTTACGCCAAGAA GATCTTCATCTTCAAAGACAAACACCCTGTTCAATGTCAACTCACCAAAA GCAGTAACAAACCAATCAGATGATACCTCAAGTACGCATACGTCAAACGT CATGGTAACAAATGCATCAAAAAGAAAGTGTATAAATTTTGCGTTTTCAA ATTCACAAAGACCTGTTTGTTCACATCCAAATTCATCATCAAGAAATGTT TCAGAATCAGACATGGTGGAGGCTACAAAGTCAAATGTCATAAAAGTGCA CCACAGTtggtcaaaattcgaaaatctGCAGGTGTCATCAATAAAGCCAA ATTGGTCAAAGTCTATTACATCAAACACTAGATCTAGACTTTCAACCGAA TCGGAGCAAATGAACTGACAAGATTTCTAAACGGACAACAATTTTTAACT AGCtgctttttataatttttatgtgTTTGTAAGCTTACATTTTTAAAATC GCTAAATAATATTTGCCAAAAAGGGAATTTACTCTTTCGTTTTAAACTAT CCTTATTTGATCTTCGGGCATCTTAAAGTTAAGGTTCTCACCCGTCTGAT TTCCCTTCAATGACAGTAAATATAAGTTTCACTTGGACTTGTGAGTCAAA TCTtcctttcaattttc

Coding sequence (CDS) from alignment at sc0000001:1974723..1975839+

>TCONS_00000108 ID=TCONS_00000108|Name=|organism=Clytia hemisphaerica|type=CDS|length=648bp|location=Sequence derived from alignment at sc0000001:1974723..1975839+ (Clytia hemisphaerica)
ATGAAGATTTGGAAAGCTTTGTTACTCGTCTCGTTCTTGGTGTACACAGT
TCACTGTGAAACAGAACAAGAGGCGAAAGAAGCAAACATTGAAGCAGAGG
AGGATGAACTTCCAGGAATGGAAATGAGTGACGAAGAAACGATCAACCAA
CAAGAAGATGCAGATGAAGAAGAAATGAAAGATGAACTTGAAGATCAAGA
TCTGAAAGAAGATGAAGACGCCAGCTACAAGCGATTTCTTTACGCCAAGA
AGATCTTCATCTTCAAAGACAAACACCCTGTTCAATGTCAACTCACCAAA
AGCAGTAACAAACCAATCAGATGAATGAAGATTTGGAAAGCTTTGTTACT
CGTCTCGTTCTTGGTGTACACAGTTCACTGTGAAACAGAACAAGAGGCGA
AAGAAGCAAACATTGAAGCAGAGGAGGATGAACTTCCAGGAATGGAAATG
AGTGACGAAGAAACGATCAACCAACAAGAAGATGCAGATGAAGAAGAAAT
GAAAGATGAACTTGAAGATCAAGATCTGAAAGAAGATGAAGACGCCAGCT
ACAAGCGATTTCTTTACGCCAAGAAGATCTTCATCTTCAAAGACAAACAC
CCTGTTCAATGTCAACTCACCAAAAGCAGTAACAAACCAATCAGATGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000056XLOC_000056Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000108-proteinTCONS_00000108-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000108-exon-sc0000001-1491911889:1974723..1975006TCONS_00000108-exon-sc0000001-1491911889:1974723..1975006Clytia hemisphaericaexon
TCONS_00000108-exon-sc0000001-1510915933:1974723..1975006TCONS_00000108-exon-sc0000001-1510915933:1974723..1975006Clytia hemisphaericaexon
TCONS_00000108-exon-sc0000001-1575043694:1974723..1975006TCONS_00000108-exon-sc0000001-1575043694:1974723..1975006Clytia hemisphaericaexon
TCONS_00000108-exon-sc0000001-1491911889:1975183..1975839TCONS_00000108-exon-sc0000001-1491911889:1975183..1975839Clytia hemisphaericaexon
TCONS_00000108-exon-sc0000001-1510915933:1975183..1975839TCONS_00000108-exon-sc0000001-1510915933:1975183..1975839Clytia hemisphaericaexon
TCONS_00000108-exon-sc0000001-1575043694:1975183..1975839TCONS_00000108-exon-sc0000001-1575043694:1975183..1975839Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1974723..1975839 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.805575 0.708942 0.44808 0.374662 0.261441 0.258243 0.186935 0.338332 0.163368 0.151769 0 0.0645573 0.0967041 0.0334787 69.3487 6.68451 0 0.111877 0 0 0.093721 0.205712 0.388998 0.252611 0.0520367 0 0.0664577 0.141851 0.215178 0
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000108 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php