TCONS_00000107 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000107
Unique NameTCONS_00000107
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length681

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000107 ID=TCONS_00000107|Name=TCONS_00000107|organism=Clytia hemisphaerica|type=transcript|length=681bp
CAGAACGATTTGAAGCGTGAAAAGAAGAGGATCGAATCTTTGATCCGTGA
ACGCAATGCTTACAGAGAAGAGGCTCACGCGAATAGTATGAAGAAGATTG
AAACCAACAAAAAGCTTGAGGCCACCAAAGAACACTTGCAAACAATCAAG
CAAGAATATGAACATAAAATTGCTCAAATGCAAACCATCCAAGAAGCAGA
GGCAGCGGGTAAGCAAAAGCAAAGAAAACGCAAGAGAAAATCTAAACAAG
TTACCTCCAACGATATCGAAGCAAATACCCTGATCGTTGCTACACAATGT
AAGAAAGACCTTCCAAAGCCACAAGAAGCAAAGAGTAACAATCCAAACAA
AGATCGACCAAAAAAATCAGATCTTGACAATGGAAAGATAGAAAAAGTCA
CTAAAGTACAAAAAAGTACGGCTCAACGAAGAAGTCAGTCAAAAGCATCT
AAGAACATTGTTTGTACGACGCCAGATGCTATTTTCGACCAACATGATAA
CGAAAGGCCGTGGAGCGTATATGACACTTCACTTATCACCTTTTGTATCG
GAATATGGTTTCTTCTCATCAAGATCTGCAGCATTGTCACCAACGATGAC
TCACTCTGGTAGTAACGTCATCTCCAAATCATATGTATACATTTGTAAAT
AACTTCTCACACTggatattttatattattt
Run BLAST on NCBI

protein sequence of TCONS_00000107-protein

>TCONS_00000107-protein ID=TCONS_00000107-protein|Name=TCONS_00000107-protein|organism=Clytia hemisphaerica|type=polypeptide|length=203bp
QNDLKREKKRIESLIRERNAYREEAHANSMKKIETNKKLEATKEHLQTIK
QEYEHKIAQMQTIQEAEAAGKQKQRKRKRKSKQVTSNDIEANTLIVATQC
KKDLPKPQEAKSNNPNKDRPKKSDLDNGKIEKVTKVQKSTAQRRSQSKAS
KNIVCTTPDAIFDQHDNERPWSVYDTSLITFCIGIWFLLIKICSIVTNDD
SLW
Run BLAST on NCBI

transcript from alignment at sc0000001:1955818..1957888+

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000107 ID=TCONS_00000107|Name=TCONS_00000107|organism=Clytia hemisphaerica|type=transcript|length=2071bp|location=Sequence derived from alignment at sc0000001:1955818..1957888+ (Clytia hemisphaerica)
CAGAACGATTTGAAGCGTGAAAAGAAGAGGATCGAATCTTTGATCCGTGA ACGCAATGCTTACAGAGAAGAGGTAAGATTAGCTTTTTATTCCAATAAAT TACCATCGATCAGCATCGATAAAGAATTTTTAGGAACTGAATAGCTAGAT AGCTAGGTTGTGTGAGTCCCTAAGACAATGTTTGAATGATTGTTTGATAA TCAAACACTTCCCCCTGTGCTTCTGCAATTTTTTTCCGTCAGCGAACGCA GACCTgatttaacggccgaagacctgaattaacggccgaagacctgaatt aacggtCAAAGACCTGAATTTCGAGCCGAAGACCTGATTCAACGGTCGAG GACCTGATTTAACAAGTCACCGGCCGAATACCTGATAAATAAGTTAGAGT TCCCTTGCATTCAAATAAACACAATAGTACGAGAAAAATGAATAGTAAGA ATGGTAGATCGACAGGACAGTGATAGTGGGTATTAGAAATGTTTACCCTC TAATGAAATAAAGGCTATTCTTTTGGCTACGATtaatattttttgaacat ttagCGAGGAAAAGCCGTAAAGGTTTTCAAAAAGAGCTCTAAAGGTCTCG ATTATGCCAGTGTTATTGAAATTCTATTTCAGGCTCACGCGAATAGTATG AAGAAGATTGAAACCAACAAAAAGCTTGAGGCCACCAAAGAACACTTGCA AACAATCAAGCAAGAATATGAACATAAAATTGCTCAAATGCAAACCATCC AAGAAGCAGAGGCAGCGGGTAAGCAAAAGCAAAGAAAACGCAAGAGAAAA TCTAAACAAGTTACCTCCAACGATATCGAAGCAAATACCCTGATCGTTGC TACACAATGTAAGAAAGACCTTCCAAAGCCACAAGAAGCAAAGAGTAACA ATCCAAACAAAGATCGACCAAAAAAATCAGATCTTGACAATGGAAAGATA GAAAAAGTCACTAAAGTACAAAAAAGGTATCTATGCTCTATTCTTCTACA ATCAGTGTCATAACATTggcaattttggcaattttggcaattttaccatt tttcgaaaattgaagttcgtNGTGTCATAACATTggcaattttggcaatt ttggctattttaccatttttcgaaaattgaagttcgagcgagaaagtcaa tttcgggccttcaacttgatctCATGgaatatttcgatctgggagggatt tattggtttctaggctatatttcaagccctatcGGACCatctttgaactt ttggatcctcacgTCCTAgggtcttaagtctagcgttaaaactcagagtN CATGgaatatttcgatctgggagggatttattggtttctaggctatattt caagccctatcGGACCatctttgaacttttggatcctcacatcctagggt cttaagtctagcgttaaaaagatagagttaaaactctacctttgCAACCT AATTtggagcacttccaaatcgtttgtggttataagatttcgtggggaat ttcccttttgtgccaagtattttggaacTGATTGTAGACATTTTCAATGA TTGCCAATTCACCCTTTCGACCGTATCCGCCAACTGCCGCGCGGGCTCTT TTTTGTCTGTTTATTACCCTAAACTCGCATAGTCTTTTTTTCCCCacata aatacaaaagaaaaacgtATCAAAAAAGAATGGATCTAGTTTAGGGGGAG AATTAAGTAATCGGTCGAAAAAGGCGTACTTTAACTTCTTTTTACAATGG TAAAAGATTGGTAAAGCTTTCTTTTCATTAAACATTATCTTCCACTGATT TTATAGTACGGCTCAACGAAGAAGTCAGTCAAAAGCATCTAAGAACATTG TTTGTACGACGCCAGATGCTATTTTCGACCAACATGATAACGAAAGGCCG TGGAGCGTATATGACACTTCACTTATCACCTTTTGTATCGGAATATGGTT TCTTCTCATCAAGATCTGCAGCATTGTCACCAACGATGACTCACTCTGGT AGTAACGTCATCTCCAAATCATATGTATACATTTGTAAATAACTTCTCAC ACTggatattttatattattt

Coding sequence (CDS) from alignment at sc0000001:1955818..1957888+

>TCONS_00000107 ID=TCONS_00000107|Name=TCONS_00000107|organism=Clytia hemisphaerica|type=CDS|length=1836bp|location=Sequence derived from alignment at sc0000001:1955818..1957888+ (Clytia hemisphaerica)
CAGAACGATTTGAAGCGTGAAAAGAAGAGGATCGAATCTTTGATCCGTGA
ACGCAATGCTTACAGAGAAGAGGCTCACGCGAATAGTATGAAGAAGATTG
AAACCAACAAAAAGCTTGAGGCCACCAAAGAACACTTGCAAACAATCAAG
CAAGAATATGAACATAAAATTGCTCAAATGCAAACCATCCAAGAAGCAGA
GGCAGCGGGTAAGCAAAAGCAAAGAAAACGCAAGAGAAAATCTAAACAAG
TTACCTCCAACGATATCGAAGCAAATACCCTGATCGTTGCTACACAATGT
AAGAAAGACCTTCCAAAGCCACAAGAAGCAAAGAGTAACAATCCAAACAA
AGATCGACCAAAAAAATCAGATCTTGACAATGGAAAGATAGAAAAAGTCA
CTAAAGTACAAAAAAGTACGGCTCAACGAAGAAGTCAGTCAAAAGCATCT
AAGAACATTGTTTGTACGACGCCAGATGCTATTTTCGACCAACATGATAA
CGAAAGGCCGTGGAGCGTATATGACACTTCACTTATCACCTTTTGTATCG
GAATATGGTTTCTTCTCATCAAGATCTGCAGCATTGTCACCAACGATGAC
TCACTCTGGTAGCAGAACGATTTGAAGCGTGAAAAGAAGAGGATCGAATC
TTTGATCCGTGAACGCAATGCTTACAGAGAAGAGGCTCACGCGAATAGTA
TGAAGAAGATTGAAACCAACAAAAAGCTTGAGGCCACCAAAGAACACTTG
CAAACAATCAAGCAAGAATATGAACATAAAATTGCTCAAATGCAAACCAT
CCAAGAAGCAGAGGCAGCGGGTAAGCAAAAGCAAAGAAAACGCAAGAGAA
AATCTAAACAAGTTACCTCCAACGATATCGAAGCAAATACCCTGATCGTT
GCTACACAATGTAAGAAAGACCTTCCAAAGCCACAAGAAGCAAAGAGTAA
CAATCCAAACAAAGATCGACCAAAAAAATCAGATCTTGACAATGGAAAGA
TAGAAAAAGTCACTAAAGTACAAAAAAGTACGGCTCAACGAAGAAGTCAG
TCAAAAGCATCTAAGAACATTGTTTGTACGACGCCAGATGCTATTTTCGA
CCAACATGATAACGAAAGGCCGTGGAGCGTATATGACACTTCACTTATCA
CCTTTTGTATCGGAATATGGTTTCTTCTCATCAAGATCTGCAGCATTGTC
ACCAACGATGACTCACTCTGGTAGCAGAACGATTTGAAGCGTGAAAAGAA
GAGGATCGAATCTTTGATCCGTGAACGCAATGCTTACAGAGAAGAGGCTC
ACGCGAATAGTATGAAGAAGATTGAAACCAACAAAAAGCTTGAGGCCACC
AAAGAACACTTGCAAACAATCAAGCAAGAATATGAACATAAAATTGCTCA
AATGCAAACCATCCAAGAAGCAGAGGCAGCGGGTAAGCAAAAGCAAAGAA
AACGCAAGAGAAAATCTAAACAAGTTACCTCCAACGATATCGAAGCAAAT
ACCCTGATCGTTGCTACACAATGTAAGAAAGACCTTCCAAAGCCACAAGA
AGCAAAGAGTAACAATCCAAACAAAGATCGACCAAAAAAATCAGATCTTG
ACAATGGAAAGATAGAAAAAGTCACTAAAGTACAAAAAAGTACGGCTCAA
CGAAGAAGTCAGTCAAAAGCATCTAAGAACATTGTTTGTACGACGCCAGA
TGCTATTTTCGACCAACATGATAACGAAAGGCCGTGGAGCGTATATGACA
CTTCACTTATCACCTTTTGTATCGGAATATGGTTTCTTCTCATCAAGATC
TGCAGCATTGTCACCAACGATGACTCACTCTGGTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000055XLOC_000055Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000107-exon-sc0000001-1491911889:1955818..1955889TCONS_00000107-exon-sc0000001-1491911889:1955818..1955889Clytia hemisphaericaexon
TCONS_00000107-exon-sc0000001-1510915933:1955818..1955889TCONS_00000107-exon-sc0000001-1510915933:1955818..1955889Clytia hemisphaericaexon
TCONS_00000107-exon-sc0000001-1491911889:1956450..1956793TCONS_00000107-exon-sc0000001-1491911889:1956450..1956793Clytia hemisphaericaexon
TCONS_00000107-exon-sc0000001-1510915933:1956450..1956793TCONS_00000107-exon-sc0000001-1510915933:1956450..1956793Clytia hemisphaericaexon
TCONS_00000107-exon-sc0000001-1491911889:1957624..1957888TCONS_00000107-exon-sc0000001-1491911889:1957624..1957888Clytia hemisphaericaexon
TCONS_00000107-exon-sc0000001-1510915933:1957624..1957888TCONS_00000107-exon-sc0000001-1510915933:1957624..1957888Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000107-proteinTCONS_00000107-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1955818..1957888 +
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0751647 0.0732974 0.510632 0.416311 0.101364 0.080099 0 0.0904695 0 0.0784566 0 0.0500593 0 0 0.128043 0.0458033 0 0.0578347 0 0 0.0726735 0.106343 0 0 0.242103 0 0 0 0 0
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000107 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php